veterans day Word Searches

Word Search - Stock Market edition 2024-11-10

10 Items: Regulator of Share MarketPurchase and Sell of goodsValue of MO - Find the missing PA_IMEBuying and Selling of shares on the same dayWhere purchase and sell of shares is carried outInstitute which holds shares in Electronic formatOwnership provided by company in exchange of CapitalWhere stock is listed in the market for the first time...

Triangle Word Search 2024-03-23

14 Items: Circle-----spherePlant-----to grow a treeLeaves-----a part of a plantMorning-----a period after dawnSpring------from February to MayAutumn----from August to NovemberFavorite-----like more than othersEvening-----the period after the sunsetAfternoon-----a period in a day after noonSquare-----a shape with four identical sides...

collingwood world book day wordsearch 2024-03-04

4 Items: anadiplosis narrative novellascifi fantasy pantalaimon pageturnerdystopian caesura hobbit bilbo librarianhorror chapter epistrophe dahl endstop romance

game time baby (Q&Jess edition) 2023-11-14

23 Items: Bi-iconHow we metYurt + HomeHeat + waterJess is allergicthis is Q (fire)Best protein everJess's birthstonethis is Jess (water)For the love of ____Camping with friendsYou feel at home hereOur first show togetherFlavor you're obsessed withThought we'd run out of gasOur first time getting drunkOur favorite food spot in LAWe love a good day trip here...

Spanish tic tac toe 2024-02-04

48 Items: AllBadMeatFishPeasRiceFatsI doMustWhy?ManySteakOnionTastyDinnerGrapesGrainsButterChickenLettuceCarrotsTo walkI thinkI agreeBecausePotatoesTomatoesPastriesI preferTo ThinkHorribleEach daySpaghettiIce creamBeveragesYou do tuSomethingI’m HungryI think soGreen beansI’m ThirstyTo exerciseYour preferI don’t agreeTo lift weightsFor one’s health...

trs 5b w17 pt2 2022-06-15

10 Items: adj. Foods from milk.n. e.g. Van Gogh, Da Vinci.n. What and how much you eat.food n. Tasty but unhealthy food.adj. Not having too much anything.v. Get rid of something. Put in the trash.adj. Adjective for food cooked by a flame.n. What you eat three times a day. Not a snack.adj. How you feel when something is horrible or yucky....

Video Game Characters 2023-07-07

20 Items: Hadoken!Get over here!Pokemons mascot.One winged angel.Do a barrel roll!A tie wearing gorilla.Earthrealm's Thundergod.Used to be called Jumpman.Grandmaster of the Lin Kuei.Hedgehog that's gotta go fast.First Lady of Street Fighting.His bird buddy is called Kazooie.Eats pellets for days, afraid of ghosts.Final Fantasy's most popular protaganist....

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

Albert Anglais 2022-06-07

54 Items: etquieuxsonqueicibonvietoutvoirdansjourplusleurquandannéefairetempsveniralorsautrecommechosefemmehommepensersavoirdehorsdehorsdonnerenfantjoueurprendrecommenttrouvermauvaistravailquelquespourraitvraimentderrièreutiliserbeaucoupvotre, vosnotre, nosmaintenantprovient dequel, quellen'importe quelseul, seulementenviron, à proposelle, ses (féminin)...

Loona Songs 2024-10-01

119 Items: d1urnew365pttwowairrosyheatstarposehowlloopttylvividedinyvoiceneedulucidnokiabirthpuzzleseesawegoistonewayfrozenhihighcolorsyumyumaliensletmeineclipsechaoticuncoverstylishsowhat?number1whynot?dioramaunf/airsparklethecarolmysundaymymelodytwilightone&onlysonatinerain51dbloonaticlove4evafavoriteohyesiamuniverseflipthatluminoushulahoopdaybydaynewtopia...

Miss Capps' Class Word Search 2024-10-28

34 Items: angleacuteobtuseRalphiealgebrapencilsgeometrytrianglesunshinecongruentwatercoloryour schooltransversalmississippiyour teachernotebookpapershow your ______solve the _______exactly 90 degreesmiss capps' hometownpopular teacher giftmiss capps' black catadds up to 90 degreesmiss capps' blonde dogadds up to 180 degreesmiss capps' favorite hobby...

