Search Results

Unit 8: Renaissance Figures 2026-04-21

35 Items: BooksDramaComedyAnatomyEmotionTheaterCultureVesaliusIsabellaLeonardoLiteracyUniversePrintingPaintingGutenbergElizabethCuriosityDiscoveryAstronomyEducationSculptureCopernicusCreativityInnovationExperimentDissectionLiteratureShakespeareRenaissanceObservationExplorationPerspectiveMichelangeloHeliocentricCommunication

SCHOOL 2026-05-17

35 Items: ARTDESKMATHMASTPAPERCHAIRTIMESPENCILRESESSIREADYERASERTEACHERREADINGSHARPIECRAYLONMARKERSFRIENDSHOMEWORKSTUDENTSWRITEINGFRACIONSDECIMALSMATHGROUPDIVIDEINGLUNCHTIMEPRINSEIPALDIONOSTICSWHITEBOARDEXPOMARKERSUBTEACHERSHEETOFWORKREADINGGROUPCOLAREDPENCILPARENTCONFRENCESSTHESUCKUPTOTEACHERS

Teaching 2014-12-02

35 Items: artmathbandtrackdeskshealthchoruscivicsrecessshapesalgebraenglishsciencebiologynumbersspanishstudentssubjectsfootballbaseballprincipalcomputerssuspendedcafeteriaattendancetechnologyvolleyballnumberlinemediacenterspreadsheetinstrumentsfrontofficesocialstudiesphysicaleducationassistantprincipal

WELCOME BACK CALCIUM! 2023-08-22

35 Items: artgymprekspedbocesmflacmusicgrowthhealthnursesrecesscalciumlibrarylearningsnowdaysstudentswarriorsadventurebidsheetscafeteriacustodialattendancefirstgradefriendshipthirdgradeindianriverourownstorysecondgradeamazingaidesconstructionkindergartennewyearnewyouadministrationbestofficestaffterrificteachers

Anniversary Party 2024-02-23

35 Items: tinwaxairartironwoodwoolsilklacegoldfirefoodpaperfruitsteelchinawaterstonemusictoolscoralcottoncopperbronzewillowsilverlinenspearlstravelleatherflowerscrystalaluminumfurnitureporcelain

First Day of Fourth Grade! 2024-08-26

35 Items: ArtGymJobsMathDeskGrowKuchaLearnFourthSchoolEraserRecessNovelsDirksenLibraryReadingWritingWelcomeJittersSucceedMartinezSpecialsSpellingTeachersLanguageScheduleProjectsBackpackSuppliesComputersTextbooksLunchtimeClassmatesWhiteboardExcitement

Mental Health 2025-08-20

35 Items: ArtDietDrawMusicGamesPaintRelaxCopingNatureMoviesHealthyWalkingTherapyFriendsTalkingJournalReadingWritingSelfTalkExerciseOptimismLaughterEmotionsStrengthOrganizeVacationStrengthsGratitudeHappinessPositivityCompassionMeditationResilienceMindfulnessRelationships

Graded São Paulo 2025-08-26

35 Items: ArtMathMusicDanceTrackGradedSoccerMorumbiTeacherStudentLibraryDiplomaEnglishSpanishScienceHistoryTheaterRespectServiceSaoPauloLearningSwimmingWellnessKindnessClassroomIBProgramGymnasiumIntegrityCuriosityCommunityPortugueseBasketballVolleyballFriendshipPerseverance

Graded São Paulo 2025-08-26

35 Items: ArtMathMusicDanceTrackGradedSoccerMorumbiTeacherStudentLibraryDiplomaEnglishSpanishScienceHistoryTheaterRespectServiceSaoPauloLearningSwimmingWellnessKindnessClassroomIBProgramGymnasiumIntegrityCuriosityCommunityPortugueseBasketballVolleyballFriendshipPerseverance

