stem Word Searches

UBB Inner Healing Incentive Dorm Graduates 2025-10-10

54 Items: LeeIrmaReedStemBerryChapaDavisGilesJassoJonesKellyLopezMayerMooreNoriaRoddySloanArjonaBladesCablesDavilaEugeneFregiaHolmanKimaniSherryWalkerWalterBrisenoDeLaPazEnglishKuimetsMagadanMalloneMendozaRamirezChelseaRobertsSanchezCardenasCarrascoChambersGonzalesRaymundaMitchellGretchenSamanthaWilliamsMaldonadoRodriguezSchroederSmithwickCarrizales...

Environment and Ecosystems 2021-12-16

55 Items: drytenwebwetbearbeesstemchaincyclefungigrassrootsseedssleeptreesbushesdesertenergyjaguarleavesmonkeypetalsplantssealedanimalsbiodomeflowersinsectsorchidspercentprimarypyramidrespirespiderssurvivevolcanoanacondabacteriaconsumerproduceraltiplanocarnivoreherbivorereproducesecondaryearthwormsrainforestcloudforestdecomposershummingbirdpollinators...

Living Word Search 2025-12-04

56 Items: EggGasStemPreyPupaBirdRootsLarvaSolidShapeLivingGrowthSensesEnergyLeavesGrowthMammalInsectLiquidVolumeHabitatReptileMeltingBoilingBurningRustingCookingMixtureSolubleSievingMovementOrganismPredatorFreezingreactionSolutionDissolveBreathingNutritionOffspringAmphibianParticlesInsolubleFilteringReversibleSeparatingPropertiesEnvironmentEvaporation...

spices 2025-11-26

53 Items: budhotnutpodteabeandillherbmacemintsagesaltsourstemanisearomabasilberryclovecumincurryhoneyleafymyrrhonionrootsscentsmellspicetastythymecassiachivesgardengarlicgingerpeppersavorycarawaychervilmustardoreganopaprikarecipessaffronvanillavarietycardamomcinnamonculinarymarjoramtarragoncondiment

Whirl Word Search 2024-01-31

59 Items: firmfernstemhurtwordyardsoreoarspouryourpairwearbeardearreargearherepeerwhirlthirdgirlsherdsservenurseturnslearnpearlworldsharpcarveporchstormsportstorychoreshorehoardwherethereartiststaredstairscareerprecutcarefulmisreadpreviewprepaidpreplanpreheatdisablemisprintmistrustmisspellmistreatdistrustdiscountdiscoverdishonest

The Respiratory System 2025-04-01

48 Items: boxstemarearibsratenosehertzpitchcordsrelaxlungsciliacoughshoutpintsmouthlarynxoxygenairwaysneezeinhaleexhalehiccupsdioxidealveolibronchiwhispermusclesmillionabdomenrestingtracheadecibelscontractcapacityballoonspressureexchangewindpipediaphragmbreathingautomaticfingernailexercisingrespiratorybronchiolescapillariesbloodstream

Plants word search 2024-06-25

9 Items: it bears no fruitit can bear fruitIt used to be a flowerholds the plant uprightabsorbs water from the groundit is the biggest portion in the leafit is a part of the leaf and first word is mainit is the closest to the stem first word is leafhelp the plant to make food and also exchange of gases.

4-H Cook County 2020-10-22

59 Items: 4HartfunheadclubfairSTEMpetsteenwoodcamphearthandsgreenworldstatefoodspaperchalkmetalhealthclovercountypublicsewingjuntosribbonnaturegrowthskillseventscareerplantsmentorcarbonloyaltyservicecountrykickoffcookingprojectmasteryhelpingcourageinspireanimalsthinkingroboticslearningcommunitycloverbudbelongingadventurechallengeleadershipgenerosity...

Ms Hoyles' AMAZING Class 2024-10-10

56 Items: askroyhelpwillgrowworkbiasmathraceSTEMvaliadnanjacobjulielianepowerfocusjameslailalearngroupsparkerraneemamelieaustinhoylesasenatharoldidrisspoetrydesireemeetinglibraryreadingsciencestudentdeservedizereejacksonjenecismistakesfreetimeorganizedodgeballcommunityeducationintrovertquestionsextrovertrepresentfieldtripsindependentstereotypesperseverance...

