weather Word Searches

vocab list 3 and 4 2025-10-01

10 Items: Depressingly gloomy.Not able to be separated.The area around a certain placeDangerously low body temperature.To get thinner or narrower at one end.Extremely great in amount, size, or intensity.A person who studies and predicts the weather.Something that is very ugly and unpleasant to look at, like a messy old building....

Out of the Dust 2024-05-09

10 Items: the body of a dead animalrequired or bound by a promiseto become painful and inflamedto twist your body from side to side as in painthe upper layer of soil that is made up of grassto give up or leave something or someone entirelyto wait for the right time before you do somethinga show in a theater that includes funny songs, etc....

Climate Change 2023-04-29

1 Item: oxygen weather climate season

36 2025-08-17

15 Items: Popular Mexico route.Ride across U.S. borders.Road linked to outlaw clubs.Classic American biker music.States with strong biker clubs.Worn on vests to show club affiliationThe symbol representing a motorcycle clubPatch sewn on the sleeve of a biker’s jacketLarge patches displayed on the back of a vestSmaller patch worn on the front of a club vest...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

Lifeguard Word Search 2025-05-17

20 Items: A small insect that bitesWatches swimmers for safetyKeeps drinks and snacks coldA cold sour-sweet summer drinkPaddling a small boat on waterBoat that moves using the windSport often played on the beachA hanging bed tied between treesProtect your eyes while swimmingStaying healthy by drinking waterPlace where people sleep in tents...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

Human Impact Vocabulary 2025-05-19

15 Items: Reusing materialsWhere animals liveA stock of materialsNo longer exists, dies outHumans clear trees to build housesVariety of habitats and ecosystemsPrevention of wasteful use of a resourceProduction and disharge of gas or radiationDeplete the stock of fish in a body of waterWeather conditions over a long period of time...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

37 2025-08-17

15 Items: Classic biker bar game.Common bar music player.Popular biker TV series.Major outlaw biker club.Angels Famous outlaw motorcycle club.Outlaw club with international chaptersA tool used to start a motorcycle’s engineA route plan for a group motorcycle journeyThe patch worn on the front of a biker’s vestA social event often held at biker gatherings...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

POSTIES 0421 COVER 2025-03-18

6 Items: to turn round and round quicklyGeothermal energy is heat from inside the _____.The energy obtained from sunlight is known as _____ energyThe _____ affects how well solar panels and wind turbines work.a hard black mineral that is found below the ground and burnt to produce heat...

CompTia ITF 2023-02-03

12 Items: How to treat people.Number system based on 8.Connects devices to Wi-Fi.Connects home to network ethernet.Company that created the ITF exam.Number system based on 2 numbers 0 and 1.Image that doesn't lose quality when resized.Number system based on 10 numbers and 6 letters.Type of internet that may be disrupted by weather....

POSTIES 0115 COVER 2023-12-15

6 Items: how hot or cold something isa place that protects you from bad weather or dangerheat, energy, etc. that is sent out in the form of raysa substance that consists of very small fine grains of rockcausing damage or injury to someone, especially to their health...

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

Snow Word Search 2025-11-01

10 Items: - A small vehicle used to slide on snow.- Frozen water that is hard and slippery.- A thick piece of clothing worn to keep warm.- The low temperature that makes you feel chilly.- A long cloth worn around the neck to stay warm.- When something turns to ice because of the cold.- Clothing for your hands to protect them from the cold....

Spring Word Search 2025-12-15

10 Items: - a colorful plant that blooms in spring.- when a flower opens and shows its petals.- an animal that sings and builds nests in spring.- the bright light in the sky that makes days warm.- a small insect that visits flowers and makes honey.- water that falls from the sky and helps plants grow.- a round object laid by birds, often seen at spring time....

2025 Spelling Bee - One Bee 2025-11-06

150 Items: tagsenddecksnugfishholdmindstaydrawcozytintmilkyawntankwantpondrubywiretailbaitlureajarahoyseeproamstuckscrubbrowncrowdskirtquilttwigstaffycomfytightcandyclosegiantpastemelonslimeteethhoistmangocoralfocusbasilsatinsugarsweetfaintfruitgoatswoozylimbsaheadseñorraiseeatensharkstackleskaterbucketchancetenderfarmerparenthockeyforesthollowsearchremind...