Check It Out! s. 10 2025-11-04

35 Items: BoyArtZaraHariGirlBothFormYashNishaIndiaPupilTwinsThaneLuckyClassFriendTwelveElevenSheylaCanadaFamilyCousinGermanAlwaysPictureDenmarkTeacherCorrectBritishExcitedHistoryEnglishBecauseSentenceThirtytwo

Piano Word Search 2026-05-13

33 Items: MCARTACTSKITSHOWSOLOSONGPIANODANCEFUNNYGRADEMUSICSTAGEMAGICFUNNYPERRYBURKSVIDEOGUITARCENTERCOMEDYKARATESINGINGCOSTUMEAUDIENCECREATIVEAPPLAUSEFAVORITEPERFORMERSPOTLIGHTNATHERSONINTRODUCEMICROPHONE

Vocabulary Words 2025-11-25

13 Items: adj. -French origin, bizzare "odd/fantastic"adj. -Latin origin, from vulnerare "to wound"v. -Latin origin, from in "in" and durus "hard"v. -Latin origin, from examen "a test, balance, or weight"n. -Latin origin, from per "through" and specere "to look"v. or n. -Latin origin, from contra "against" and stare "to stand"...

MAY 2024 2024-05-15

36 Items: cakebowleggswhiskicingcrumbfloursugarbakerrobotpeoplechurrorecipecultureresultsqualitycookiesganachegeorgiamermaidoperatorwarehouseredvelvetchocolatedecoratorcontinuousproductioncolorblastcamouflageimprovementsafetyfirstmaintenancebuttercreamdouglasvillecommunicationhumanresources

🎯Jeu n°1– Mot mêlé spécial « Vie associative » 2025-07-01

36 Items: DSUCRABLIENUNIRPAIXAIDERUNIONACTIFDONNERVALEURPARTAGESOUTIENCITOYENCULTUREECHANGEFAMILLEACCUEILRESPECTBENEVOLEENTRAIDECOHESIONHABITANTBIENETRECOLLECTIFTOLERANCEINCLUSIONINSERTIONEDUCATIONANIMATIONMEDIATIONENGAGEMENTSOLIDARITEINNOVATIONASSOCIATIONIMPLICATIONINTERGENERATION

Beyond the Scramble 2025-11-09

36 Items: ZONEPIVOTSYKESPICOTUNIONASEANLOCALPOROUSLEGACYSTIFLETARIFFBERLINBORDERAFRICAPRIMACYCULTURENATIONSGRIDLOCKSCRAMBLESOLUTIONECONOMICCORRIDORFESTIVALREGIONALARBITRARYSYNTHESISINGENIOUSTRANSCENDPERNICIOUSRESURGENCEANTAGONISTARTIFICIALSOVEREIGNTYCOOPERATIONBUREAUCRATICINFRASTRUCTURE

SEMANTIC FIELDS 2026-02-27

36 Items: LawTradeRightsDutiesPolicyMarketJusticeEconomyScienceSocietyCultureEqualityIndustryLearningResearchEvidenceArgumentAnalysisConflictDemocracyInflationEducationKnowledgeEcosystemPollutionCommunityGovernmentProductionInvestmentHypothesisCitizenshipConsumptionDevelopmentConstitutionSustainabilityInterpretation

Reference Laboratory 2026-04-17

36 Items: SERUMBLOODCELLSPLASMAVERIFYRESULTSPOSITVECULTURECLOTTEDLIPEMICSTERILECRITICALANALYZERSPECIMENNEGATIVEDILUTIONPOLICIESBACTERIAISOLATESCOLONIESREAGENTSMCFARLANDCHEMISTRYHEMOLYZEDSANITIZERMICROSCOPETECHNICIANHEMATOLOGYHEMATOCRITLABORATORYCOAGULATIONPEACEHEALTHCALIBRATIONSMICROBIOLOGYCONTAMINATEDINSUFFICIENT

constitution terminology 2023-01-22

20 Items: Having two branches or chambers.The first term amendments in the U.S. ConstitutionComposed of the Senate and the House of Representatives.A person who shapes or creates a concept, plan, or system.To control or supervise by means of rules and regulations.The funds or revenue of a government, corporation, or institution....

