weather Word Searches

Aerospace Word Search 2022-09-22

77 Items: ivappdnacellraysscanmarsmoonnasarisktoolstormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganvesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareaerospaceastronautbiologistcolleague...

Mack Word Search 2023-05-04

91 Items: mackwifemerrymimicmoosewackywhilewhitewokenwomanmammalminutemomentmonkeywantedwebbedwickedwobblewombatwoodenwreathwrithemagnifymannersmarilynmeetingmelodicmentionmiiddleminoretmissingmissionmittensmorningwaddledwarrantwaveredwaywardweatherweavingwebsiteweddingwelcomewesternwhetherwhiningwhirledwillingwinningworkingworriedworshipwrittenwrought...

The Impossible Word Search 2024-06-14

93 Items: vethatcapredmayjobschefcoatbluepinkjunejulypilotnursesunnywindyfoggyrainysnowyshoesskirtshirtsocksdressscarfwhiteblackbrowngreenfortyfiftysixtymarchaprildoctorcloudyshortsjacketglovescolorsorangeyellowpurpleeleventwelvetwentythirtyeightyninetymonthsaugustspringsummerautumnwinterfamilymotherfathersisterstylistteacherweatherreadingdancingsinging...

Weather and Climate Unit Vocabulary Word Search 2023-05-15

6 Items: catlionzebrahippoelephantMan's best friend

the setokin 2023-11-06

5 Items: design name that related to weatherfirst edition lauched by the setokinpurple evergreen plant native to the Mediterraneanyellow and blue flower design on white knitted setokinColour represent the future, the imagination and dreams and spiritual

Test 2024-09-26

15 Items: Growth of cities.Group of islands.Half of the Earth.Earth's surface features.Community of living things.Typical weather in a region.Spreading of cultural traits.Large, continuous area of land.Major ecological community type.Moving from one place to another.Narrow strip connecting two lands.Distance north or south of equator....

ww4 u 2 2024-03-07

16 Items: to rotto allowvery hugefully grownto be more thanmore than enoughto burn slightlyto refuse to give into bring about change inan arm, leg or tree branchto order to not do somethinga group of trees growing togetherto find the answer by using arithmeticto stand higher than what is around itthe average weather conditions of an area...

HOMOPHONES 2014-12-14

97 Items: besoarkbuyduedyeewefluforlednewwonseesumtoewaraideislebearbeatburyblewbuoyseedsellcordfarefeethairheelliarmademaleneedpailpeekpourpreywrapringrollroseseemsoresoultalewailwaitwornaloudaltareightbirthbreakbreadbuildsensesightqueuedoughflourgrownwholepeaceplanereignwritesteeltheretongswastewitchborderbrowsechoosecorpsecourseelicitgreaselessonceiling...

20 Mins to Complete 2024-03-12

101 Items: jutdeftwaftzealtakebluffembergustoknollquellswarmtersewaveraplombbanishdebrisdismaldispelemergefalterhastenignitejabberjargonjostlekindlemusterscurrysombertacticcountercunningdisdainengrossfurtiveheadwaymeandernarrateobscureominousreclusestaminasubsideswaggeruncannyweatheraptitudebrackishbrandishdefiancediminishgruelingluminousmomentumpristine...

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Ecosystems 2024-10-08

100 Items: PreySoilLakePondBiomeNicheOceanRiverMarshSwampTaigaForestDesertTundraStreamArcticHabitatSpeciesFoodwebClimateWeatherEcotoneEstuaryOrganismProducerConsumerPredatorOmnivoreZonationWetlandsSavannahEcosystemCommunityFoodchainNutrientsSymbiosisMutualismHerbivoreCarnivoreScavengerEcosystemPollutionGrasslandCoralreefChaparralPopulationDecomposerEnergyflow...

Quarter 4 Vocab Words 2023-05-16

29 Items: Water that is in the groundVapor/gas turning into liquidLiquid turning into vapor/gasMovement of heat around an areaA whole bunch of underground waterWater starting to soak into the groundHumans removing trees from a forested areaLow level air pollution that reduces visionWhen the plant evaporates water through its leaves...