British politics 2025-09-11

20 Items: de wetde stemliberaalkandidaathet debatde partijhet beleidde premierde campagnehet kabinetde grondwetde regeringde ministerconservatiefde oppositiede parlementde democratiede verkiezinghet Lagerhuishet Hogerhuis

Itch Word Search 2025-09-29

6 Items: Book of mapsFlower holderRed Cross supplyMerit badge earnerWhere land meets seaCast wearer's frustration

7 TH SCIENCE 2025-11-20

27 Items: CONETREELIGHTWATERSPORESUGARROOTSGARDENLILIESSIMPLEOXYGENCOMPLEXMINERALSFLEXIBLESTRUCTUREFLOWERINGCONDUCTINGSTRAWNERRYTO SOAK UPEVAPORATIONREPRODUCTIONCHARACTERISTICSONE WHO PLANTS SEEDSTHE MAIN STEM OF A PLANTTHE PORES WHERE A PLANT BREATHESTHE PROCESS A PLANT USES TO MAKE FOODPLACE WHERE PHOTOSYNTHESIS TAKES PLACE

P4 SC: Plant System 2025-12-15

10 Items: the roots absorb thisIdentify a part of a plantthe roots also absorbs thisLeaves help plants to make thisLeaves take in and give out thisIdentify a second part of a plantidentify another a third part of a plantRoots hold/______ a plant firmly to the groundStem supports a plant or holds it upright to get this...

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

SWEtacular Word Search_2 2025-09-12

5 Items: Creates and manages fundraisers and club merchHosts an annual STEM conference for high school girls.organizes social and collaborative events for SWE members.Engages the broader community students with STEM events and SWE volunteers.Coordinates the Big/Little program, SWE Connect, and bringing members together.

Plant Systems 2025-08-06

12 Items: _____ produces pollen.______ receives pollen.In a flower, this becomes the fruit.In a flower, this becomes the seeds.Protects the flower at the bud stage.Two types of roots: Tap root and ______ root.Before it becomes a fruit, it was once a ______.Parts of a fruit: Stalk, sepal, seeds and _____.The roots take in water and ______ from the soil....

Science Unit 1 Word Search 2023-10-10

60 Items: gasiceacidbaseheatsizestematomsshapesolidsteamenergyexpandliquidlitmuslustermatterphasessolutevolumeblendedboilingchangeselementmeltingmixturesciencesolventtexturechemicaldecreasedissolveengineerfreezingincreasemagneticmaterialmetallicmoleculeparticlephysicalpropertypropertyseparatesolutionexplosioninferencesubstancehomogenousreversiblescientific...

Examination Review 2024-07-05

59 Items: fixfarmbankcartstemrootfeedmilkheatkillgrowhurtbendmovetakeneckturnleftleafridehourshotelsugarabovespinewaterelbowbreakrightgrassflavorfutureleavestakeincactussearchgatherdesertdamagestorescorneracrossminutesairportuprightfactorymachinestretchmountainfallovershoulderstraightsquirrelmagicshowcommercialsupermarketcottoncandycrosstheroad...

Plants 2025-07-28

59 Items: AirBigPeaSoilGrowFoodSizeStemHardStemHardBarkNeemPineRoseWeakMintRiceWallPlantGreenWaterSmallTreesHerbsBrownWoodyTrunklayerMangoGrassStickplantthingsOxygenFriendAroundShrubsStrongBanyanCottonFruitsSpicesBananaplantsCoconutSpinachSupportUprightSunlightClimbersCreepersBranchesGulmoharHibiscusCorianderGrapevineVegetablesBougainvillea

Word Search #10 2024-03-04

60 Items: aidowndeafstemdebtrideseizetruthshadefrankhumancornyagilemixedpuppetarrestcrisisescorttroopsvalleywonderforestarrivepreferlatterpsychecontrolinstalltreasonwesternneutraltormentgeneralstrangesinceretwisteduncannyfragilestomachpretenseconvincepubliclyformallyidentitypetitionchivalrycheerfulterribleinteractdelicatetutelageacademicaftermathtransport...

Examination Review 2024-07-05

59 Items: fixfarmbankcartstemrootfeedmilkheatkillgrowhurtbendmovetakeneckturnleftleafridehourshotelsugarabovespinewaterelbowbreakrightgrassflavorfutureleavestakeincactussearchgatherdesertdamagestorescorneracrossminutesairportuprightfactorymachinestretchmountainfallovershoulderstraightsquirrelmagicshowcommercialsupermarketcottoncandycrosstheroad...

SWEtacular Word Search_3 2025-09-12

6 Items: Hosts an annual STEM conference for 100+ high school girls.Designs flyers, manages social media, and promotes SWE eventsEngages the broader community with STEM events and SWE volunteers.organizes events like shadowing, resume reviews, and mock interviewsRuns a 10-week coding program for middle school girls taught by SWE....

