technology Word Searches

EDU 200 Chapter 3 Vocabulary 2024-07-01

15 Items: a person's ancestrytechnology that adapts to support students with disabilitiesa rigid, simplistic caricature of a particular group of peopleimmigrants who are fleeing unsafe conditions in their home countriespart of the inclusion process whereas you work with other professionals...

EXERCISE 130326 2026-03-13

15 Items: What group of scholars developed critical theory in the 1920s?Which philosopher helped develop the foundations of critical theory?Which theory challenges systems of power and inequality in communication?Which scholar introduced the concept of the public sphere in communication?...

Wuxi Word Search 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Gardner Denver Thomas 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Globalization 2025-08-05

1 Item: Tariff, Economic, united nations, Cultural, Transportation, immigration, import , export, world bank, liberalization, international, business, company, urbanization , communication, trends, Market , supply, technology

TOPIC 8: APPLICATION PORTFOLIO MANAGEMENT 2024-05-08

20 Items: Simplifying the APM process with automated data collection.Identifying and managing IT software applications company-wide.Formulating an EA vision that makes business objectives feasible.Determining which applications do not support business capabilities.Benchmarking to ensure a company is as efficient as its industry peers....

RLSolution Word Search- match the clue to the appropriate reporting channel. Turn in by 3/30/2026 to Jenna! 2026-03-25

24 Items: ‘CATCH ALL’ REPORT LOGHARM RELATED TO A STAFF MEMBERRELATED TO THE PHYSICAL BUILDINGUSED FOR AN ‘ALMOST HAPPENED’ EVENTLIFE EVENT RELATED TO MOTHER & BABYHARM OR ISSUE RELATED TO INTERVENOUSHARMFUL EVENT RELATED TO A MEDICATIONAREA TO REPORT ISSUES IN DELAY OF CAREUSED FOR ANY POTIENTAL NHSN REPORTABLESREPORT FOR ANYTHING RELATED TECHNOLOGY WISE...

Social Work Ethics Word Search 2025-07-02

1 Item: SERVICE SOCIALJUSTICE DIGNITY WORTH RELATIONSHIPS INTEGRITY COMPETENCE CONDUCT ADVOCATE RESPECT VALUE VULNERABILITY WELLBEING PRACTICE TECHNOLOGY CODEOFETHICS SELFDETERMINATION INFORMEDCONSENT CULTURE CONFIDENTIALITY DISCHARGE RESILIENCE

Rise of Civilizations 2025-10-14

1 Item: technology hierarchy specialization rivers silt government trade complexity tools mesopotamia systems society culture agriculture surplus population domesticate monarchy economy neolithic paleolithic bronze age

VOCABULARY UNIT 1 - INTERESTS 2025-02-21

21 Items: SportsGeneral Interests- Physical activities involving skill and competition.- A winter sport involving sliding on snow using skis.- A sport where players roll a ball to knock down pins.- Popular styles of clothing, accessories, or appearance.- Activities or subjects that someone enjoys or finds engaging....

Imperialism Word Search 2026-01-21

20 Items: What local people were forced to work for at low ratesMaterials taken from colonies alongside rubber and oilA major region where 19th-century imperialism took placeThe type of mission used to justify spreading European cultureOne of the primary ways imperialism harmed colonized societies...

Workplace Incivility 2024-11-30

10 Items: an authoritative rule dealing with details or procedure.relating to relationships or communication between people.the person who leads or commands a group, organization, or countrythe action of working with someone to produce or create something.a state of emotional, physical, and mental exhaustion caused by excessive and prolonged stress....

Expand Your Horizons 2026 - Word Search 2026-03-12

15 Items: You are a future LEADER.'CTE' stands for "Career _______ Education."_____________ is considered the "birthplace of [answer to Q1]."60 units will make you eligible to receive an ____________ degree.If you're doing a research project, you may present it at _________.One of the common workshops at the Skyline College "Fab Lab" is _______________....

Cyberbullying Word Search 2024-05-20

12 Items: Pretending to be someone else to deceive, manipulate, or harm them online.Publicly humiliating someone online for their actions, appearance, or beliefs.Repeatedly sending hurtful messages or threats to intimidate or distress someone online.Intentionally leaving someone out of online activities or groups to isolate and hurt them....