Mystery at the sea 2022-06-17

9 Items: They work on a ship.They move with the wind.He is the boss on a ship.It is a window of a boat.It is bigger than a mouse.It is a room inside a boat.Sail are wrapped around this pole.It is used in case the boad sinks.It shows you how the weather will be.

colors 12-word search 2023-03-15

12 Items: the color of nightthe color of grapesthe color of tangerinesthe color of a dandelionthe color of a snowflakethe color of strawberriesthe color of a tree's trunkthe color of lips of a babythe color of the Mediterranean Seathe color of a cloud during a stormthe color of the sky in good weatherthe color of leaves in spring and summer

3rd Grade Sight Word - Word Search 2023-08-24

108 Items: bynotoarebuyi'mitsnewoffoneourtootwowaswhowonalsocityhaveholeintoit'sknewknowsaidthentheyyourverywantwearwentwhenwithaboutagaincan'tcoulddon'tfirstlet'srighttheirtherethrewuntilwe'rewherewholewon'twritealmostalwaysanyonebeforedidn'tenoughexcepthiddenmyselfpeopleprettyreallyschoolthat'swinneryou'reanotherbecausedoesn'tgettinggeneraljournallaughed...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Our Earth and Environment 2023-02-15

14 Items: our planeta dense forestWhat gives us oxygengrows from the groundwhat plants grow fromtaking trash and reusing itthe outer land near a riveranother word for what’s outsidewhere you can find the frogs! 🐸taking food waste and making it soilwhat comes from the sun on warm daysthose on the earth that are not human...

Science 2023-11-16

12 Items: are invertebratesclosest planet to the sunBreak down of minerals or rockswhat was our first science topicmetamorphic, sedimentary and ……..a rock that doesn’t weather easilywhat energy is the energy of movementmeasures the temperature of the waterGaseous form changing to a Liquid formnever ... in a lab (a rule Miss Mam told us)...

What Makes This Place Special? Vocabulary 2023-02-07

10 Items: a vacationnot the sameto go from place to placea place with a roof and wallsthe animals that live in a habitatthe path someone follows when travelinga picture that shows where things are locateda natural feature of Earth, such as a mountaina place with many businesses, homes, and peoplewhat the air and sky feel and look like any time

Kiani Word Search 2023-06-13

105 Items: ofasmftsabsocrooccbfsgatebaggbagcarmfarmdumnrcrewgsarrampfueliropbaseseatlatekianivadimwendyleslyhowdydeltapilotgonowauditacarsguestscaleheavybimalakeahjanicholmonikaspiritrunwayunitedtarmacofficerebookrefundsafetyairbusalaskapickupayashnawilliamsharnetadrianabaggagedelayedairportcaptainjetbluearrivalweatherrevenuelevartistationcheckintaxiway...

Summer 2023-09-11

100 Items: hotsunhaticesandswimfirewoodjunejulytripfoodcokesodasingreadbakedopegoatyolobeachtowelhumidsunnyriverpartywaterfruitmangograpeguavapaintmoviestudyjapankoreachinasummercastlesportshotdogsmoresforestaugustshortsparadegelatopapayaorangepuzzletravelmexicokaraokecampingweathertouristbandanasandalsindoorssciencewritinghistorycountryecuadorenglandumbrella...

Never Let Me Go: Writer's Methods 2022-12-12

13 Items: a repeated symbolthe genre of the novelanother word for speechwhere a story takes placesymbols or reminders of deaththe type of narrator Kathy isa comparison using 'like' or 'as'when the weather reflects the moodanother term for non-chronologicalwhen the writer gives advance warningthe feeling or mood created by a writer...

"THER" words! 2023-02-09

16 Items: In a group.This or that.To have more.Not all alone.A different one.Want something else.A present from a bird.A male who has children.A sibling who is a male.The opposite of rougher.A female who has children.A male who has grand children.A female who has grand children.Something a baby uses to calm themselves....

Personally For You 2023-05-22

18 Items: Fat catOldest dogTommys catYoungest DogDepressed dogAnimal that meows.Animal that barks.Animal that barks offspring.Animal that meows offspring.Something you like to drink.A place you go to on Sundays.Something you do not like to do.Something you do in your past time.You have 3 of these in your family.You have 1 of these in your family....