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

SHAMMY CREATION 2025-11-17

150 Items: GOLDCOZYMYDADFANCYOCEANSILLYGOOFYFUNNYBEACHBLUEYBINGOSILKYHONEYJESUSWASABISHAMMYDRAGONDISNEYSHARKSWICKEDMOVIESMUSEUMMAKEUPTONINGGINGERTRAVELFAMILYTIKTOKUROLOGYFASHIONREADINGHOBBIESVAMPIRECOOKOUTBLANKETSHAMPOOMIRACLEBUBBLESDOGGIESROMANCEGOODINGHIGHWAYMASCARAYOUTUBEBARGAINBIOLOGYDOLLARSRADIANTBLOSSOMWORSHIPCASHIERSTYLISHFLOWERSCANDLESWEATHERPAYMENT...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

Daddy-Long-Legs pgs. 44-48 2023-10-16

15 Items: Why was Mr. Jervis in town?What did Jervis give a box of?How does Judy feel with Jervis?Where did Judy eat with Jervis?How does the campus look in May?Who did Mr. Jervis come to visit?Where is Judy going for the summer?What is Judy working hard to become?Where did Judy and Jervis walk around?How many months will Judy be on a farm?...

M2L19 - Vocabulary - 7th grade 2025-01-07

14 Items: To cause to be neutral.Not pleasant and disagreeable.To remove or separate from others.To destroy, demolish, or annihilate.Hopeless or unprotected from weather.The act, practice, or process of doing something.To be excluded or treated as being of no importance.Having to do with religion and showing great respect....

gothic elements and gothic words word search 2023-04-22

14 Items: a non living spirita blood sucking monstera place where the dead restbeing left on a cliff hangeran unatural thing or creatureunkowing of what will happen nexta place that people can go to praywhere the weather affects the moodan era of time known as the dark agesa building someone rich might live ina young lady often in distress in gothic books...

Voca 4000 Lesson 1 2025-08-27

12 Items: felling fear (AF***D)having the taste of salt (SA***)like silver in color and luster (SIL****)to praise for some act or service (COM***D)to look at in a close, thorough way (EXA***E)causing a feeling of fear or horror (HOR***E)the usual weather conditions in a place (CLI***E)to speak about something in a few words (MEN***N)...

Brynn's CrossWord Puzzle 2023-05-12

24 Items: Measures the air pressure.Measures the speed of wind.Change in moisture content.The weight of the air pushing down on earth.When a boundary between two air masses stalls.A warm water current that comes from the equator.Measures the amount of precipitation that has fallen.Form when a colder air mass moves toward a warmer air....

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

Canadian cities 2025-06-14

28 Items: - Retirement paradise where gardens bloom and wallets empty- Car manufacturing town that puts wheels on Canadian dreams- Medieval fortress city that somehow ended up in North America- Cottage country gateway where city folk pretend to be outdoorsy- The center of the universe, according to everyone who lives there...

YLC5 U6 2025-07-30

10 Items: Causing fear or making someone feel scared.To go down or reduce in amount, number, or size.The effect or influence of one thing on another.To go up or increase in level, height, or amount.Referring to traits passed from parents to children.Long-term changes in temperature or weather patterns....

Winter Weather 2025-12-10

1 Item: • FROSTBITE • SNOWSTORM • AVALANCHE • WHITEOUT • WINDCHILL • FREEZING • HYPOTHERMIA • TEMPERATURE • SLEET • HAIL • ICICLES

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

cute words♡ 2023-10-25

160 Items: momnapskysunteacakecutedearfallhopehugslakelifelilylovepetsrainrosesandsofttoysbeachbloomblushbookscleandaisydancefreshfunnygiftsgrasshappyhearthoneyhubbyjellojollylightlunchmerrymusicoceanoreospeacequietrelaxrivershinesillysleepsmilesongsstarssweetswingtastytouchtreestruthwaterwavesyummyangelsapplesautumnbreezebrightbubblycolorscuddledreamsfamily...