Indiana Dunes Word Search 2026-05-19

10 Items: IcedunesBaldyCultureLupinesPye WeedCardinalEuropeanAlexandersCapped CHickadee

Physical Activity 2026-04-24

19 Items: Outdoor spaceBad consequencesGood consequencesActivity with rulesrules and regulationsYoung people aged 13-17The state of being activePeoples views and beliefsChanging physical positionpaid position of employmentMāori holistic view of healthmore opportunities than othersless opportunities than othersA result of something happening...

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

Volition Word Search 2025-01-06

15 Items: deeply respected or honoredshowy but cheap and of poor quality.shining with light; bright or radiantreserved or uncommunicative in speech; saying littlecheated or deceived someone to take money or property.firm and steadfast in loyalty, principles, or adherence.the power of using one's will or making a conscious choice...

Criminal Thinking Errors 2025-07-01

15 Items: A criminal thinking error that shows a failure to follow through with commitments and intentions.A behavior of criminality that displays a lack of accountability for one's actions or obligations.A positive attitude of being thankful or having a readiness to show appreciation for and to return kindness....

Nurse Word Search 2025-09-22

25 Items: Your mom and dad.Work that you do after school.The leader of the whole school.The children who learn at school.The place you go to learn every day.You can find swings and a slide here.The teacher writes on this with chalk.You carry your books and pencils in this.A short break for playing between lessons.The room where the school secretary works....

Pirate Word Search 2025-06-22

12 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with a hat, boots, and lasso...

10 Humanities Revision 2025-11-09

12 Items: The mixing of races.Being the same in status and freedoms.The forced separation of people by race.Man who challenged Terra Nullius and won.Contained area that held Jewish people in WW2.Mass genocide of Jewish people by Nazis in WW2.Feelings of contentment that come from good wellbeing.A member of the National Socialist German Workers Party....

La cathédrale de Reims 2020-10-01

35 Items: artlieucielêtreverspluslorsafinfaireconnuaussicommepeintFranceéleverentrerancienchacunchaqueédificelumièrevitrauxmodernependantensuitegothiquetoujoursfrançaisilluminébombardéMoyen-Âgecathédralerévolutionentièrementdémonstration

Dictée Château de Chambord groupe orange 2021-01-21

36 Items: artbelpaixlorstourplusmaisTempsfossépiècelargepalaisaperçudonnerfaçadeinvitépercerservirchâteauluxueuxfenêtredécorerpouvoirModernesdéfendrerecevoirnombreuxfrançaisétrangerailleurscitadelleabandonnermeurtrièreremplaçantRenaissances’installer

Les Trois Grâces 2021-04-13

36 Items: artronddirefemmecoeurformelégerplacevillearméetaillegéantecoloréjoyeuxrendreventremoraledansertravailfémininartistesociétécraintemenaçantredonnerrésistercritiqueinspirerpiétinerapparencesculptureextérieurimportantinstallerdominationreprésenter

Welcome to 4th Grade 2024-08-09

33 Items: CalMiaEvaAriArtNDIEvanEttaMathAyamiRyleyCalebTeddyWyattDiegoMusicLunchGianniMelodiRecessMsOwensKennedyPritikaCamilleBrixtonZacheryLibraryReadingTsheringKindnessEducationTechnologySocial Studies

All tied up 2025-03-20

36 Items: ArtRopeKnotWrapFlowBodyTrustSceneSafetyBreathEnergyBondageHarnessTensionBalanceFreedomPassionReleaseShibariFrictionSymmetryDominantPositionPressurePatternsRestraintAestheticPrecisionEnduranceSuspensionConnectionSubmissiveCreativityCompressionNegotiationCommunication

RugsNStuff Word Search 2025-09-12

35 Items: GunCutArtYarnWoolGlueLoopTrimShearColorTraceFrameBlendFabricDesignCreateCustomUniqueVisionNeedleDetailFinishBorderLayersTuftingBackingPatternTextureStretchOutlineWorkshopScissorsTapestryProjectorRugsNStuff