INDUSTRY 2024-10-26

1 Item: production, supply chain, logistics, engineering, automation, workforce, machinery, quality control, innovation, research, development, construction, technology, safety, standards, sustainability, operations, trade, efficiency, distribution, market, compl

Spatial PhenoSearch! 2023-08-10

10 Items: Proteins that are activated in the same cell.Natural emission of light by biological structures such as tissues.Overlapping excitation and emission wavelengths of two or more fluorescent dyes.Emission filters that capture the peaks and part of fluorophore emission wavelengths....

Breakthrough Inventions and Innovations 2025-04-14

10 Items: MICROSCOPE : An instrument used to view objects too small for the naked eye.3DPRINTER : A machine that creates three-dimensional objects by adding material layer by layer.FUSION : The process of combining two atoms to form a heavier atom, releasing vast amounts of energy....

Business, Word Search 2023-09-15

1 Item: Financial, Management, Sales, People, Leadership, Interpersonal, interest, Sustainability, governance, innovation, Strategy, growth, Corporate, Venturing, Marketing, Disruption, Technology, Operations, HR, Customer, Development, Digital, Models, Cybersecu

GAME PUZZLE 2024-05-04

1 Item: excited cultural disappointing dental tradition pottery jet yatch helicopter tablet battery storage stressful weight unidentified waste invention technology journalist recognize navigate disaster mansion scared surprised tiring

TEXAS'S COMPLICITY IN GENOCIDE 2025-12-04

27 Items: Popular name for San AntonioFounder of Cornerstone ChurchThe real name of SATX's sister cityFormer mayor who visited Israel in 2017County commissioner who visited Israel in 2025Amount of tax dollars sent from Texas to IsraelFormer mayor who visited occupied Jerusalem in 2011Refunds for energy spending that HOLT Renewables got....

PROFESSIONS 2025-03-16

1 Item: Architect, Artist, Biologist, Carpenter, Chef, Civil Engineer, Data Analyst, Dentist, Doctor, Electrician, Environmental Scientist, Financial Analyst, Graphic Designer, Historian, Human Resources Manager, Information Technology Specialist, Journalist, Law

CAREER READINESS WORD SEARCH 2024-08-26

1 Item: ARCHITECTURE, MULTIMEDIA, COMPUTERS, EDUCATION, ENERGY, FINANCE, GOVERNMENT, HEALTH, HOSPITALITY, HUMAN SERVICES, TECHNOLOGY, LAW, PUBLIC SAFETY, MANUFACTURING, MARKETING, ENGINEERING, TRANSPORTATION, HOLLAND CODES, CAREER KEY, OCCUPATION, NAVIANCE, BRIDG

IRS Puzzle 2024-12-17

25 Items: M in MIR stands forThesaurus stands for ________A video consists of a sequence ofweb scale discovery services provide?A search system is called a __________ system.the process of removing stop words from a query?Information System Consists of __________ programsimilarity between two vectors by measuring Angle?...

business professionalism 2025-09-18

20 Items: is an expert in their area of work.is a desired result of a person’s effort.using words or sounds to express yourself.writing information to share with somebodyattitude you project with your speed of speechsomething you want to accomplish in the future.something you want to accomplish in the near future....

Dystopian Fiction Literary Conventions 2026-02-20

15 Items: Prolonged cruel or unjust treatment by those in powerThe act of fighting back or refusing to obey an unfair governmentThe struggle to stay alive in a dangerous or resource-poor environmentThe act of carefully watching someone, usually through cameras or spies.A confined space, like a wall or a dome, that keeps citizens from leaving...

Welcome to Family & Consumer Science 2025-04-11

1 Item: career, research, community, culinary, family, technology, nutrition, development, personality, friends, support, emotions, life skills, manage, resources, meal planning, budget, wellness, child care, culture, career, consumer, entrepreneur, housing, inte

Nursing Shortage 2024-04-07

15 Items: What primary focus guides the efforts of nurses in healthcare settings?What term describes the insufficient number of available nurses in healthcare settings?What strategy aims to keep nurses in their current positions within healthcare institutions?What paramount concern guides the actions of nurses and healthcare providers in their duties?...

Socioeconomic Disparity Word Search 2023-11-29

4 Items: What type of disparity refers to the unequal distribution of economic resources and opportunities among different individuals or groups within a society?What is the communication model discussed in the presentation that helps determine the extent of a patient’s understanding of health information and instructions?...

School 2026-02-11

250 Items: GymPenClubDeskExamQuizRuleTestWiFiBreakChairClassCoachEmailEssayGradeLunchNotesNursePaperStaffTutorVideoAgendaBinderCampusCourseDebateFolderLaptopLessonLockerMarkerMentorOfficeParentPencilRecessReportReviewRewardSafetySchoolSeniorSpeechSportsSurveyUpdateAbsenceAlgebraArtRoomBiologyCollegeDiplomaEnglishFacultyHistoryJanitorJournalLibraryMeeting...