SDG 13 - JHS 1 2025-08-17

1 Item: weather, rain, flood, hot, cold, sun, storm, wind, temperature

New Year's Eve Article Word Search 2025-12-17

11 Items: What object moves down at midnight?What material is the modern ball made of?What city hosts this new year celebration?What do people often make for the new year?What type of lights does the ball use today?Where in the city does the celebration happen?What do people do together as the object moves down?...

Voca 4000 Lesson 1 & 2 Review 2025-09-02

16 Items: to leave; go away (v)to gather together (v)to make a sign to somebody (v)not hurt or broken; healthy (adj)happening or done every day (adj)to praise for some act or service (v)causing a feeling of fear or horror (adj)to accept or regard something as true (v)the usual weather conditions in a place (n)to speak about something in a few words (v)...

Human-Environment Interaction Review 2025-11-12

12 Items: The removal of salt from seawaterWhen fertile land turns into a desertA resource that cannot be replaced once it's been usedThe process of collecting and moving water for farmingUsing resources in a way that protects them for the futureA resource formed in the Earth by plant and animal remains...

Words Beginning with the Prefix "anti-" 2025-08-04

18 Items: Against fighting or war.A strong feeling of dislike.Weapons made to stop airplanes.The exact opposite of something.Not liking to be with other people.Something that kills or stops bacteria.Something that cleans cuts to stop germs.When something exciting ends in a boring way.Medicine that kills bacteria making you sick....

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

The Gothic 2025-09-30

10 Items: Dracula and FrankensteinA feeling of intense and overwhelming fear.Something unnatural that cannot be explained by science.Here we regularly find stormy, dark conditions with rain or fog.Feeling excited or anxious about something that is going to happen.Something strange and unpleasant that is linked to death and violence....

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

Unit 10: Atmospheric Science and Pollution 2024-04-25

14 Items: the ocean's pH becomes more acidicatmospheric layer in which auroras occuratmospheric layer that breaks up meteorsthin layer of gasses surrounding the Earthatmospheric layer that contains the ozone shieldheat can be reflected by gasses in our atmosphereatmospheric layer in which all weather events occur...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Spooky Word Search 2024-10-31

179 Items: axebogboocatnunspywigbatsfallfearhowlmaskmistmothalienbeardbeastbloodbonesboxercandyclowncovencryptdecaydemoneerieenemyfancyfangsfoggyghoulgourdmummyouijapartypropsravenscaryskullslimesnakestaffswordtoxictrollvenomwingsafraidapplesautumncasketcharmscircuscorpsecreepycurfewghostsgoblinhorrorleavesmakeuporangeparadepeglegplaguepiratepoisonscared...

Advanced Science 2023-02-28

21 Items: study of arachnidspollination by birdsWhat mammal lays eggsalloy of copper and zincwhat type of fish is albacoreAnother name for the stone ageLinseed oil comes from what plantHow many men have walked on the mooncloud at ground level is called whatthe rabbit has how many incisor teethThe fastest-running terrestrial animal...

El Hombre de Vocabulario PE 2/Quizlet 2024-09-11

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustpleaseseasonwinterspringsummerTuesdayJanuaryOctoberyou saynotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberhow manyIt's hotclassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyIt means...student deskIt's rainingIt's snowingfall, autumnstudent (male)...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Geography & US Regions 2023-02-08

9 Items: The way a certain place makes moneyThe average weather in a given area over a longer period of timeA region famous for citrus fruit, alligators, jazz music, and seafoodAnything that is found in nature that can be used by humans or animalsThe act of people traveling to places outside of their usual environment...

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Hola, ¿Qué tal? 2025-11-24

44 Items: badwellso-sopleaseGoodbyeLikewiseIt's hotvery wellexcuse mehe/she isdelightedIt's coldWhat's up?My name isIt's sunnyIt's windyI'm from...Good morningIt's rainingIt's snowingSee you laterGood afternoonYou're welcomehis/her name isSee you tomorrowHow is it going?Nice to meet youWho is he/she/it?He/She is from...and you (familiar)And you? (form.al)...

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

English language devices Word Search 2023-06-25

15 Items: a naming wordwords that link to each othera word used to describe somethingan action or something that you can doa comparison using the words like or asthe repeated use of the s sound in a wordthe same starting letter for two or more wordsdescribing something as though it is an animalusing a word that sounds like the sound it makes...