DAY AND NIGHT POWER WORDS 2023-04-23

4 Items: facesfadesshinespattern

Senior Geography Word Search 2023-10-10

20 Items: Northernmost polar circleSouthernmost polar circleThe continent on which we are currentlyThe largest and most populated continentThe continent on which Charles and Don are currentlyThe second largest and second most populated continentThe least populated continent (by a considerable amount)...

Animals 2023-10-11

10 Items: Mention one flightless birdHow many legs does an octopus haveWhich bird is the symbol of peace?which is the tallest animal in the worldName the animal which can grow till its deathWhich is the only bird that can fly backwards?arctic whale: which animal has the longest lifelineWhich insect can lift up to 50 times its body weight?...

Hanukkah 2022-12-07

10 Items: Judah Maccabee's nickname.Hanukkah customs include playing with four-sided spinning tops called ______ and exchanging gifts.Jewish scholars have also suggested that the first Hanukkah may have been a belated celebration of ______.In another interpretation, Jerusalem under Antiochus IV had erupted into civil war between two camps of Jews....

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

Word Search 2022-10-13

19 Items: A feelingYellow fruitEnglish alphabetThe place we liveCapital of AmericaState with four i'sA very cold countrySmall armored animalA day where one is bornBest gym in the countryAlcohol, typically from ScotlandA series about six friends in NYTechnical item we cant live withoutOur really amazing teacher in English...

November 2022-10-28

1 Item: hayrides scarecrow acorns bonfire election leaves harvest family veterans football turkey cold Indians sweaters pilgrims spices pumpkin November thanksgiving fall

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

FOOD 2024-04-22

16 Items: tastes goodsugar is ______lemons are ______you cook food in thisyou cut food with thisstrong coffee is ______the first meal of the dayyou wash dishes in the _____how you feel when you want to eatyou put food in this to keep it coldthe person who cooks food in a restaurantto stay healthy, always eat fruit and _____...

Happy Mother's Day 2021 2021-04-21

3 Items: MOMBESTEVER!

ellies wordsearch 2023-12-18

16 Items: to create lighta pattern of starsthe study of planetshas the north star in itfor light to bounse of itthe study of constellationsa rock that falls from spacea person that travels in spacea spoon made of made of 7 starslight in the sky from a meteoroidapath in space around a planet/starwhen night and day are the same length...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Renaissance 2024-10-08

15 Items: rebirth_ years of war.Died from a stroke.Had three children.Worked 18 hours a day.Believed in top Depravity.95 statements on a documentBridget Bisop was involved in the _.Spaghetti is known for being greated here.This is the way individuals see the world.An expectation about someone or something.He was mad at the clergy selling "indulgences"...

Want more customers for your business? 2022-06-06

12 Items: us.offeronly use chat.- +375259112693- @FeedbackMessageslive:contactform_18day! wordsearchlabs.comcost of one million messages 49 USDTEST mailing Up to 50,000 messages.offer is created automatically. Use our contacts for communication.database contains more than 27 million sites around the world to which we can send your message....

Phone Word Search 2023-12-28

9 Items: electrical applienceOther word for "behind".The city in Northern Ireland.The Day of pink T - shirts is fight against...Emotions because we are do not to do any obligations.When we get bitten by a mosquito, the consequence is...Actions we do in free time because we love that and we good at....

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Great Depression 2023-03-09

20 Items: like a farmlike a citystuff you eathelping the poora non-profit joba very poor townno alcohol allowedstopped prohibitiona share of a companya community outside a cityto come back from a down timetravel from on place to anotherthe day the stock market crasheda place where you go to learn stuffheat going through a house of building...

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

Enero Word Search 2023-03-03

20 Items: not bad butnot good butopposite of sadopposite of youngcolor of the cloudsmonth of graduationnumber after nineteenhaving a lot of moneyfirst month of the yearhe wasn't handsome he waswhere you go to make moneyif something isn't true it'show you feel after a long daywhen you have a lot to do yourat diez y acho i am still very...

WORLD PHYSIOTHERAPY DAY WORD SEARCH PHYSIOTHERAPY DEPARTMENT HOSPITAL KUALA LUMPUR 2024-09-18

10 Items: BACKSPINEMOVINGCHRONICPOSTUREEXERCISESTRENGTHEDUCATIONERGONOMICLIFESTYLE

Henry's Sky Science Word Search 2023-12-18

14 Items: a small rock in spaceto discharge somethingthe study of the universedebris from an object in spacewhen light bounces off another objecttrain their whole lives to go into spacea big rock made up of dust and particleshappens when the sun crosses the equatora smaller constellation of the big dippera famous constellation that resembles a big bear...

Vocab List 3B 2023-05-09

48 Items: AllBadMeatPeasRiceFatsI doWhy?ManySteakOnionDinnerGrapesGrainsButterYou doLettuceCarrotsTo walkI AgreeBecausePotatoesTomatoesPastriesI PreferTo ThinkHorribleSphagettiIce CreamBeveragesSomethingEvery DayI'm HungryYou PreferI Think SoCooked FishGreen BeansI'm ThirstyTo ExcersiseShould, MustI Think ThatChicken(Food)I Do Not AgreeTo Lift Weights...

Filler Week 4 2023-02-03

10 Items: Baby Raccoons [Raccoons]A baby shark [Hammerhead Sharks]Fiction[What Happens Next, Katie?]Raccoons eat anything: they are _____ [Raccoons]A tool used to twist a nut [Screws, Nuts, and Bolts]A box or pot for saving money [What Happens Next, Katie?]Modern day relative of the ancient armadillo [Ancient Armadillo]...

Meeting Wordsearch for my Food Drop Off Hero 2022-10-05

21 Items: What we swipedThings to comeWhere we were bornWhere we both liveWhat I am with youSomething you work onCity you were born inWhat I am in right nowSomething we both loveLives super close to mePlague I currently haveThe chance we connectedPlatform that connected usHow we have been communicatingWhat you were wearing yesterday...

3B Spanish 2023-05-08

48 Items: whyallbadmeatpeasricefatsI domanysteakoniondinnergrapesgrainsbutteryou dolettucecarrotsto walkI agreebecausepotatoestomatoespastriesI preferto thinkhorriblespaghettiice creambeveragessomethingevery dayI'm hungryyou preferI think socooked fishgreen beansI'm thirstyto exerciseshould, mustchicken(food)I do not agreeto lift weightsfor one's health...

Jessica & Parker 2024-08-03

28 Items: Parker's nieceParker's sisterParker's nephewParker's hometownJessica's hometownParker's birth monthJessica's oldest sonJessica's professionParker's middle nameJessica's middle nameJessica's birth monthJessica's maiden nameJessica's older sisterParker's favorite sportParker's favorite colorJessica's oldest twin sonThe month Parker proposed...

VocabMan 2 2024-09-17

63 Items: inpendaymayhotbookyearweekjunejulycoldfallmonthtodaymarchaprilwindyfolderpencilmondayfridaysundayaugustpleaseseasonwinterspringsummertuesdayjanuaryoctoberhowmanyrainingsnowingnotebookthursdaysaturdayfebruarynovemberdecemberHacesol.classroomtommorrowwednesdayseptemberyousay...itmeans...studentdeskwhatdayisitLaestudiantestudent(male)teacher(male)...

Vowel Team Syllables Week 1 2024-02-12

10 Items: I wear _____ with my snow pants.I like to eat _____ for breakfast.Can you please put your project on _____ !I use my umbrella to _____ me from the rain.One hour of t.v. a day is a good _____ for kids.Be sure to check for trains on the _____ tracks!The chemicals in the cleaner will _____ your body!...

Tzitzit- clues only 2024-06-03

10 Items: Shearing the wool off the sheepThe uniquely colored string among tzitzitTzitzit should not be cut using this materialSpecial piece of fabric at the top of a tallitThe Tzitzit garment that you wear during prayerThe Tzitzit garment that you wear throughout the dayNumber of total strings that each corner is made up of...

anything 2023-10-17

130 Items: foxelfbobgrut5grumlegarmsunsindayredpitcatdogabsicealexlinkwolfferbryanolafelsaannasmg4smg3smg2smg1smg0taribookbootkidscakerakezurgxmasreadgearkingnosejakenerdricelambfaceveryvasepinkbluejokelakelakeirisbearmariopeachstevewariozeldaganoncappysamussnakemidassloneluigikirbykevensantaplutogoofypeteymeggyjonesdumboblazeninjatablesnackapplewoodymelon...