4th Grade 2026-04-24

36 Items: KaiLMCArtGymAlexErikDreaSaraOwenGwenWillGageRutzJacobJamirHaleyMilesFieckJichaMusicKempsJonesBrownProfeAudreyTannerLaineyAuroraBrookeLandonHelwigKinsleySpitzerSpanishMcConnellVandeZande

PBS The Nervous System 23-24 2023-11-15

20 Items: the top part of the brain stemthe lobe that processes hearingthe bottom part of the brain stemthe middle part of the brain stemthe lobe of the brain that processes visionthe study of microscopic anatomy of tissuesthe type of cell found in the nervous systemthe nervous system that consists of the nerves...

Food , Drinks and deserts 2023-12-21

138 Items: hammilkcrabporkPORKmushyamswaterlagerlattestoutgritssushicoffeefrappegrappaeggnogoolongbrandycognacshrimpwafersturkeyquinoapotatosalmonsalamifondueseltzerslushiechicorylobsterhotdogslasagnawafflesoatmealpumpkinmuttonsoxtailslemonadesmoothieiced-teaestragonabsinthepancakesporridgepigtailspopsiclemilkshakecherryadeorangeadeiced-beerroot-beergreen-tea...

Ruler Word Search 2025-06-22

12 Items: A sheet you use to write or draw onThe person who leads the whole schoolThe room where students learn and workA writing tool with bold, colorful inkPeople you like to play and learn withA book with pages for writing and notesPages you read to learn or enjoy a storyA white stick used to write on chalkboards...

Whole Word Search 2026-01-29

11 Items: – Feelings of failure or low self-esteem.– Sense of pride gained from mastering skills.Thinking – Logical thought based on real situations.Intake – Nutrient essential for bone and tooth development.– Adequate water intake to support energy and concentration.Protein – Foods that support muscle growth and tissue repair....

Nurse Practitioner Week 2023! 2023-11-11

18 Items: A1c > 6.4%A disorder of the enthesesBlood pressure above 119/79State of elevated cholesterolWork jointly with others or a teamThe art of displaying kindness and concern for othersA person competent or skilled in a particular activityGive training in or information on a particular subjectDeficiency in the amount of oxygen reaching the tissues...

Eucharist 2023-11-13

9 Items: Going to the altar to receive...invoking the power of the Holy SpiritTranslation of Eucharist in Greek and thanks to GodAct of turning bread and wine to Body and Blood of Christ"to make holy" and shedding of Jesus' blood for our salvationthe highpoint of the mass and central sacrament with special title...

Coast Word Search 2025-08-01

16 Items: The movement of sedimentThe distance a wave has traveledAn area where the land meets the seaFine material is carried along in the waterThe dropping of material due to a loss of energyThe movement of water up a beach as a wave breaksThe covering of land with a large amount of waterLarge boulders and rocks are rolled along the sea bed...

Yes! Word Search 2025-11-19

21 Items: METTALOTUSBUDDHADHARMASANGHAMANTRATEMPLEBEINGSRINPOCHECHENREZIGSUFFERINGNAMASKARACOMPASSIONMEDITATIONDEDICATIONcan simply copy the list below and paste it into the generator of your choice:Using an online generator is the easiest way to make a custom word search puzzle....

Hardware Unit Vocabulary 2025-12-11

19 Items: The "U" in "USB"A type of storage that keeps data without powerTransmits data at high speeds via light signalsCable that connects storage devices to the motherboardStores and manages files for other devices on a networkA piece of software that may need to be installed for a peripheral to work....

Elementa Unit 9 word search 2026-05-11

11 Items: orandbutgodtreetemplebecauseholidaygoddessalthoughand (attached to end of word)

Renewable energy Snjeza Word Search 2026-04-20

18 Items: Moving air.Dirty air from fire.A machine that spins in the wind.A small thing that stores energy.Water that flows across the land.A vehicle we drive on the road.A mountain with hot lava inside.Energy that gives us light and power.A wheel that turns in water.A place where water makes electricity....