Recombinant-Dna-Technology Word Search 2024-12-16

30 Items: ProjectTherapyBt-CropsBio-FuelsTechnologyELISA-TestGolden-RiceGene-CloningGene-TherapyBio-ReactorsCry-ProteinsBio-PesticidesBio-RemediationCloning-VectorsBio-FertilizersEthical-ConcernsTransgenic-PlantsDNA-FingerprintingTransgenic-AnimalsRestriction-EnzymesTherapeutic-ProteinsBioinformatics-ToolsHybridoma-TechnologyMonoclonal-Antibodies...

nerds word search 2025-10-10

62 Items: DCLabGeekDorkDataSTEMHackNASASmartGamerCoderComicMangaAnimeChessBrainyHackerSci-fiMarvelPuzzleCodingDebateTriviaTheoryBookishFanaticFantasyPhysicsBiologyQuantumCircuitEsportsStudiousAcademicEngineerTheoristStarWarsStarTrekRoboticsCalculusResearchEmulatorScientistCollectorCosplayerSuperheroChemistryBoardgameAnalyticalProgrammerResearcherStrategist...

Everybody Up 5 Review 2023-05-25

65 Items: shyasiaseedrootstemcalmeasyplaincheapkenyaindiaenergyafricaeuropesleepyfamousreturnoxygenseasonforestdeserttundraslowlyloudlyrelaxednervouscollectchuseokquicklyquietlyidentifyballoonscupcakescarnivalcolorfulfriendlyaustraliawideawakeconfidentdifficultdelicioustraditiondangerousenergeticdifficultexpensivegrasslandcarefullysolarpanelantarctica...

For jasmine <3 2025-03-03

7 Items: My majorMy eye colorMy moon signMy favorite colorI wear ____ jewelryMy favorite place to eat on campusSomething that's always on my mind

Stem Changing Verbs (o-ue and e-i) 2017-07-26

9 Items: poderpedirdormirvolvercostarservirrepetiralmorzarcompetir

Active Word Search 2025-04-04

70 Items: BileStemAortaAtriaSpermStentWhiteXylemActiveBenignLipasePhloemPlasmaTissueAerobicAllelesAlveoliArchaeaCloningEnzymesInsulinMeiosisNucleusOsmosisPlaceboQuadratSpeciesStatinsStomataVaccineBacteriaCatalystCellWallCoronaryDenatureDominantEfficacyGenotypeGlycogenNitratesPalisadeReflexesRibosomeOestrogenPathogensPlateletsPulmonaryProducersRecessive...

Classification & Kingdoms of Life 2018-10-26

71 Items: seedstembirdfishtaxonclassordergenusfungialgaefungiconesdomainphylumfamilyarchaelichenleaveskingdomspeciesplantaeeukaryabuddingflowersneedlesconifertropisminsectsreptilemammalsLinnaeustaxonomyanimaliaprotistabacteriamollusksAristotlehierarchyautotropheukaryoteprotozoanarachnidsamphibiancommonnameprokaryotemicroscopetechnologyeubacteriadecomposer...

o to ue/u to ue stem-changing verbs 2023-01-09

11 Items: to dieto flyto playto findto showto sleepto dreamto have lunchto be able, canto return (an item)to return (from a place)

Goddard Science 2025-09-10

74 Items: heatleafrootseedstemwavecrestorganscalesporerocksdesertenergyfossilopaquetroughvolumeproblemresultserosionextinctvibrateigneouscriteriadrawbackfairtestoptimizeresourceamplitudecollisioncontinentelevationpollutionprototypereceptorswatercyclefiltrationexperimenthypothesisconclusiondepositionrainforestreflectionwavelengthweatheringevaporation...

MOTS MÉLÉS JEEEP PROD 2025-08-11

74 Items: CUTRGBPNGYUVXMLRAWJPGMOVRAMBMPWINMATXMSBUSMAXNUEJEUSETZOOJOGSPISAGAPRODMENUFLOUTESTSTEMJEEPCINEJEEEPMACRONOEUDMEDIAINTROAUDIOVIDEOOCTETCANONNIKONLASERSTUDIOFUSIONEXPORTAPERCUMANUELEFFETSOPENFXTITRESFFMPEGDAVINCIPROSHOWTITRAGETEXTURERESOLVEMONTAGEMUSIQUEMAXIMUMMINIMUMCOULEURTUTORIELTIMELINETIMECODEENCODAGEFAIRLIGHTSLIDESHOWIMPRESSIONTRANSITION...

your next clue... 2022-11-15

12 Items: I loveradiatewomen inyou are mylife is aboutmatch made inwe both love towe are a couple ofbest way to end the daybest way to start the daywe are _ first and foremostfirst word dance, second word...