Never Let Me Go: Writer's Methods 2022-12-12

15 Items: a repeated symbolanother word for speecha novel about growing upwhere a story takes placethe main genre of the novelsymbols or reminders of deaththe type of narrator Kathy isa comparison using 'like' or 'as'when the weather reflects the moodanother term for non-chronologicalwhen the writer gives advance warning...

Science crossword puzzle 2023-05-12

25 Items: Measures the air pressure.Measures the speed of wind.Change in moisture content.vane Measures the direction of the blowing wind.front When a boundary between two air masses stalls.pressure The weight of the air pushing down on earth.stream A warm water current that comes from the equator.gauge Measures the amount of precipitation that has fallen....

Survival vocabulary 2024-03-26

12 Items: A sound.It means "cuerda".It means "potable".A small town or city.You see yourself in it.An object used to cut things.If you stand ..... , you don't move.How you feel when you don't drink waterAn object that always points to the north.This word describes animals that live in nature.A small light you can use when it is dark or at night....

Monthly Challenge T-Z 2023-05-19

118 Items: trytailtaketalktallteamtelltesttextthanthatthentheythistimetiretoestowntreetriptrueturntypeunitverywaitwakewalkwallwantwarmwashwavewearweekwellwhatwhenwildwillwindwingwishwithwoodwordworkyeahyeartableteachteddythanktherethingthinkthreethrowtodaytoothtouchtraintreattricktruckuncleunderuntilvideovisitvoicevroomwatchwaterwhalewheelwherewhichwhilewhite...

Cluster 1 Lesson 1-5 Vocabulary 2024-01-17

16 Items: The importance of something to the matter at handHow people interact with their regions physical geographyA region's temperature and weather conditions over a long periodFinding a place using other places or features around it as a guideSurface features (such as mountains and valleys) in an area of land....

WORDLY WISE LESSON 2 (YELLOW) 2023-11-05

15 Items: To rot.To burn slightly.Very large or huge.A large tree branch.To bring about a change in.To figure out by reasoning.To order not to do something.To go beyond what is allowed.A group of trees growing together.To become fully grown and developed.To refuse to give in to; to withstand.The average weather conditions of an area....

9306 Shoes of Peace 2023-12-25

10 Items: A follower of Jesus.Told off or scolded.Son of God, Savior, and Lord.Belief and complete trust in GodBeing in a state of rest, not awakeReally surprised, in awe of somethingReally bad weather with lots of wind and rain.A kind of vehicle that floats and moves on water.A big area of water that is smaller than an ocean...

6th grade review. Maisie 2024-05-15

15 Items: made of ice crystalswhen a star explodesthe middle of the sunknown for its big ringsmost distant major planethas the hottest atmosphereknown as the 'classic' cloudonly known planet with living thingsthe top of the earth (we live on it)the largest planet in our solar systemsmallest and closest planet to the sun...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

Kody White 2024-05-16

15 Items: the hottest planetthe closest to the sunthe center of the earththe first form of a starthe third largest planetwhen lava cools in the waterthe outer layer of the earthwhen you can see the whole moonthe farthest planet from the suna planet that has the biggest ringthe only planet that has life on itwhen water evaporates out of a plant...

Weather and Climate Unit Vocabulary Word Search 2023-05-15

4 Items: Measures the air pressureMeasures the speed of the windThe weight of air pushing down on EarthLarge bodies of air that have uniform temperature, humidity, and pressure

Barometer Word Search 2023-05-22

15 Items: when colder air moves to warm air masswhen warm air mass moves to cold air massa weather device that measures air pressurea group of air with same pressure and humiditya device used to messure wind speed and directionthe weight of the molocules of a large mass of airwarm air mass is caught between two cold air masses...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

1. Word Search 2024-07-11

60 Items: AloneFortyProudSceneWhiskEnergyLetterNibbleNinetyShrubsAddressAlreadyBelieveBouquetClimberCunningGrammarHealthyLaughedMessagePassageReceiveRelaxedRewriteRoutineScratchStomachTwelfthWeatherWritingBrightlyBusinessDivisionEleventhFinishedFrightenInnocentMedicineNationalSentenceSyllabusThankfulThousandTomorrowTurmericCharacterDeliciousEducation...