Achieve, Word Search 2023-09-26

36 Items: herdpeakcliffcycleeageradaptawardgraingreatteethtoothoccurascendborderdeducepeopleescapepersonmeadowmotivecattlechargedesertfastenassistachievebenefitcascadeequatorillegallibertycultureemotioninclinedemergencycontribute

8H - Short Stories 2026-02-28

36 Items: EndfoodPackMoonPermVoiceBloodBullydimsimMiddleFatherSmellsPlaitsCultureHusbandHuntingAntbushRibbonsPigtailHomeworkLilyChenWerewolfBeginningResolutionbodybuilderOrientationGhaniangirlComplicationJetblackhairTheWifesStoryTakemeawaypleasespecialfriedriceSituationalIronyChineserestaurantPeterChansChineseTakeawayrestaurant

Mummy Word Search 2026-04-14

36 Items: dnadietmummybootstombstoolstractbonesteethbloodsocialstatusdesertbronzeicemanorgansearringleatherstatuesjewelrycultureancientartisanschemicalmineralswrappingsartifactsdigestiveethnicityintestinesoccupationscientistsdecorationsmicroscopiccraftspersonanthropologists

Festivals & Culture of Europe 2 2026-03-19

10 Items: BALLETFLAMENCOHALLOWEENGONDOLIEROPERANIGHTEISTEDDFODKNIGHTHOODAPRILSFOOLSMAYPOLEDANCEHIGHLANDGAMES

Christmas 2025-11-30

7 Items: globestoppersWreathsStockingsand baublesNutcrackersand garlands

места 2023-04-20

6 Items: zooparkhallgallerytheatrefood restaurant

JBEQ FRNEPU 2025-04-09

15 Items: thuartf***cakesnakestuffdaboysballadmygirlstephenlimericklolbeansorchestraxylophonechochochudies

Dns Word Search 2025-06-20

15 Items: Converts web addresses to IPsProject management methodologiesOverall experience and usabilitySystem to track changes (e.g., Git)Designing for mobile before desktopCode that is free and shared publiclyImprove code without changing behaviorService that stores your website onlineVisual elements the user interacts with...

Spanish Vocabulary 2023-04-19

20 Items: catdogauntcamerafathermotherbrothercousinshusbandparentschildrendaughterdecorationsgrandfathergrandmothergrandparentscousin (male)aunts and unclecousin (female)brothers and sisters

The Crucible Vocabulary Review 2025-02-27

37 Items: bitliefbasinladlefactoagapegauntpoppetseededchristgibbetjoshuacleavelecheryprobitygullingandoveradamanthysteriaand abeldesolateclemencydenounceaffidavitcallouslybewitchedrepreievepenitencerescindedmagistrateand tobiaseffronteryproceedingsremorselessdisputationcondemnationconciliatory

OSMOSMJERKA 2018-04-26

36 Items: mišArtRamRomUSBlogoWordlistfontChromradnaradniSmartkabelEnterslajdWelnesgooglegrafikoblicistrujacelijakučištetablicemobitelInternetprocesorpovršinazvučnicipodnozjestranicakompjutorZaglavljetipkovnicainformatikaprezentacija

Inspirational 2023-08-29

36 Items: artgodbookhopelovebibledreamoceanpoemssongsstorymusicbabieschurchfamilyheroesnaturepeoplequotesspeechtravelprayercouragedoctorsexamplefriendsleadersloyaltysunrisesunsetsworshipcandlesdevotionmiraclesrainbowsteachers

Italy Word Search 2026-04-16

36 Items: ArtRomeCasaCiboCiaoMilanPastaPizzaRomanAmicoCittàLibroPregoAcquaVeniceSicilyNaplesPiazzaStradaGelatoGrazieScuolaTuscanyTourismFlorenceSardiniaApennineFamigliaBuonaseraInsegnanteBuongiornoRenaissanceAgricultureArrivederciArchitectureMediterranean