SE word search 2025-11-25

75 Items: sscbstemdeerratssodahawksarbordeltatexassocalblueycranecaneschipschilihuntereventswaiverlayoutbudgetloungeblockyturtlesubwaycoffeeuhclpdnarutohoustonwebsterbayareaserviceopossumpopeyesthequadpopcornaltitudepearlandhawklinkaligatorburritoscommunitycampusrecclearlakearmadillomcdonaldspatiocafestarbucksfrontdeskhomecomingchartwellsuniversityactivities...

Orchid, Word Search 2025-11-20

10 Items: Burnt coal or ashA cup with a stemA grassy open fieldA swift hunting birdA place where ships dockA common crystal mineralA smooth metamorphic rockA delicate flowering plantA tree with drooping branchesA system of millions of stars

Ethan Morgan's Week 5 Stem Words 2022-09-08

5 Items: verdictdismissproducediameterdynamite

Afterschool 2025-05-05

81 Items: MiaArtGymClubGlueMathSTEMYardDanteKarolKevinLucasLukasYuvanMsKimComicDanceSnackStaffWaterHaileyStevenMrAlexMrArliMsGabyMrLupeMrNoelMrWaliCheeseCodingSoccerSportsAbigailAuritriImanuelJayleenJocelynNatashaMrAaronMrHarryMrJesusMsPerlaMrPeterMsSoniaCleanupCookingDrawingMarkersWritingIsabellaMichelleMsBrendaMsJackieMrTyrellMrTyleekMrZurielBackpack...

TSFA 2 2025-12-09

21 Items: the level of light received on a plant surfacethe storage or shipment of flowers out of watersells florals good and services to the consumerthe impression of the design being stable and self supportedin Flowers is due to the inability of water to enter the stemgrowers wholesalers and retail florist must process their flowers...

SPRING Word Search 2024-03-18

80 Items: beebugdigeggfogmaybabybirdbulbcoltgrowiriskitelambleafnestseedsoilstemthawwarmweedwindwormbunnychickcloudgrassgreenhatchlilacmarchplantrainyrootsstormtulipwaterawakencocooneasterflowergardeninsectpicnicpigletpuddleseasonshovelshowerspringsproutvioletblossomgoslingrainbowthunderweatherarbordaybarefootbaseballblissfulbloomingdaffodilducklingearthday...

Review word search 2025-04-02

84 Items: sewasktietugpotagogasbuytubtoldtelltimefirelifemadewashmakegametownmustwisestemseedsizehelpgrowrootvinesoilfinewoolwellcookreadlongpolesinkchorespendsewedstiltspentlearnbeginspendbeganshootgrownstuckprizethankmovedbricklargesleptstillcropsspacestovesincewashedmodernshouldsproutpickedinsidebuttonslearnedblossomdiagramchangednarratorfamiliesimportant...

Garden 2024-05-03

85 Items: dighoesowbeesclayforkhoselawnpotsrakesoilstembladedaisyfencegrafthedgeherbsmulchpestsseedsshadespadevinesweedswormsaphidsgardenglovesleavesplantspollenshearsshoveltrowelannualscabbagecompostfoilageharvestinsectspepperspruningtrellisweedingcucumberdrainagegardenerlettucesmoistureplanterssunlighttomatoeswateringcultivarsflowerbedfrostdatenutrients...

Spring School Holidays - Jumbo Word Search 2024-09-19

92 Items: SunBugBeeBudPotSowSunIvyBudHoeAntMudSeedTreeLeafFernDirtTwigRoseRainShedVineRootLawnWormWeedBushNestSoilRockWindStemCornMossTurfPondRakeTendLilySnailGrassHedgeHerbsFrogsBasilSpadeDaisyTansyFlowerGardenPetalsSproutShovelTulipsCloverWeederTrowelPollenShrubsCactusThornsLiliesCarrotOrchidTomatoOnionsZinniaSunhatFennelCompostBlossomCreeperLettuceHarvest...

Why do we need plants? 2025-01-25

10 Items: A tall yellow flower.To get bigger and taller.The sky is bright with this.The ground where plants grow.The yellow parts of the flower.The sunflower’s feet in the soil.The long green part of the plant.What you give to plants to drink.The flat green part of the plant.A small thing that grows into a sunflower.

Why do we need plants? 2025-01-25

10 Items: A tall yellow flower.To get bigger and taller.The sky is bright with this.The ground where plants grow.The yellow parts of the flower.The sunflower’s feet in the soil.The long green part of the plant.What you give to plants to drink.The flat green part of the plant.A small thing that grows into a sunflower.

woordzoeker 2025-08-03

100 Items: PenZonVisJasOorDakApelZantGautKlokBoomMuurHontBergLigtGrasTaalHoetVlamTrapBoekMaanWintRootZeepBeilKnopMarkWoutGeurNeusBrugDorpTeitStemSmitDansTantWerkDoosSlofPeilMelkHoutTouwTulpZalmInktKlijRitsStoelHamerSkoolKaarsSneewDroomHuijsVorekKlompTafulSlaapSteenVogulAardePaartWaterFietsBroekIjzerPapirAvontRaketBaartSlangKamerLaptopRivierVrientReegenKoffie...