Weather 2023-11-28

1 Item: sunny, cold, snowy, hot, stormy, windy, rainy, cloudy,

Biodiversity Vocabulary 2023-10-06

20 Items: eats plantseats animalsword for Earthbreaks down dead mattereats plants and animalsgroup of the same organismweather patterns over timecollection of organ systemshunts and eats other animalscannot produce its own energyassociated with living thingsorganism that feeds off a hostgroup of different populationsis hunted and eaten by predators...

UNIT 5 TORNADO EDUCATION 2024-09-29

20 Items: YOUR STATEYOUR COUNTYWHAT YOU LIVE INLIKES TO CHASE MICENOT WEAK BUT ------GVIOLENT CIRCULAR WINDOFTEN HEARD IN STORMSSPARKS IN THUNDERSTORMSSTRONG WIND THAT BLOWS: GU--STUFF THAT BLOWS THROUGH TREESNOT THE BACK BUT THE _________LIGHTER WIND THAT BLOWS: BR----AN ALERT TO BE SAFE IS A W------PRECIPITATION THAT FALLS FROM CLOUDS...

united 2024-01-05

32 Items: seamoonlakeatomoceanrivercloudsenergytissueerosionbiologyecologymoistureecosystemacousticsamplitudeatmosphereevaporationtemperaturecondensationaccelerationDwarf planet with two moonsplanet with the biggest ringslargest planet in the solar systemhottest planet in the solar system...

The Great Depression 2024-10-14

15 Items: known as the CCCknown as the SSAsevere dust stormswhen you are not employedA horrific time in historywhere investors buy and sale stocksknown as the Wall Street Crash of 1929chats created by Franklin D. Roosevelta time of low rainfall and dry weatherthe president who created the New Dealknown as the Mississippi River Flood of 1927...

Weather 2023-06-24

1 Item: competition, hill, wildlife, storm forecast, rotating storm, tropical cyclone, typhoon, hurricane, world meteorological organization, spin

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Women Clothing and Accessories 2023-08-30

30 Items: Tells timeUndergarmentIntimate wearHead coveringSheer legwearDenim trousersHair accessoryCasual footwearFor cold weatherFor pierced earsKeeps hands warmOne-piece outfitStretchy and snugButton-up sweaterOpen-toed footwearWorn on the fingerElevates your heightWorn around the neckAdds flair and warmthWorn around the wristHolds money and cards...

Merit Badges 2024-09-02

134 Items: ArtLawGolfPetsChessMusicRadioStudyHikingEnergyNatureRowingSafetySportsCookingCampingCyclingArcheryBuglingDogCareFishingGeologyPotteryReadingSkatingTextileTheaterWeatherWeldingFirstAidSwimmingAviationBasketryCanoeingClimbingDraftingForestryKayakingMedicinePaintingPlumbingRoboticsWoodworkAstronomyAthleticsBirdStudyChemistryDentistryGardeningGenealogy...

Bonham Word Search 2023-12-11

17 Items: Drummer for Rush.Drummer for Nirvana.Drummer for The Beatles.Queen's dynamic drummer.Iconic drummer of Pink Floyd.Genesis drummer and solo artist.Led Zeppelin's legendary drummer.Famous for his work with The Police.Renowned for his drumming with Cream.Drummer for the Red Hot Chili Peppers.The Who's explosive and innovative drummer....

Out of the Dust 2024-05-09

10 Items: the body of a dead animalrequired or bound by a promiseto become painful and inflamedto twist your body from side to side as in painthe upper layer of soil that is made up of grassto give up or leave something or someone entirelyto wait for the right time before you do somethinga show in a theater that includes funny songs, etc....

Climate Change 2023-04-29

1 Item: oxygen weather climate season

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

POSTIES 0115 COVER 2023-12-15

6 Items: how hot or cold something isa place that protects you from bad weather or dangerheat, energy, etc. that is sent out in the form of raysa substance that consists of very small fine grains of rockcausing damage or injury to someone, especially to their health...

CompTia ITF 2023-02-03

12 Items: How to treat people.Number system based on 8.Connects devices to Wi-Fi.Connects home to network ethernet.Company that created the ITF exam.Number system based on 2 numbers 0 and 1.Image that doesn't lose quality when resized.Number system based on 10 numbers and 6 letters.Type of internet that may be disrupted by weather....

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

Daddy-Long-Legs pgs. 44-48 2023-10-16

15 Items: Why was Mr. Jervis in town?What did Jervis give a box of?How does Judy feel with Jervis?Where did Judy eat with Jervis?How does the campus look in May?Who did Mr. Jervis come to visit?Where is Judy going for the summer?What is Judy working hard to become?Where did Judy and Jervis walk around?How many months will Judy be on a farm?...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

gothic elements and gothic words word search 2023-04-22

14 Items: a non living spirita blood sucking monstera place where the dead restbeing left on a cliff hangeran unatural thing or creatureunkowing of what will happen nexta place that people can go to praywhere the weather affects the moodan era of time known as the dark agesa building someone rich might live ina young lady often in distress in gothic books...

cute words♡ 2023-10-25

160 Items: momnapskysunteacakecutedearfallhopehugslakelifelilylovepetsrainrosesandsofttoysbeachbloomblushbookscleandaisydancefreshfunnygiftsgrasshappyhearthoneyhubbyjellojollylightlunchmerrymusicoceanoreospeacequietrelaxrivershinesillysleepsmilesongsstarssweetswingtastytouchtreestruthwaterwavesyummyangelsapplesautumnbreezebrightbubblycolorscuddledreamsfamily...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

Brynn's CrossWord Puzzle 2023-05-12

24 Items: Measures the air pressure.Measures the speed of wind.Change in moisture content.The weight of the air pushing down on earth.When a boundary between two air masses stalls.A warm water current that comes from the equator.Measures the amount of precipitation that has fallen.Form when a colder air mass moves toward a warmer air....

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

Unit 10: Atmospheric Science and Pollution 2024-04-25

14 Items: the ocean's pH becomes more acidicatmospheric layer in which auroras occuratmospheric layer that breaks up meteorsthin layer of gasses surrounding the Earthatmospheric layer that contains the ozone shieldheat can be reflected by gasses in our atmosphereatmospheric layer in which all weather events occur...

Advanced Science 2023-02-28

21 Items: study of arachnidspollination by birdsWhat mammal lays eggsalloy of copper and zincwhat type of fish is albacoreAnother name for the stone ageLinseed oil comes from what plantHow many men have walked on the mooncloud at ground level is called whatthe rabbit has how many incisor teethThe fastest-running terrestrial animal...

El Hombre de Vocabulario PE 2/Quizlet 2024-09-11

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustpleaseseasonwinterspringsummerTuesdayJanuaryOctoberyou saynotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberhow manyIt's hotclassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyIt means...student deskIt's rainingIt's snowingfall, autumnstudent (male)...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Geography & US Regions 2023-02-08

9 Items: The way a certain place makes moneyThe average weather in a given area over a longer period of timeA region famous for citrus fruit, alligators, jazz music, and seafoodAnything that is found in nature that can be used by humans or animalsThe act of people traveling to places outside of their usual environment...

English language devices Word Search 2023-06-25

15 Items: a naming wordwords that link to each othera word used to describe somethingan action or something that you can doa comparison using the words like or asthe repeated use of the s sound in a wordthe same starting letter for two or more wordsdescribing something as though it is an animalusing a word that sounds like the sound it makes...

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Summer Wordsearch 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Units 47 & 48 part 3 2024-03-15

40 Items: credit(math) minus(το) the dollar(η) the square root(ο) the (shape) cube(το) the social media(το) the figure, shape(η) the (math) algebra(ο) the (weather) wind(η) the saving, thrift,(η) the temperature, heat(η) the rain, rain shower(τα) the mathematics, math(το) the coin, physical currency(η) the value, price, worth, merit...

summer 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Weather and Climate 2023-05-12

1 Item: stream Warm water current

Fall And Fall Again 2024-10-03

1 Item: Football,Daylight,Weather,Orange,Hotdog,People,Leaves,Candy,Party,Coats,Treat, Trick,Rain,Fair,Hot,Fur

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Anniversary Silly Search 2024-08-22

15 Items: The most wonderful drinkA favorite Western holiday for usAn object in the sky we both adoreA favorite weather event for us bothA desi drink we both have almost dailyYour Disney plushy friend won at a county fairThe name of the trivia game we played early onA reality show we watch with the romance and drama...