Traitors Hosts 2026-04-22

36 Items: ArtAnaStafLiseEricTejaAssiTijlPaulMadsGagoAlanSonjaKaranRotemFrankGirayRodgerGretelKarineMartinAttilaSergioJuanraVojtechSiobhanAlessiaMalwinaDanielaOleksiyClaudiaFredericVladimirMadeleineChristofferKonstantinos

Culture of Belarus Word Search 2026-05-11

10 Items: minskbrestfaustgrodnoslutskskarynabatlejkaPaulinkaKievanRuskorenizatsiya

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Hypothalamus Word Search 2026-05-04

10 Items: Controls blood sugar (insulin)Controls metabolism (energy use)Controls sleep cycle (melatonin)Controls breathing and heartbeatConnects left and right brain sidesReproductive glands (ovaries/testes)Controls thinking and decision-makingControls hormones and keeps body balanceMaster gland” that controls other glands...

ERROR-PREVENTION 2026-03-03

7 Items: ARCCHANDOFFAND RESOLVECOMMUNICATIONWHY AND COMPLYQUALIFY VALIDATE VERIFYSTOP THINK ACT AND REVIEW

SCHOOL 2022-10-23

39 Items: gottWORKknoxzayetreythirdfifthlexiaWORDSstoneschoolmartinmurrayraptorfourthDREAMSpiercehaywardpencilsenglishwritingsciencehistorytomlisonhomeworkphysicaldivisionadditionsandstoneIN SCHOOLcomputerseducationelementaryAND DONUTSvocabularyAND MUFFINSsubtractionkindergartenmultiplication

Find & Focus: Word Search Adventure 2024-11-29

30 Items: CarsFishPetsBirdsSpaceworldherbsFruitsSportscitiesanimalsFlowersSeasonsInsectsHolidaysof treesproductsutensilsFurnitureJewelleryMushroomsphenomenaVegetablesof cheesescharactersinstrumentsand planetsof the pastof transportand fortresses

Authors Word Search 2025-03-18

34 Items: IdeaFactOrderCluesCauseValidIndexPrintInformEffectPurposeSummaryOpinionof ViewSynonymAntonymOpinionCaptionHeadingDiagramItalicsEvidencePersuadeFeaturesGlossaryInferenceEntertainSummarizeParaphraseSubheadingDescriptionof Contentsand Contrastand Solution

Unit 3 Review 2023-01-29

16 Items: of low quality, or not acceptableenjoyable, pleasant, or interesting:the liquid that comes from fruit or vegetablesthe flesh of an animal when it is used for fooda drink made with the juice of lemons, water, and sugara sweet food made with a mixture of flour, eggs, fat, and sugar...

subjects 2025-11-03

10 Items: rajzmatekhittanolvasásnéptáncnyelvtantechnikatestneveléskörnyezetismeretdigitális kultúra

Topic 1 - Introduction to Geography 2025-10-07

10 Items: County that Telford is located inRegion that Telford is located in______ jobs provide services e.g. teacher______ jobs collect raw materials e.g. farmerMade up of 3 nations: England, Wales and ScotlandStudy of the Earth's surface, environments and people_______ geography is the study of people and manmade features...

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

Friend Word Search 2026-02-06

10 Items: - to give or use things together- being nice and caring to others- doing something good for someone- a happy face shared with friends- showing love and concern for others- paying attention when a friend talks- someone you like, trust, and play with- having fun together with games or toys- being with friends and helping each other...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Grohl Word Search 2023-12-11

10 Items: Known for his work with Nirvana and Foo Fighters.Renowned for his drumming with The White Stripes.Famous for his precision with Pearl Jam and Soundgarden.Known for his energetic drumming with Queens of the Stone Age.Drummer for The Killers, contributing to their distinctive sound.Percussionist for Arcade Fire, with a dynamic and eclectic style....