All About School 2025-09-25

100 Items: ArtBusGymLabBandBookDeskGlueIdeaMathPoemQuizSTEMTapeTestAngleBoardBrainChairChartClassEarthEaselEssayLunchModelMusicNurseNotesPaintRulerStudyAnswerBinderCircleCrayonDesignEnergyFolderFrenchLaptopLessonMarkerOfficePencilRecessAlgebraBiologyCookiesEnglishHallwayHistoryJournalLibraryLockersPolygonProblemPrinterScienceSpanishStaplerTeacherBackpack...

At the park 2024-10-09

3 Items: a tall, woody plant with stema long seat for several peoplea structure with a smooth with smmoth surface for children slide down

Stem List 3 - Find the example words hidden in this puzzle. Look at the clues and definitions at the bottom of the paper for clues on which words are hidden. Use your stem notes! 2024-11-04

22 Items: the act of forgivingcapable of being submergedaffected with or inclined to claustrophobiaattended by or causing suffering or disasterShe suffers from some ____ without her glasses.one of the same or nearly the same age as anotheran undertaking usually involving danger and unknown risksthe adhesive friction of a body on a surface on which it moves...

Saguaros in the Desert 2025-04-07

11 Items: made of rockto stay alivea type of cactuscompletely or entirelythe main stem of a treenot hot or harsh, or strong in tasteto stretch out or extend toward somethingan area of land that does not get much rainan animal that hunts and eats other animalshard, pointed parts on some plants, animalsdarkness created by shelter from the Sun's light

Intro to Botany 2025-02-04

29 Items: scientist that study plantsa plant having one cotyledona plant having two cotyledonplants do this to conserve waterouter layer of tissue in a plantspace on a stem between two nodesgrowth that increases plants widththin stalk that attaches the blade to the stemsecond set of leaves that appear after germination...

Parts of the Plant 2025-08-15

12 Items: – A long, curved fruit with yellow skin and soft, sweet flesh.– The small part inside the fruit that can grow into a new plant.– The part of the plant that contains seeds and often tastes sweet.– The flat green part that makes food for the plant through photosynthesis.– A tropical fruit with yellow or orange sweet flesh and a large seed inside....

Centristic Word Search 2024-12-19

61 Items: it360PCSTLSShipWigsDoorStemCafeLoftSkivePondsGlattPrintFrozeDealziRideMobatWorldVerdeGlassDatafiTravelCameraLumentPeopleCellarEstreiaOutdoorVisiMaxKoperksCentralLampostCharityNutteryFilingsCapitalGlatbiteHyremotePlumbingWestwoodPartnersSecurityMade EasyAdvantageInsuranceSafegressSnakeKingMiFitnessEverkleenCentristicYour TableState LimoYardscapes...

SWEtacular Word Search 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

SWEtacular Word Search_1 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

Heritage Huskies 2023-01-06

119 Items: wulawliuwanxievexptaartlintanbowncarrcopadotyhillhydepacetianstemfiizkentdeepabairbbairblandcrookcrossgrosshenryhyattjonesmooremyerssmithspirewalshmarshblacklewisspireaikensarcherbarlowbarnescarperchurchcowleycurtishughesporterromerocsweattannertaylortollerzavalareevesashmeadelswoodfaucettfreitaggladdenhhansenrhanseniniguezpearsonkeyoungkryoung...

add 2025-08-25

115 Items: wordwithgiyuinchmoresavegridlorefnafbookthisworkarchtentlistearnharecopyvasepintmagetubelinethencluemakefindsignhelplaceviewexamplanstempacelabsslabenterlistssunnydemonvisitlearnsharepixelkochocedarcrestworkssheetimagehearsharesrightmagesstyleenterspacesolartitleloginplacelargequestpacescapessearchcreateslayerimagesremovecustomtiktokeatinggoogle...

Find the Words 2025-11-13

55 Items: CatUangBabiDaunBubukAntriPergiDudukNapasDarahKulitMinyakRinganMenariBatangKorbanMakananMembeliBelajarBerdiriMenutupMemintaMemasakMenjualMembuatBerlariJongkokGentengGerbangHalamanPasukanTatakanAir-liurFurniturMargarinMengajarBerlututBerenangMenggaliMembayarMemegangBerfikirBercandaMenyisirMengambilMemeriksaMengutangMata-mataMenunggangMata pisau...