DANNY DEVITO 2024-10-25

135 Items: ADDAIDANDANTANYATEDADDANDAYDENDIDDINDONDOTDYEEATENDEONETAINNIONIVYNANNAYNETNODNOTOATODDODEONETEDTEATAOTOETOYVETYEAYETANONANTIAVIDDATEDEANDENTDENYDIETDINEDINODIVADIVEDONEDYEDEDDYEDITENVYIDEAINTOIOTANANONAVYNEATNEONNODENOTENOVAOVENTENDTIDETIDYTIEDTINYTONETONYVAINVEINVENTVETOVOIDVOTEYETIAIDEDAVIONAVOIDDANDYDATEDDEITYDEVONDINEDDIODEDIVEDDIVOTDONNADOTED...

Ally 2024-05-21

14 Items: - low in the sky- category of water things- Planet in space with 7 ring- lights up the earth at night- category with rock and ground- only planet with water in space- when a liquid turns into a solid- only planet in space with storms- category with living things in it- when the continets were all in one- in space things that shine really bright...

Colors 2024-07-19

10 Items: "The darkest color, like the night sky.""The color of grass and leaves on trees.""The color of the sun and a ripe banana.""The lightest color, like fresh snow or milk.""A color resembling that of wood or chocolate.""The color of ripe strawberries and fire trucks.""A light shade of red, like the color of a rose."...

CNA Lesson 17 Review 2023-01-22

15 Items: walkingturning upwardturning a jointturning downwardbending backwardbending a body part or jointstraightening of a body part or jointmovement of a limb toward the midline of the bodymovement of a limb away from the midline of the bodydevice used to maintain a body part in a fixed positionpermanent stiffening of a joint or muscle caused by atrophy...

Ki Tetze 2024-09-08

18 Items: ShalomTeshuvahthe rams horn.Our worst enemy ever!Amalek’s grandfather.A temporary dwelling.a guardrail for a roof.Literally, “Head of the Year”74 are found in portion Ki TetzeHow long are we to remember Amalek?The last letter of the Hebrew alef-beit.Rosh Hashanah is said to be his birthdayThis Hebrew letter has a number value of 20...

CREATE SENTENCES 2022-10-14

2 Items: NEVER EAT ANYEAT SOME VEGETABLES EVERY DAY

Colors and other things 2023-03-08

20 Items: - Hair on your head- The color of blood- The color of coffee- The color of clouds- The color of the sky- The color of the sun- The color of the Moon- The color of eggplants- The color of an orange- A shiny version of gray- The color of tree leaves- A shiny version of yellow- The color of Mr.Roldan's hair- We do this when we hear music...

Vocab List 3A 2023-04-28

55 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverRightCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysI LoveI LikeSausageHot DogWithoutLemonadeIced TeaTo DrinkTo Shareyou LoveYou LikeBreakfastFor LunchHamburgerFood,MealEvery DayOf CourseHow AwfulSoft DrinkFruit SaladApple JuiceStrawberriesFrench FriesOrange JuiceMore or Less...

Emma and Toby's Word search 2024-06-08

23 Items: Toby's car?Emma's car?Emma works for?The wedding car?Emma's middle name?Who is left handed?The Brides mums name?The Brides dads name?The Grooms dads name?The Grooms mums name?Where did Emma go to uni?Toby teaches what subject?What bird rhymes with love?Emma's bouquet is what flowers?What county did Emma grow up in?What county did Toby grow up in?...

Askiathegreat Word Search 2024-10-04

27 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

New year's day 2024-02-16

2 Items: tenmonkey

PU1 Word Search (BUSCAPALABRAS) 2024-09-09

23 Items: FunnyWelcomeThe manExcitedThe womanThe opposite of "alto"Antes de «Buenas tardes»El trabajo del Sr. SpearsThe opposite of "delgado"Use this to take notes in.The opposite of "tener calor"The opposite of "tener hambre"Another way to say «mucho gusto»Use this to find out ¿Qué hora es?¿_____ ______ tus clases hoy? ¿Bien?...

Card Connections Summer 2024 Recap WORD SEARCH! 2024-09-20

40 Items: Julypizzapizzaaugustbakingcostco___ fraud___ amountdispute ___extra creditextra creditexpialadociousCard Specialist ___they moved to MilwaukeeAngela's favorite hobbiesour project team is pretty ___.who's basket are you bidding on?Card programs' newest team member!the card specialists are pretty ___.the dispute specialists are pretty ___....

October Word Search 2024-09-23

12 Items: rosh. jewish new yearyom. day of atonementor, a festival/ activity!our first issue release monthone of the most popular U.S. holidayshappy birthday to all October birthdays!meteor shower happening the 21st & 22nd this montha common fall spice, you might use it in in another word…maybe not as good as a spice, but a fall staple nonetheless....

Anokha Word Search 2024-08-03

6 Items: CHAPTER OF THE MONTH(4 letters)ONE OF THE CLUBS OF THE MONTH(6 letters)The club that organized the "Hands of Farmers" event.(5 letters).EVENT BY THE DANCE CLUB TO RAISE AWARENESS AGAINST SUBSTANCE USE(11 letters)The club that organized the "International Day Against Drug Abuse and Illicit Trafficking." (6 letters)...

Word search Day 10 - Orchidaceae, and others lab 2023-06-30

6 Items: catlionzebrahippoelephantMan's best friend

Mazzy Wedding 2022-12-29

16 Items: Which band is Mare's favorite?Jazz's birth month is _________.Mary drinks this beverage every day.Mary has had her permit _______ times.The couple share a son named ___________.Mary's favorite flower is ________________.Jazz and Mary met in the month of __________.Mary and Jazz's first date was at ___________....

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

Classroom Expectations Scavenger Hunt 2024-09-04

7 Items: Mrs. Ford's dog's name is __________________.Find your ___________________ number hanging above your head.Is it a ______ 1 or ______ 2? You can find out on the whiteboardClass Expectation #2 Pause conversations by the end of ______________ or countdown.What are we doing today? Check the ____________ on the right side of the front whiteboard....

christmas history 2022-12-03

16 Items: 1939.A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.This reindeer was created to advertise for the Montgomery Ward stores inFor some Romans, this god's birthday was the most celebrated day of the year....

American Holidays Vocabulary 2024-02-21

12 Items: freedom____________to work____________a gathering of people to have fun_________a day celebrating a famous person or event ________a person who has spent time in the military________respect that is given to someone who is admired ___________to do something special for an important event________________...

October Word Search 2024-09-23

12 Items: rosh. jewish new yearyom. day of atonementor, a festival/ activity!our first issue release monthone of the most popular U.S. holidayshappy birthday to all October birthdays!meteor shower happening the 21st & 22nd this montha common fall spice, you might use it in in another word…maybe not as good as a spice, but a fall staple nonetheless....

Word Search - International Yoga Day 2024 Chalapathi Institute of Pharmaceutical Sciences (Autonomous) 21/06/2024 2024-06-21

40 Items: yogacalmkarmafocusbodhimudrapeacesleepchakrabandhadhyanadharmamantrastresshealthmemorysadhanaplacebothoughtabhyasatherapyanxietymeditatepracticenamasthepolaritycleaninglearningshavasanacognitionpranayamabehaviourchaturangapsychologyrelaxationcompassioncreativitymindfulnessperformanceconcentration

New year's day 2024-02-16

2 Items: tenmonkey

5B wk19 2024-01-16

16 Items: The square is a _____ with four equal sides and four right angles.He has _____ with his homework, so his teacher gave him extra time._____ up the living room will make it more comfortable for everyone.The _____ in the bedroom is soft and comfortable to walk on. I love it.The salad has a variety of _____, such as lettuce, tomatoes, and cucumber....

christmas history 2022-12-03

15 Items: A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.For some Romans, this god's birthday was the most celebrated day of the year.This reindeer was created to advertise for the Montgomery Ward stores in 1939....

Camisa Word Search 2023-03-29

8 Items: Usually the top layer of your clothingSomething you wear on your head on mainly sunny daysUsually the bottom layer of your clothing on your top bodya piece of clothing you wear on the bottom part of your bodya piece of clothing that you wear to cover your private areasSomething you wear mainly during the day to cover your bare feet...

שמואל אי פרק ח 2024-01-15

13 Items: Shmuel's son #1Shmuel's son #2The Jews complained to himJews asked for this from ShmuelShmuel's sons settled in this cityWhoever says the sons of Shmuel sinned is ___A king could make their daughters ___ makersThe Jews weren't meant to be like the other __A king will take this much of the people's grain...

Banking Services Terminology 2024-09-10

23 Items: Compounded every dayCompounded every yearAnnual percentage rateCertificate of depositCompounded every monthCompounded twice per yearCompounded twice each monthCompounded every other weekCompounded every infinitelyDeposited on a set scheduleCompounded every three monthsMoney withdrawn from an accountMoney deposited into an account...

Movie Word Search 2023-05-04

43 Items: PiItHerTedBlondeCarrieScreamAvatarmother!AladdinEternalsMagnoliaSuperbadCat's EyeChristineLife of PiMadagascarMean GirlsSecretariatBarry LyndonThe AvengersPulp FictionThe FabelmansBoogie NightsJurassic ParkCool RunningsThe TerminatorRomeo + JulietT2: Judgement DayKill Bill: Vol. 1Kill Bill: Vol. 2The Hateful EightBrokeback Mountain...

Mollys Wordsearch 2023-12-18

20 Items: the big bearthe small bearthe study of planetsorbit around the sunthe galexy we live inour solar systim is in onethe study of constellationsthe bigger spoon in the skythe smaller spoon in the skyif a meteor touched a groundalso knowen as a shooting stara formation of stars in the skyan object that light bounces off of...

2nd Grade Alexander and the Terrible, Horrible, No Good, Very Bad Day 2018-04-02

10 Items: timelylonelymostlyslowlytotallyquicklyhonestlyperfectlynervouslyhopefully

Pirket Avot פרק ג, משנה טז 2024-04-16

19 Items: This writesThis is openHe offers creditHe is the shopkeeperEverything is given on _Nobody can escape Hashem's _Hashem has this as collateralthey go around often every dayHashem runs the world like thisThis lies open (you write in it)all who wish to _ may come and _The judgement is a judgement of _This is spread over all the living...

Tuck Everlasting Chapters 1-5 2024-01-19

18 Items: Not eagerLook searchinglyCapable of being reachedShowing fear and lack of courageMade less hopeful or enthusiasticFeeling or expressing pain or sorrowPrevent from being seen or discoveredA quick reply to a question or remarkDeficient in amount or quality or extentA formal and solemn declaration of objection...

Water safety 2023-11-23

16 Items: important sea safety hintnice sea view by the seasideuse it to dry up your wet bodyprotects your head from the sunan activity we all enjoy at seais the main component of the seaa virtue you must have by the seasidethe name of a garment you wear to swimwhen ever in doubt about where to swimdangerous objects buried under the sand...

Sip and search 2024-06-06

23 Items: Toby's car?Emma's car?Emma works for?The wedding car?Emma's middle name?Who is left handed?The Brides mums name?The Brides dads name?The Grooms mums name?The Grooms dads name?Toby teaches what subject?What bird rhymes with love?Emma's bouquet is what flowers?What county did Toby grow up in?what county did Emma grow up in?...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Monsters of Myths and Legend 2023-06-20

15 Items: You're after his lucky charms.West Virginia's beloved monster.Stone by day, warriors by night.The terror of sailors the world over.Friend to talking donkeys. Has layers.I hope you brought silver tipped bullets.Bigfoot's frosty cousin in the Himalayas.Garlic and crucifixes will ward these away.This is what you'd classify Frankenstein's monster as....