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

ULTIMATE WORD SEARCH 2025-04-22

41 Items: Half girl, half fishThe king of the jungleHidden gold and jewelsA sneaky, fast fighterColorful arc after rainA spooky floating thingA colorful flying insectA tiny cake with frostingIt buzzes and makes honeyA slow animal with a shellA yellow fruit monkeys loveCold, sweet, and melts fastA horse with a magical hornA spiky plant in the desert...

osteichthyes 2025-04-30

23 Items: anemones.activities.fertilization.class of fish characterized by bony skeletons.Fish that migrate from freshwater to the ocean to spawn.Organs used by bony fish for extracting oxygen from water.An air-filled sac in many bony fish that helps control buoyancy.The tail fin, the main source of propulsion for forward movement....

First Aid Basics 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Brianna Hart Ch.17 Vocab 2025-05-01

10 Items: Different molecular structures of the same element.Elements in groups 3 through 12 of the periodic table.Property of metals and alloys that allows them to be drawn into wires.Element that shares some properties with metals and some with nonmetals.Element, such as radium, whose nucleus breaks down and emits particles and energy....

Zora Neale Hurston 2026-04-14

10 Items: The last name of the authorThe implementation of social reform or new, liberal ideasLegalized system where people were bought and treated like propertyThe neighborhood that was the birthplace of a new wave of African American literatureCity where Hurston was born, and featured in many of her famed novels, such as this essay...

Ancient Civilizations 2026-04-17

36 Items: EgyptIndiaChinaIsraelGreeceTigrisEmpireEconomyPharaohDynastyCultureReligionPoliticsZigguratSilkRoadGeographyEuphratesNileRiverHimalayasCuneiformDemocracyIndusRiverMonotheismPolytheismCityStatesIrrigationMesopotamiaTradeRoutesAgricultureCasteSystemCivilizationAchievementsMediterraneanHieroglyphicsSocialStructureFertileCrescent

Critical Words! 2023-01-07

21 Items: A missionBold and hardypopular DnD showWhere it all beginsScholarly magic userGoing on an adventure!Master of martial artsPriest of the old faithSurvive by avoiding noticeSpellcaster with inherent magicHoly warrior bound by sacred oathMagical people of otherworldly graceInspiring magician with musical powerWielder of magic derived from a bargain...

Giraffe Word Search 2023-05-19

7 Items: an animal who is fat, gray and small.an animal who have big neck and is yellow.an animal fast, yellow or orange and violent.an animal who is Black and white, and have strips.an animal who is small, Black and walk underground.an animal who have a trank, if fat and live in forest.an animal who belongs to the tiger family and has a very loud roar.

Chemical Engineering 2026-04-16

32 Items: The force exerted by a gas or liquid per unit area.The movement of liquids or gases through pipes, equipment, or processes.A measure of a fluid's resistance to flow; how thick or "sticky" a liquid or gas is.Unwanted or unusable material produced during a manufacturing process or chemical reaction....

Mental and Emotional Well-being 2025-04-14

10 Items: MOTIVATION : The internal drive to take action or achieve a goal.SELFESTEEM : Confidence and belief in one’s own worth or abilities.GRATITUDE : The feeling or expression of thankfulness and appreciation.INTROSPECT : To look inward and examine one's own thoughts and feelings....

WORD SEARCH UNITS 1 & 2 2026-02-10

24 Items: happyworriedin good shapenot decoratedwilling to helpbroken or harmedtelling the truthnew completely newnot ordinary or usualhelping you do thingsrelaxed and not worriedexisting in large numberscaring only about yourselfold and not useful anymorequiet and doesn't laugh a lotable to be trusted or believednot helpful; doesn't work well...

French Hierarchy Word Search 2025-03-27

10 Items: a form of government with a monarch at the heada division of a society based on social and economic statusthis war ended with Catholicism being the national religionprotected civilization from harm by raising a military servicehighest class, highly respected, cared for souls, and oversaw and ran religious events...

Democracy & Mexico's Government 2024-10-01

9 Items: govlasts six yearsdebates and makes lawsare composed of judgesit's composed of deputies and senatorsapplies and makes sure laws are followedform of government that depends on the will of the peopleone _________ is to preserve and promote the dignity of the individualMexico's government _________ are the Presidency, the Congress, and the Courts

Motivating Factors 2025-01-20

37 Items: PayTeamMoneyPridePowerGoalsPraiseValuedValuesSalaryPurposeCultureRewardsManagerTimeoffHonestyFeedbackLearningBenefitsPositivePressureBenefitsPromotionWellbeingProcessesLeadershipInnovationCreativityRecognitionAchievementDevelopmentAdvancementFlexibilityEnvironmentAppreciationCommunicationCollaboration

Hispanic Heritage Month 2025-09-24

30 Items: RicoRicoBáezCubafoodsSpainChileViejaBelizaLindorSelenaArepasPozoleMexicoHistoryhistorycultureLatinasLatinosAmericaAmericaTamalesMofongoHeritageHondurasClementeGuatemalaNicaraguaElSalvadorCelebration

Hispanic Heritage Month 2025-10-06

36 Items: suntacoflagmoonCubaPerusalsamusicdancehappycolorChileFridaDiegofiestafamilyfriendguitarMexicoBrazilponchoparaderhythmartistmaracascultureAmericafreedomsombreroheritagelanguageequalityHispanictraditioncelebratecommunity

INTERVIEWING SKILLS 2026-05-19

36 Items: STARPHONEPANELEARLYCLOSEATTIREGROWTHRESUMECASUALFORMALWORKINGCONNECTCULTUREATTITUDEPOSITIVEINPERSONRESEARCHTHANKYOUSCHEDULEBRANDINGSTRENGTHWEAKNESSEVALUATEDINTERVIEWHANDSHAKEQUESTIONSCOMPETENCEIMPRESSIONDIRECTIONSREFERENCESBEHAVIORALRELIABILITYPREPARATIONPROFESSIONALINTRODUCTIONCOMMUNICATION

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

ADJECTIVES ENDING IN -ED & -ING 2024-05-14

18 Items: Causing anxiety or concern.Causing astonishment or shock.Feeling great surprise or wonder.Feeling in need of rest or sleep.Causing great surprise or wonder.Feeling calm and free from stress.Causing someone to need rest or sleep.Causing curiosity or holding attention.Feeling very enthusiastic or very happy.Causing enthusiasm and extreme happiness....

Healthy Word Search 2026-05-07

10 Items: - picking what you will do- not in danger and protected- a place to learn and stay safe- looking after yourself and others- saying you will do the right thing- a guide that helps keep people safe- feeling good and strong in your body- support from trusted adults or friends- a word used to stop or refuse something...

Summer safety 2026-01-29

11 Items: sweatingdizzinesssunglassespubliclibrarychronicconditionsUse a broad-spectrum sunscreen to protect your skin. Reapply at least every two hours—more often if you're swimming or sweating.Wear protective clothing, a wide-brimmed hat and sunglasses to further protect against sun exposure and skin cancer and eye damage....

The Effects of Unionized Nursing on Patient Outcomes 2024-12-02

10 Items: SafetyBenefitsAdvocacyRetentionWhich act defines scope of practice and governs nursing unionization?Unionization provides reduced burnout and improved job satisfaction for this population.Unionization provides safer environments and consistent care standards for this population....

King Word Search 2025-12-15

10 Items: - being nice and caring to others.- a hopeful idea about a better future.- treating everyone the same and being just.- a person who helps guide and teach others.- the right to live, speak, and learn equally.- a talk given to share ideas with many people.- showing care and good behavior toward others....

James 4 2023-09-04

16 Items: doisittoandhimwhonotonesinthedoesknowsrightthingtherefore

Hund Word Search 2025-04-22

16 Items: musandhundkattkaninrotteilderslangehamstermarsvinkyllinggullfiskpapegøyeparakittkanarifuglfugleedderkopp

From Word Search 2025-08-08

18 Items: iofofmytothetheandfromthismouthforgehornsfocusritualaugmentempowerstrength