Spelling List #1: ALL, AL, AW 2022-10-13

12 Items: a type of nuta word that means totalthe inside of your handsomething that is not biganother word for flower stemthe amount of rain that fallsa product that heals your skina word that means to speak or chata word that means the opposite of angrya thing used to draw on a board or pavementa room where a horse or other farm animal lives...

Ag lesson 13.1 2024-02-08

15 Items: parts that provide supportlargest part of most plantspart that does reproductiondirection xylem brings stuffdirection phloem brings stuffpart that does photosynthesistype of root that is strait downpart of plant that provides supporttype of tissue that xylem and phloemtype of flower with all of the partsflower with only 3 of the main parts...

Pirate Word Search 2025-06-21

10 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with pointy ears and whiskers...

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

Catnap Word Search 2023-02-24

2 Items: ask snug skip mask skit snip task skin riskbatman pigpen catnip last nest spit rest spot lost fast stop stem spin

trs225b bt4wk15pt1 2022-07-07

10 Items: n.A gentle wind.adv.How a crab walks.n. e.g. Taiwan, UK, USA, France, Japan.n.A part of a plant that is underground.n.The tall, thin, central part of a plant.n.A colourful part of a plant that attracts bees.n.Something inside fruit that can grow into a new plant.n.The ground. Plants take water and nutrients from this....

DNA & Cell Cycle 2025-10-23

12 Items: Unzips DNA helixDNA is in the shape of aGuanine always pairs withIn DNA, Adenine always pairs withCondensed DNA, humans have 46 of themAdds nucleotides to the new DNA strandThe process of cells growing and dividingA section of DNA, controls cell differentiationSugar found in DNA, makes up the sides of the ladder....

FK White 25-26 2025-08-05

64 Items: Dennis-ESLHurley-ESLLopez-IBCAManuel-ESLSuiter-RTIGoudeau-ESLPenado-BandStoupy-BandWarnken-ArtGobert-SPEDForeman-SPEDCheramie-STEMMiles-7th ELABoss-LibrarianFruge-PE CoachTaylor-7th ELAZaazoui-FrenchComeaux-6th ELAHebert-7th MathTenali-8th MathEdwards-PE CoachC. Hayes-6th ELAHiggins-6th MathPerkins-7th MathRoss-8th ScienceSavoie-Combo ELA...

Pirate Word Search 2025-06-22

12 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with a hat, boots, and lasso...

Petal Word Search 2025-12-10

18 Items: – When a flower opens.– A flower before it opens.– Small purple woodland flower.– The colorful part of a flower.– Tall flower that follows the sun.– White, fragrant evergreen flower.– White petals with a yellow center.– Exotic flower often found indoors.– Spring flower that grows from a bulb.– Another word for a flower in full form....

Leaf Word Search 2025-07-15

20 Items: What anchors a plant?What is an unwanted plant?What gas do plants release?What action transfers pollen?What provides energy for growth?What germinates into a new plant?What is the process of flowering?What part performs photosynthesis?What medium do most plants grow in?What develops from a flower's ovary?What kind of plant climbs or trails?...

Ultimate Word Search Challenge 2023-06-01

143 Items: fatgymhotlokmvpoofronwaxyouzbtabbybikecorachemdivefartflexfateflipguachikehurtjumplovelisalakeprompicspinkpostpoloquizshayswimsnapstemsnowucsbwaltexamyoloalphaaleksarborbrockbeachbubbabenchcoswbclimbcurryclashdrunkdaygedancefirstgreenhoneyheartinstamasonmegannolannwordoceanpollypastapestopsychrockyspikestalksleepsugarsquatsushiteslateachtrackvitos...

ORGANELE,EKONOMIČNOST,ENZIMI,MATIČNE ĆELIJE,PROVODLJIVOST 2022-09-21

20 Items: Naučnik koji je otkrio ćelijuSve hemijske reakcije u ćelijiKratki nastavci nervnih ćelijaStručni naziv za nervnu ćelijuMatične ćelije na stupnju blastocisteNaizmenično grčenje i opružanje mišićaProteini koji ubrzavaju hemijske reakcijeStručni naziv za sve specijalizovane ćelijeZajednički naziv za enzime koji razlažu masti...

Level One 2025-06-22

5 Items: The kind of knowledge we build—especially in content review.I help you sharpen your thinking about your own thinking. What am I?You don’t study alone here—this is built on teamwork. What’s the word?We meet weekly to prep, review, and support each other before exams. What kind of session is this?...