Water Word Search 2025-05-05

20 Items: A treat for summerA big boom in the sky!Something fun to jump onWhat you take in the summerWhat you feel in the summerA type of meal or gatheringA sweet and freshly productHow you get tan in the summerYour body's reaction to cool offWhat people say it looks like outsideWhen you bath in the sun it's called?A place to go when the weather is warm...

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Units 47 & 48 part 3 2024-03-15

40 Items: credit(math) minus(το) the dollar(η) the square root(ο) the (shape) cube(το) the social media(το) the figure, shape(η) the (math) algebra(ο) the (weather) wind(η) the saving, thrift,(η) the temperature, heat(η) the rain, rain shower(τα) the mathematics, math(το) the coin, physical currency(η) the value, price, worth, merit...

CE2 2025-05-14

1 Item: exclamatory comfortable miserable misbehave weather whether summarising plain plane accept expect piece peace

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Summer Wordsearch 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

summer 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Earth and Space Science 2025-05-30

10 Items: A large, slow-moving mass of ice formed from compacted snow.Any form of water falling from clouds—rain, snow, sleet, or hail.The layers of gases surrounding Earth that support life and weather.Molten rock beneath Earth's surface that can form lava when erupted.An imaginary line around which Earth rotates, causing day and night....

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Environmental and Nature 2025-04-14

10 Items: CLIMATE : The long-term weather patterns in a specific area.RECYCLING : The process of converting waste into reusable materials.RENEWABLE : A resource that can be replenished naturally, like solar energy.HABITAT : The natural home or environment of an animal, plant, or other organism....

Mission: Find the Hidden Words! 2025-11-13

10 Items: Relating to the whole world; worldwide - LOBGALA room or area where food is prepared and cooked - ENICHKTA day of festivity or recreation when no work is done - YLHODIAA game, toy, or problem designed to test ingenuity or knowledge - ZUPELZA person's regular occupation, profession, or commercial activity - SSBUNIES...

The Five Themes of Geography: Place & Region 2025-03-01

11 Items: The plants that cover a specific place.The shared way of life for a group of people.The long-term pattern of weather in a particular place.These features describe the natural environment of a place.These regions are areas defined by a common characteristic.These features describe the people of a place, both past and present....

Medicalalertcodeblue Word Search 2024-12-02

12 Items: Smoke or FireA missing childYou found a suspicious packageSecurity assistance needed for a hostage situationExternal Threat requiring all entrances to be lockedSecurity Assistance Needed for a violent patient/visitor/employee with a weaponAny Staff/Visitor “Individual” experiencing any type of medical emergency situation...

Geography Key Words - L1 2025-09-03

10 Items: the types of plants in an area or a regiona tool or instrument for finding directionsa sphere that is a model of Earth and most accurately represents ita physical feature on Earth's surface such as a mountain or a plainthe study of our physical surroundings and how humans interact with them...

Earth and Space Science 2025-04-14

10 Items: GLACIER : A large, slow-moving mass of ice formed from compacted snow.AXIS : An imaginary line around which Earth rotates, causing day and night.MAGMA : Molten rock beneath Earth's surface that can form lava when erupted.ORBIT : The curved path of a planet or satellite around another celestial body....

Science Word Search 2025-02-07

100 Items: pHDNALabAtomGeneCellLensWaveDataAcidBaseBiomeVirusPlateOceanForceSpeedLightSolarEnergyProtonFossilEnzymeOpticsFusionTheorySampleAtomicBiologyPhysicsQuantumGravityNeutronSpeciesMicrobeProteinNucleusGeologyVolcanoWeatherClimateKineticCircuitCurrentVoltageFissionReagentSolventIsotopeMoleculeElectronOrganismBacteriaRibosomeTectonicVelocityFriction...

Weather and Climate 2023-05-12

1 Item: stream Warm water current

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Fall And Fall Again 2024-10-03

1 Item: Football,Daylight,Weather,Orange,Hotdog,People,Leaves,Candy,Party,Coats,Treat, Trick,Rain,Fair,Hot,Fur

Anniversary Silly Search 2024-08-22

15 Items: The most wonderful drinkA favorite Western holiday for usAn object in the sky we both adoreA favorite weather event for us bothA desi drink we both have almost dailyYour Disney plushy friend won at a county fairThe name of the trivia game we played early onA reality show we watch with the romance and drama...