Digital Citizenship 2024-09-12

22 Items: Software that damages a device or steals informationInformation that isn’t true, often created to trick peopleA person who uses a fake online persona to gain the trust of someone else.Software designed to gain unauthorized access to and disrupt or damage a computer system...

Academic Word Search 2026-03-08

250 Items: ARTBUSFUNLABTAGBANDBELLBOOKCLUBDATADESKDOOREXAMGLUEHALLIDEALOCKNOTEPLAYQUIZRICETEAMATLASCARDSCHAIRCHESSCLASSDRAMAESSAYFOCUSGAMESGOALSGROUPMEDALMUSICRULESSLIDESTAGESTUDYTRACKTUTORBINDERBURGERCODINGDEBATEEFFORTERASERFRUITSHEALTHLAPTOPLOCKERMARKERNAPKINOFFICEPENCILRECESSREVIEWSAFETYSOCCERSPORTSSTAIRSTABLETTROPHYVIOLINWARMUPADVISORALGEBRAARTROOMBIOLOGY...

Exploring the Consequences of Nursing Burnout on Nurse Well-Being and Patient Care 2023-12-02

8 Items: What can raise awareness about the signs of burnout, encouraging early intervention and support?Which kind of empowerment for nurses increases the ability of nurses to confidently mitigate the consequences of burnout?_________ effort is required to encourage a more positive workplace environment and decrease the impacts of nursing burnout....

Space Word Search 2025-11-01

250 Items: tosuesuntaptaxteatenthetietiptoetootopspinspotstarstaystepstirstopsuchsuitsureswimtailtaketaletalktalltanktapetaskteamtearteentelltendtenttermtesttextthanthatthemthentheythinthisthustimetinytiretonetoolspacespeakspeedspendsplitsportstaffstagestairstakestandstarestartstatestealsteelstickstillstockstonestorestormstorystripstudystuffstylesugarsuper...

Gis Word Search 2025-12-19

1 Item: geospatial mapping cartography spatial coordinates GPS remotesensing data analysis visualization python programming software technology database SQL automation webgis arcgis qgis layers metadata surveying satellite raster vector cloud computing api intern

My Motion and Machine word search. 2025-10-18

16 Items: to put togetherto go up and outa machine that helps lift thingsplane- a machine that moves objectsa simple machine that goes up and outis a movement from one position to another.( The scientist) First Law of Motion states:- is any applied force that moves an object.- are any type of device/technology that makes work...

Review the words 2025 2026-03-16

250 Items: sameramenleavefirstmeterweighIndiaorderthickearlylivesnoodlegoldenflightarrivearoundyou’lldollarmosqueflavorspeechbutterforgetcreatecareerchooseprettytaughtadjustsecondcrispyeasilyreasonshadowcandlelittleweightspringresulteffortwisdomadvicememberfollowshowercouplefinishshoulddesignbottlepublicusefulremovecenterspreadfathertriviasurveyanswerunique...

EV3 Robotics Vocabulary 2023-05-09

16 Items: to take apart.provide linear mobility for a robot.detects rotational motion on a single axis.any command or group of commands in a program.to build by putting parts together; to build; to create.specific areas for connecting sensors and motors to the EV3.the primary source of physical motion in the Mindstorms EV3system....

word search 2025-09-14

13 Items: a statement or legal documentfalse or inaccurate informationnegative reviews, poor reviews, unfavorable reviews, or bad feedbackdetails that allow someone to get in touch with you or an organizationthe use of technology to harass, threaten, embarrass, or target another person...

US History Eras 2024-12-02

10 Items: 1890s to the 1920s - period of political and social reform1929-1939 - period of economic crisis and government response with New Deal programs1945-1991 - the power struggle between the Soviet Union and the United States after World War II...

Pizza Again Word Search 2025-03-30

21 Items: Where was pizza first invented?What is a white pizza typically made without?What is America's least favorite pizza topping?What unusual pizza topping is popular in Japan?What unusual pizza topping is popular in Sweden?Which country consumes the most pizza per capita?On what continent was the tomato first discovered?...

Week 1 Key Terms Word Search 2023-08-07

15 Items: Electrical cycles per secondGlobal de facto wireless networking standardThe measurement between triads on the displayLong-term storage device that plugs into the motherboardCompact and cheap storage device that can store a lot and are easy to useRoutine that is burned into a flash memory chip located on the motherboard...

Networks 2026-03-25

31 Items: The largest WAN accessible to the public.This is a network that covers a larger geographical area.refers to all of the devices that are connected to the internet.is a set of agreed rules that state how to format, send and receive data.A company that provides Internet access to homes, schools, and businesses....

Biomedical Engineering Word Search 2026-03-23

14 Items: To make better or as good as you canA minimum requirement for how the design must functionA desirable outcome given up to gain another desirable outcomeIn engineering design, some-thing that limits the solution to a problemA series of steps that engineers follow to come up with a solution to a problem...

Impact Foundation - U3 - Vocabulary 2026-01-22

23 Items: To make something better.To create a picture in your mind.You feel it when something hurts you.It may happen when someone is really sad.Connected to or done through the internet.Able to be changed to another place or position.To change your position from one place to another.To keep something in your hands so it doesn’t fall....

Chapter 6 Word Search 2024-03-14

10 Items: Designing and producing e-books or printed books using book development software.A group of slides created in a digital presentation software (ex.PowerPoint, Google Slides).using software to produce documents with elaborate control of the form and appearance of individual pages....

RPMS 2024-06-07

25 Items: I DON’T CAREI DON’T LIKEI DON’T BELIEVEADDRESS THE ISSUEI DON’T UNDERSTANDDETERMINE THE TYPE OF ISSUEEMPATHIZE WITH THE PROSPECTDISCOVER THE SOURCE OF THE ISSUEthe prospect’s commitment to join the Navythe prospect’s future plans and life pressureswill have oversight of the National Inspection Team (NIT)....

Antropology 2025-12-04

18 Items: – to come together (usually in community)– the study of past peoples and past civilizations.– the study of a person’s individual or familial past– changes that occur as a result of changes in the environment.– beliefs or rituals passed down from one generation to the next– a large population of people organized into a collective society...

Combating the Opioid Crisis 2026-04-05

33 Items: A medication that blocks opioid effectsInvolving multiple healthcare professionsMoral principles guiding nursing practiceRemote healthcare services using technologyA medication used to reverse opioid overdosesMedications used to treat opioid use disorderSymptoms experienced when stopping opioid useA partial opioid agonist used in OUD treatment...

October Security Summit Wordsearch (Harder) 2023-08-18

20 Items: What term means having permission or approval to access something?What is the unique address used to identify a location on the internet?What term refers to the ability to enter or use a system, service, or area?What term describes a widely accepted or established norm or specification?...

The Executive Branch 2025-12-01

21 Items: second-in-command to the presidentthe person in charge of the Executive Branchthis is the number of years for one presidential terma rule or command the president gives out that has the force of lawofficials who represent the United States government in other nationsthe power of the president to cancel a proposed law written by Congress...

words 2024-10-03

2 Items: audience a psychological state in which a person believes that others are actively watching or listening to the unique string of characters that identifies each computer using the Internet Protocol to communicate over a netwo information an act of logging...

Ethics 2025-11-05

18 Items: An imaginary line that separates me from you.How we define our relationships with clients.Doing what is right even when no one is looking.Our own moral principles that govern our behavior.The last step to setting boundaries is to trust your _________.ATC Company PREA policy has a _____ tolerance for PREA violations....

Computer Vocabulary 2025-08-26

20 Items: The physical parts of a computer.It receives and sends data on computer networks.A computer that provides data to other computers.A type of memory card typically used in digital cameras.Programs that tell a computer what to do and how to do it.It stores data and instructions while the computer is working....

Marketing - Branding Test - Use vocabulary words to complete word search. 2024-03-04

20 Items: gives the brand name, trademark, or logo.products that does not carry a company identity.the physical container or wrapping for a product.using packages to promote social and polital causes.two or more different products or services in one package.A specific type of brand mark, one with human form or characteristics....

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

INTERNET 2025-09-03

10 Items: Digital platforms that allow the creation, exchange, and collaboration of content among users, making the dialogue interactive.Refers to being connected to the Internet or a digital network, allowing access and real-time interaction with information, services, or people....

Weather Word Search 2024-05-05

37 Items: Mass/VolumeAlso known as heat energy.The degree of heat in an objectThe lowest layer of the atmosphere.An instrument used to measure heat.Envelope of gases surrounding the planet.The outermost layer of Earth's atmosphere.A breeze blowing from the sea to the land.A coordinate the specifies north or south.The transfer of heat due to physical contact....

Military and Civil Leaders 2025-03-24

25 Items: Commander of American forces in Europe during WWIsocial reformer who campaigned for women's rightsreceived the Congressional Medal of Honor for bravery during WWIIsoldier whose action in the Argonne Forest made him an American heroAmerican general, who commanded allied troops in the Pacific during World War II...

US MILITARY 2024-12-29

44 Items: Focused on air and space operations.The newest branch, established in 2019, focusing on space operations.The largest and oldest branch, responsible for land-based military operations.A term used to describe military personnel who die during combat operations. (abbr)...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Chapter 17 Part 2 2023-08-30

33 Items: Recording of financial transactionsAn individual's or business's net worthSelling goods for use rather than for resaleSelling goods for use rather than for resaleA single statment of a business's purpose (2 words)An image or phrase that identifies your goods or servicesServices offered to consumers for little or no cost (3 words)...

Challenger - Comet Vocabulary ALL - Word Search 2023-05-16

30 Items: The compactness of an object.To move in a circle or orbit around.The seven colors that make up white light.The title of elected US government officials.A group of stars that form a picture or a shape.The action of rotating around an axis or center.A comet that orbits the Sun in less than 200 years....

History of Law Enforcement 2025-10-01

22 Items: The Greek word that “police” is derived from.Ten “tithings” were grouped together to form a hundredIn 1326, the shire reeve was replaced with this officeA form of community policing instituted by King William in 1066.Entrusted to serve and protect the public, and to control and prevent crime...

China and India Vocabulary Word Search 2024-10-11

26 Items: upper or ruling classTo make certain that something happens or is the case.To keep in existence or continue a practice, system, or structure over time.The exclusive control of a commodity or service in a particular market, preventing competition.Related to war or the military, often used to describe skills, training, or laws governing armed forces....

China and India Vocabulary Word Search 2024-10-11

26 Items: upper or ruling classTo make certain that something happens or is the case.To keep in existence or continue a practice, system, or structure over time.The exclusive control of a commodity or service in a particular market, preventing competition.Related to war or the military, often used to describe skills, training, or laws governing armed forces....

Safeguarding Customers and the Bank 2023-10-30

26 Items: Fraud perpetrated by someone who works inside an organization.An employee who reports fraud or other wrongdoing within a company.Authentication by two or more of the following: something the user has, is, or knows.aAn area that allows computers equipped with wireless fidelity to receive internet connection....

WH40K 2024-06-04

100 Items: - The Chaos God of war, blood, and skulls.- The Chaos God of change, fate, and sorcery.- The Chaos God of excess, pleasure, and pain.- The Chaos God of decay, disease, and despair.- The heavily armored suits worn by Space Marines.- The immortal ruler and psychic beacon of humanity.- A versatile combat exoskeleton used by T'au warriors....

Business Essentials Unit 3 Review 2025-03-24

58 Items: Facts and figuresTop-level employeesStability; regularitySales or gross incomePolite behavior; good mannersPay or wages for work completedData presented in a useful formThe money that a business spendsLoyalty to a particular businessFocused on customer needs and wantsProducing goods in foreign countriesRules applying to acceptable behavior...

IB CS Network Fundamentals 2026-02-23

89 Items: Inverse of OR gate outputInverse of AND gate outputCPU with one processing unitControl system without feedbackOutputs the inverse of the inputOS handling of network communicationProduces physical movement or outputCPU retrieves instruction from memoryOutputs true when inputs are the sameCPU interprets the fetched instruction...

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

Specialized Networks 2023-04-12

37 Items: The internet of things.All SAN storage devices are called targets.A protocol used by wireless mesh networks for communication with smart devices.An IoT standards-based protocol similar to Zigbee but simpler and less expensive.This converts voice and fax calls between the PSTN and your IP network in real time....

Terminology C 2025-03-14

31 Items: Criminal activities that involve the use of computer technology and the Internet.access memory and executes them, and the arithmetic logic unit performs the mathematics and logical functions.A function in Microsoft Excel and other spreadsheet applications that combine or join two or more strings into one string....

Ch2 - IT Fundamentals Terminology 2023-09-05

52 Items: A group of eight bits joined together.Kilobits of audio data processed each second.A numbering system that uses two digits, 0 and 1.A numbering system that uses ten digits, 0 through 9.A way of reducing the size of files, making them easier to store.The smallest unit of digital information, represented by a 1 or 0....