Help the Earth-Recycle! 2022-10-02

11 Items: A process of converting wastes into reusable materials.The thin, hard outer layer of an egg which is very fragile.A slender woody shoot growing from a branch or stem of a tree or shrub.A material made up of very thick, stiff paper, usually pale brown in colour, used especially for making boxes....

Floral Design Vocab Review 2024-11-04

49 Items: UnityRhythmBalanceTextureFramingCardettePiercingSkeletonArmatureStairStepPillowingAnalogousProportionProcessingMonochromeBoutonniereInterpretiveConditioningTotal area a person can see ________Light reflected off an object ________Technique with more than one focal pointJapanese style of floral design ________...

Cells 2023-06-16

21 Items: contains DNAsites of photosynthesisan undifferentiated cellsites of protein synthesissites of aerobic respirationwhen cells become specialisedmovement low to high using energythe first stage of the cell cyclethe final stage of the cell cyclewhere chemical reactions take placecontains cell sap to keep cell turgidcellular process that releases energy...

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

Photosynthesis 2025-11-17

1 Item: chlorpolast convert cynabacteria gas glucose greenhouse leaf photosynthesis stem symbiotic

Spelling & Vocabulary Wk. 10 2025-10-14

10 Items: every person.situated directly below something elsetake place; occur; find or come across by chance.almost certainly; as far as one knows or can tell.in spite of the fact that; even though; however; but.become fully aware of (something) as a fact; understand clearly.(noun)the liquid that comes from meat or other food when cooked....

Structure and Function of Plants 2023-12-05

9 Items: _______ help plants get what they need.The part of the plant that makes most of its food.Which plant part plays the biggest role in supporting the plant?Flowers contain structures that are responsible for _____________.An adaptation used by cactus to survive in a hot, dry environment is ________ ________....

Space and Technology Word Puzzle 2023-01-03

25 Items: The endless voidA new thing to createA thought or a feelingAnother word for modelSomething used to divedThe continue or to makeThe subject with numbersSomething used to times itA bright source or a movementTo get more of an understandingThe element on the periodic tableUse it to make something organizedA branch of physics and technology...

TSFA study guide 1 2025-12-02

20 Items: Color mixed with gray.Color mixed with black.Color mixed with white.Lightness or darkness of a color.Brightness or dullness of a color.Visual perception based on light reflection.Small, delicate flowers used to fill empty spaces.Round, full flowers that add weight and visual mass.Colors: Red, yellow, and blue—the foundation colors....

word search 2025-03-26

11 Items: Which species are sequential hermaphrodites?The 'jumping gene' found by Barbara Mc ClintockWhat does traditional vaccine development rely on?What remains a persistent issue for a career in STEM?Mary Anning's discoveries created public interest in...What is the name of the first women to win a Nobel Prize in Chemistry?...

Cord Blood Awareness Month - July 2023 2023-06-16

1 Item: Blood, Banking, Umbilical, Stem, Cells, Awareness, July, Safeguard, Hope, Future, Protect, Baby, Diseases, StemCord

Salads, Soups, Casseroles 2025-04-08

12 Items: a leaf of a plant used to season foodtype of emulsion that will not separatea person who values and enjoys fine foodclear broth made from strained, clarified stocka combination of foods prepared in a single dishseasoning made from a combination of spices and herbsa dried root, stem or seed of a plant used to season food...

minecraft blocks 2021-12-08

129 Items: logbedtnticegatesanddoorwoolslabloomstonewallsgrassglassbrickchestanvilsignsplanksleavesfencesgravelstairsladderbamboohopperpistoncactusbeaconbarrelsmokerbasaltcarpetbannerpodzolfurnacelanternseaweedgranitespawnerpumpkindioritebedrockhaybaledropperend-rodobsidiangold-oreiron-oreamethystconcreteobservercaludroniron-barcoal-orejuke-boxbee-hive...

Help, Find me 2022-11-24

5 Items: Many soldiers lost their lives in the conflict, or war, between the North and the South.Tracy held the flower as gently as she could, fearing that the delicate stem would breakThe bottle’s capacity, the amount of liquid it can hold, can be measured in ounces or milliliters....

선박조종 2025-03-20

1 Item: bow, stem, ahead, stern, astern, port, starboard, abeam, bridge, fore, aft, centerline, midships, freeboard, airdraft, draft, underkeelclearance

선박조종 2025-03-20

1 Item: bow, stem, ahead, stern, astern, port, starboard, abeam, bridge, fore, aft, centerline, midships, freeboard, airdraft, draft, underkeelclearance

skincare word search! 2025-10-13

11 Items: fragrance free and water resistant- contains zinc oxide 3.4%helps support skin firmness and reduction of skin laxity- contains hexapeptide-11thoroughly cleanses and gently exfoliates- contains jojoba oil and a variety of acidshelps conserve elastin and protect from environmental stressors- contains sodium ascorbate...

Biology Word Search - Kiki 9b 2024-06-11

15 Items: the coloring in a leafa reagent that tests a leaf for starchA part of a plant that attracts pollinatorsA part of a cell that supports and protectsA part of the vascular bundle that carries waterAn organ that is responsible for transport in plantsthe product of using iodine on a leaf after photosynthesis...

Revision,Living and non-living things to fungi and bacteria(Jackey) 2025-03-27

22 Items: Fish are_____-blooded.There are_____ in yogurts.The process of classifyingFish breathe through_____.The process of pollinating.Fungi: Mushroom,_____ and yeastThe classify things by their_____._____ are the only mammal that can fly.WOW stands for: _____,oxygen and warmth.There are only 4 groups of living things....

Guess Who ( First one to come with all the corrects answers wins a prize) Happy Staff Giving 2025-11-18

41 Items: Holahead ladyThe huggerOkay friendsBalloon QueenGirl next doorCrochet MasterThe influencerI's Married NowFury baby mommaThe quiet modelThe FashionistaOg Pre-k TeacherVegan SweetheartQuiet sweetheartGetting CardstockMind your MannersPretty smile girlYeesssss Hunnnyyyholds down the forttours, tours, toursThe Happy CommitteeAfterschool Mama Bear...

Plantae Kingdom 2025-04-29

1 Item: plantae, root, stem, photosynthesis, moss, tree, algae, flowering, oxygen, water, sunlight, soil, leaf, pot, cacti, lavender, adaptations, ecosystem, reproduction, food, seeds, structures

Statistics Fun 2025-09-25

1 Item: individual, categorical, quantitative, dotplot, frequency, relative, venn, diagram, percent, marginal, conditional, histogram, stem, leaf, mean, median, mode, boxplot, interquartile, range, outliers, normal, standard, distribution, skewed, zscore, empiri

CHAPTER 2: KNOWING HOW YOUR BODY WORKS 2024-08-27

1 Item: endocrine system, neuron, arteries, epidermis, pancreas, bladder, gallbladder, pituitary gland, body system, heart, plasma, brain stem, hypodermis, respiration, bronchi, integumentary, respiratory system, capillaries, joint, skeletal system, cerebellum, k

One Word Search 2024-10-06

250 Items: eggpanwaxboxsipsixflyskicubkeynewpopnodcardadyarnpinewoolharmkneewrenzoombuzzlewdmilkblowpinklovetrayslimfilmdimestemsailwoodlookantsrailclambabychopedgenosyneststopfoldwailshutlickusednameteamruinpasthalfmeltsucksighcoalcornnicetablebrassjollyflakyflashstarthauntquilttrampsmashcrimeerectdrinkbikescolorjumpymilkyclothducksspicywearycruelquicktense...

Activ8 STEM Academy - The First Year 2024-05-24

1 Item: De.Aristizabal, Nurse.Fowlkes, Przybyl.Brown, Schill-Booth, V.A.Studies, Custodians, Fitzgerald, Altruismo, Cafeteria, Counselor, Mr.Stokes, Danville, Isibindi, Ms.Terry, Specials, Academy, Amistad, Faculty, Gauldin, Staff, History, Holland, Reading, Scie

sailing ~ 250 WORDS 2025-07-12

250 Items: aftbowebbjibleelogpinruntoebankbeambeatboombuoyclewdeckdockeaseeddyflagfoilfootfurlgaffgustgybeheelhookhulljibeknotliftlinelufflullmarkmastnosepeakpierpoleportpuffreefriserollsailseamskegsolostaystemstowtacktrimvangwakeyardzoneabeamablowaloftberthbilgeblockchinecleatdraftdriftentryfetchflareflukegenoahatchheavehitchhoistironsleechlinespanelpinch...

Maple Word Search 2025-10-02

1 Item: Patch Jack-o-Lantern Gourd Stem Vine Orange Round Halloween Harvest Seeds Carve Face Candle Autumn Hay Bale Tractor Farmer Corn Field Rustic Squash Thick Pie Sweet Spicy Soup Family Festival

Robotics 2025-11-21

1 Item: Accidents, Arm, Base, Battery, Brain, Circuits, Code, Coding, Controller, DC, Data, Distance, Edison Tesla, Electric, Joint, Lab, Link, Magnesium, Manipulator, Motor, PPE, Professionalism, Radio, Regressor, Robot, Robotics, STEM, Safety, Sensor, System, V

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....