YEAR 6 HOMEWORK 2025-03-25

1 Item: opportunity weather microscale survive module experienced sequence absence adequate compulsory documentary impact stationary dispatch switch pressure rigours

Trade 2023-10-23

7 Items: Exchange of goods and servicesIslands Europeans' name for the Moluccas, islands rich in cloves and nutmegOcean Trade Route A sea route of trade that connected India, China, the Middle East, and Eastern Africa.Trade Route gold-salt trade; linked North and West Africa; across Sahara Desert; spread Islam; land trade...

REMEMBERING CONCEPTS 2023-03-19

1 Item: BREEZE, OCEANCURRENT, LEEWARD, WINDWARD, RAINSHADOW, THERMOHALINE, WIND, ALTITUDE, CLIMATE, SOLSTICE, TROPIC, ARCTIC, CORIOLISEFFECT, HUMIDITY, SALINITY, TEMPERATE, WEATHER, ATMOSPHERE

Summer Words 2024-09-01

10 Items: A drink made from lemons, sugar, and water, usually served cold.The activity of moving through water by using your arms and legs.Red, sore skin caused by too much sun exposure without protectionThe area or land close to the sea; a place people visit for vacationsA small building made of wet sand, usually built by children on the beach....

Unit 9: Climate Change 2025-04-29

15 Items: The warm periods that occur between ice ages.A mixture of gases that surrounds a planet or moon.the removal of large areas of forests for human purposes.the development of towns and cities on previously natural areas.Gases Gases in Earth's atmosphere that trap heat near the surfaceWarming An increase in the average temperature of Earth's surface....

Week 12 Hard 2023-12-16

25 Items: to startkept goingto replacesignificancebursting outgovernment buildingOccurring every yearthe study of the pastA period of deep sorrowGive me the short versiona doctor who performs operationsthe minimum amount to sustain lifeto honor something in a special wayto sink a ship by cutting holes in itthe fact or process of doing something...

IPCC Report Terms Word Search 2025-11-26

1 Item: WARMING, HEATWAVE, TEMPERATURE, CARBON, GREENHOUSE, ENERGY, EMISSIONS, ATMOSPHERE, WEATHER, DROUGHT, FLOODING, STORMS, WILDFIRE, SEALEVEL, MITIGATE, ADAPT, SAFETY, DATA, SCIENCE

Elite Word Search 2025-08-27

200 Items: sixowenodboyilllegpetmilkworktoadwirychindarewraprestovalyellwarmshiphunthugesoftnextsealfallnearsinkhatehighsorethawtrottalllikebaitwinkbuzzwormtoesloudfuelchopwildclubbeefhoureliteplantsteamstuffgreetprintbellsslaveultrapushyhappywomenjuicecrackskatetacitalarmthumbsilkyequalstalecoughhoverversewatchshinyfrontdrunkfloorneedyshirtsleeptradebroad...

Acción de Gracias 2023-11-21

16 Items: mes de Thanksgiving - Thanksgiving monthel clima actualmente - the weather right nowuna comida con verduras - a food with veggiesestación de Thanksgiving - Thanksgiving seasonmes después de Thanksgiving - month after Thanksgivingúltimo día de clases esta semana - last day of class this week...

Natural Resources 2024-03-10

25 Items: resources that occur naturallymixture of gases surrounding earth3 types of inexhaustible resourcesremains of decomposed plants & animals3 types of renewable natural resourcesnatural resources used to provide energycycle where water is continuously renewednatural inorganic substances on or in earth2 types of of nonrenewable natural resources...

Environment Stewardship 2025-05-06

20 Items: Long-term weather patterns in a regionTo break down naturally by microorganismsA poisonous substance harmful to the environmentA natural or artificial lake used to store waterThe upper layer of a forest formed by tree crownsTo plant trees in areas where forests were removedImproper disposal of trash in public or natural spaces...