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

Chukat ~ “Statute” 2024-07-07

17 Items: Moses’ sisterAbraham’s nephewHe dies at Mount HorHebrew word for “statute”Hebrew word for a good work.Hebrew for “instruction” or “teaching”“outside the camp” during Temple times.Messiah Yeshua is the _____ of the Torah.The last enemy to be destroyed. 1Cor15:26The person who took Yeshua’s body away for burial....

Vocabulary Unit 1 Station 2 2022-10-19

10 Items: Carrots, broccoli, onions are ...My biggest ... is becoming a famous star one day.A good ... has to know all the players in his team.Some teachers ... nice at first, but are really nasty.Do you like Mexican chili? - Nah, it's too ... for me.Tom has been ... so he can't go and see a movie with us....

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Paulina & Matias 2024-09-27

25 Items: The Couple's SongKendrick vs. DrakeThe Bride's first jobThe Groom's first jobThe Bride's birthday monthThe Name of the Groom's barThe Bride's favourite movieThe Groom's favourite hobbyThe Name of the couple's catWhere the couple got engagedThe Couple's first date spotThe name of the wedding venueHow did the couple first meet?...

N5-2C7 2024-10-23

44 Items: costnovelcareerall dayfreshmanaptitudenerd/geekprofessorto educateproductionto providescholarshipmemorizationgood companyto get a jobupperclassmanpractice roomcharacteristicto enter schoolpass, acceptanceto explore careerto select a majordocuments, papersto train, educateindustrial demandparents of students교육 teaching by rotepassion, dedication...

Askiathegreat Word Search 2024-10-04

28 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Try to Be the Only One pt.2 2024-03-05

26 Items: 聞く(hear)人生(life)賛美歌(hymn)他の(other)伝える(tell)ラジオ(radio)教会(church)考える(think)聴く(listen)いくつかの(some)について(about)牧師(minister)静かに(quietly)ある日(one day)meetの過去形(met)とても(very much)欲しい,〜したい(want)tellの過去形(told)hearの過去形(heard)findの過去形(found)wantの過去形(wanted)気づく,見つける,探す(find)thinkの過去形(thought)listenの過去形(listened)理解する,わかる(understand)興味がある(be interested in)

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

ww4 u10 2024-06-07

14 Items: What _______ you?The knight ______ the dragon.What is the _________ of the lake?What are the ________ you are experiencing today?The dog _______ from the sound of the vacuum cleaner.It is kind to __________ your friend if they are sad.It is important to ______________ well in a friendship.The king decided to _________ the thief from the Kingdom....

Thanksgiving knowledge 2024-10-04

11 Items: Which month is Thanksgiving celebrated in the US?What type of pie is a popular Thanksgiving dessert?First province to celebrate Thanksgiving in Canada?Which US President made Thanksgiving a national holiday?Which day of the week is Canadian Thanksgiving celebrated?What is the bird traditionally associated with Thanksgivng?...

Devarim 2024-08-03

18 Items: King of BashanKing of Heshbon.יַרְדֵּן (English)הַדְבָרִים (English)Brother of the Master.synonymous with “overseer”Number of men it takes for a minyan.The 12 spies are better known as ______.Moab and Ammon were descendants of ____.Moses’ farewell speech to the sons of Israel.The original inhabitants of the territory of Mt. Seir....

New Words for the Week of November 6 2023-11-11

17 Items: Our neighbors kept chickens in a _________.What will I _________ if I look in your bag?If you have an itch, you want to _________ it."Please forgive me!" she said with a __________."My car was stolen! Somebody call a __________!"After dinner, Budi had a big _______ on his face.On a warm day, your ice cream cone will _________....

Unit 1 week 2 and Unit 2 week 4 2023-09-28

15 Items: very valuable to you.it is in danger of being hurtto represent ideas or objectsbravery in a difficult situationyou remembered something from the pastto be stay alive after a dangerous eventthings that have been done for a long timeyou do something special for a day or eventis the number of people living in a certain place...

Terrific Tainos! 2024-10-15

15 Items: CubaHaitiJamaicaPuertoRicoDominicanRepublicTaino villages are known as YUCAYEQUESMarried Taino women wear a short apron called NAGUAThe huts in the middle of Taino villages are called BOHIOSTaino language was carved into stones known as PETROGLYPHSModern day descendants of Tainos live in the places listed below:...

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...