REMEMBERING CONCEPTS 2023-03-19

1 Item: BREEZE, OCEANCURRENT, LEEWARD, WINDWARD, RAINSHADOW, THERMOHALINE, WIND, ALTITUDE, CLIMATE, SOLSTICE, TROPIC, ARCTIC, CORIOLISEFFECT, HUMIDITY, SALINITY, TEMPERATE, WEATHER, ATMOSPHERE

Trade 2023-10-23

7 Items: Exchange of goods and servicesIslands Europeans' name for the Moluccas, islands rich in cloves and nutmegOcean Trade Route A sea route of trade that connected India, China, the Middle East, and Eastern Africa.Trade Route gold-salt trade; linked North and West Africa; across Sahara Desert; spread Islam; land trade...

Summer Words 2024-09-01

10 Items: A drink made from lemons, sugar, and water, usually served cold.The activity of moving through water by using your arms and legs.Red, sore skin caused by too much sun exposure without protectionThe area or land close to the sea; a place people visit for vacationsA small building made of wet sand, usually built by children on the beach....

Acción de Gracias 2023-11-21

16 Items: mes de Thanksgiving - Thanksgiving monthel clima actualmente - the weather right nowuna comida con verduras - a food with veggiesestación de Thanksgiving - Thanksgiving seasonmes después de Thanksgiving - month after Thanksgivingúltimo día de clases esta semana - last day of class this week...

Natural Resources 2024-03-10

25 Items: resources that occur naturallymixture of gases surrounding earth3 types of inexhaustible resourcesremains of decomposed plants & animals3 types of renewable natural resourcesnatural resources used to provide energycycle where water is continuously renewednatural inorganic substances on or in earth2 types of of nonrenewable natural resources...

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

Week 12 Hard 2023-12-16

25 Items: to startkept goingto replacesignificancebursting outgovernment buildingOccurring every yearthe study of the pastA period of deep sorrowGive me the short versiona doctor who performs operationsthe minimum amount to sustain lifeto honor something in a special wayto sink a ship by cutting holes in itthe fact or process of doing something...

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

united 2024-01-05

14 Items: mooncloudserosionatmosphereDwarf planet with two moonsplanet with the biggest ringslargest planet in the solar systemhottest planet in the solar systembranch of biology that deal with the study of plants, including their structure, properties, and biochemical processes....

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

Pavel's Lord of The Flies Word Search 2022-11-23

26 Items: ridiculous; absurddejected; dispiritedshy; reserved; sedateharshly pungent; bittermaking little or no noiseforceful; causing to yieldproper; in good taste; orderlydeep hatred; animosity; ill willnearsightedness; lack of foresightstronghold; fortress; fortified placeto shake tremulously; quiver or tremblea break or interruption; often from work...

Vocab word search 2024-04-26

12 Items: the part of your hand near your thumbA shocking moment, a great surprise of amazementlock of hair. A piece of hair hanging like a curlA fast movement of something or where you twitch.you achieve something a victory, you are successful.steadily into someone or something with a dead stare...

WAY OUT THERE in SPACE 2024-03-01

34 Items: We live on itThe Blue PlanetNow a dwarf planetToo large to handleAir surrounding earthShe's too hot to handleConsidered the red planetGives warmth to the earthStreaks of light in the skyThe name always sounds funnyThe solid outer part of earthThe only planet that can floatThe region surrounding the SunBrightly colored bands of light...

Natural Disasters 2023-11-29

11 Items: a large piece of ice floating in the ocean.a strong and very big storm that forms over warm oceans.when the Earth shakes because of the movement of rocks underground.A drought is a long period of time when there is little or no rain.a bad weather condition with strong winds, rain, thunder, and lightning....

All About 3rd Grade! 2022-06-08

1 Item: Chapter books, Animal Research, Poems, Opinion Writing, Jump Rope, Multiplication, Division, Clocks, Fractions, Area, Perimeter, Geometry, Invertebrates, Vertebrates, Photosynthesis, Mystery Science, Life Cycles, Weather, Pilgrims, American Revolution, Ma