About me 2025-02-05

1 Item: beautiful, peeing, delightful, energetic, funny, generous, happy ice lover, possibility real short, talkative, up going, united ,weather lover, excellent, zing

About me 2025-02-05

1 Item: beautiful, peeing, delightful, energetic, funny, generous, happy ice lover, possibility,real ,short, talkative, up going, united ,weather lover, excellent, zing

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

The Great Gatsby Bonus Word Search 2025-10-08

25 Items: Tom’s mistressGatsby’s real nameThe “nouveau riche”The story’s narratorCelebrations at Gatsby’sSymbol of hope for GatsbyThe color of Gatsby’s carGatsby’s secret occupationNeighborhood full of “old money”Tom’s gift to Myrtle in chapter 2Symbol of moral decay and debaucheryWho Gatsby reunites with in chapter 5Secret bars and location of chapter 4...

About me 2025-02-05

1 Item: beautiful, peeing, delightful, energetic, funny, generous, happy ice lover, possibility real short, talkative, up going, united ,weather lover, excellent, zing

About me 2025-02-05

1 Item: beautiful, peeing, delightful, energetic, funny, generous, happy ice lover, possibility,real ,short, talkative, up going, united ,weather lover, excellent, zing

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

Red, white, and slightly unhinged. 2025-11-08

14 Items: The President’s polite way of saying, “Absolutely not.”Proof that even the Founding Fathers needed an edit button.A group of adults who argue professionally and call it democracy.Half of Congress, also known as “The Room Where Bills Take Naps.”The person blamed for everything, from gas prices to the weather....

united 2024-01-05

14 Items: mooncloudserosionatmosphereDwarf planet with two moonsplanet with the biggest ringslargest planet in the solar systemhottest planet in the solar systembranch of biology that deal with the study of plants, including their structure, properties, and biochemical processes....

Chapter 1 Marine science vocab practice 2025-08-20

17 Items: An endeavor or studystudy of oceans and their phenomenaarea of ocean that is become oxygen depleted.Organisms that float or drift in the sea’s currentsorderly pattern of gathering and analyzing informationexplanation for observed events, can be tested by experimentstrial set in an experiment that contains experimental variable...

ITM WORD SEARCH 2025-01-21

1 Item: TALLTRUCK, DEBIT, CREDIT, KIDINCAR, SHIRTLESSMAN, HATMAN, SUNGLASSES, DOGINCAR, IDSCAN, CUSTOMERONFOOT, CASHCHECK, WHITECAR, WEATHER, MAKESAJOKE, REDSHIRT, WEARINGGLASSES, ONTHEPHONE, TAPFUNCTION, MICHAELODOM, CARLOUSRELEFORD, NETTRANS, BEARDEDCUSTOMER, W

ITM WORD SEARCH 2025-01-21

1 Item: TALLTRUCK, DEBIT, CREDIT, KIDINCAR, SHIRTLESSMAN, HATMAN, SUNGLASSES, DOGINCAR, IDSCAN, CUSTOMERONFOOT, CASHCHECK, WHITECAR, WEATHER, MAKESAJOKE, REDSHIRT, WEARINGGLASSES, ONTHEPHONE, TAPFUNCTION, MICHAELODOM, CARLOUSRELEFORD, NETTRANS, BEARDEDCUSTOMER, W

the final yule 2024-12-17

220 Items: gaycozygoldmallstarvestboxesciderdollyelvesfeastfudgegreenhollyigloojollylegosmerryparkapartypeacescarfslushballetbakingblocksbuffetchillyeggnogfamilyfrostyfrozengivingglovesgrinchhockeyiciclejoyfulmoviesparcelpicklepuffinrottenseasonskiingsleighsneakyspicessprucestresstinseltrainstravelwreathairportantlersbelieveblitzencandlescatalogchimneycousins...

Pavel's Lord of The Flies Word Search 2022-11-23

26 Items: ridiculous; absurddejected; dispiritedshy; reserved; sedateharshly pungent; bittermaking little or no noiseforceful; causing to yieldproper; in good taste; orderlydeep hatred; animosity; ill willnearsightedness; lack of foresightstronghold; fortress; fortified placeto shake tremulously; quiver or tremblea break or interruption; often from work...

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS