states of matter Word Searches

Smell Word Search 2024-06-08

40 Items: spyfanwildlifthairsofasmellstinkslinkwringteachneedymushysteelfrogsbleedprintsmilefalseflingwritebecomesteadyremovechoosematterprettyhaircutqualifyimperilpuzzledtenuoussplendidspitefulintroducebefittinginsuranceadjustmentsuperficialadventurous

Science! 2024-09-09

40 Items: GASATOMHEATDATAFORCELIGHTSOUNDSOLIDMATTERENERGYLIQUIDMETHODGRAVITYCIRCUITBOILINGMELTINGMIXTUREHABITATRESULTSKINETICFRICTIONFREEZINGCHEMICALSOLUTIONDISSOLVETRANSFERMAGNETISMINSULATORCONDUCTORECOSYSTEMPOTENTIALEXPERIMENTHYPOTHESISCONCLUSIONELECTRICITYTEMPERATUREEVAPORATIONCONDENSATIONGRAVITATIONALTRANSFORMATION

Science 2024-10-06

40 Items: DNACELLFORCEVIRUSENERGYMATTERNEURONPROTONGENOMEENZYMEFOSSILcatATOMGRAVITYQUANTUMSPECIESPROTEINCLIMATENEUTRONHORMONEPHYSICSBIOLOGYANATOMYGEOLOGYINERTIAMOLECULEBACTERIAELECTRONMUTATIONREACTIONFRICTIONSPECTRUMEVOLUTIONECOSYSTEMASTRONOMYCHEMISTRYMAGNETISMRADIATIONBIODIVERSITYPHOTOSYNTHESISELECTROMAGNETISM

Sea Word Search 2025-05-09

38 Items: furgasbinrunnestcavecoopfoodfoodjumpswimrideshellsolidmetalglasspaperdairyfruitlunchhabithabitanimalanimalscalesmatterliquidgroupsgrainsdinnerbeehiveplasticpictureproteinfeathersexercisebreakfastvegetables

Exercise 2025-05-09

38 Items: furgasbinrunnestcavecoopfoodfoodjumpswimrideshellsolidmetalglasspaperdairyfruitlunchhabithabitanimalanimalscalesmatterliquidgroupsgrainsdinnerbeehiveplasticpictureproteinfeathersexercisebreakfastvegetables

Word Search #2 Ciencia 2025-07-03

40 Items: pHDNAAtomCellAcidBaseDataForcePowerTableMotionEnergyMatterVolumeTheorySpeciesProteinGravityDensityElementPhysicsBiologyMoleculeOrganismGeneticsChemicalReactionCompoundEcosystemEvolutionChemistryMicroscopeLaboratoryHypothesisExperimentChlorophyllTemperatureObservationPhotosynthesisThermodynamics

38 - Physics Terms 2025-07-12

40 Items: accelgammalightwavesactionatomicbosonschargecosmicenergyfieldsforcesfusionjouleslaserslengthmattermotionnucleiohmicsphotonplasmaquarksqubitsscalarstaticstraintensorvectorcurrentdensityentropygravitahadronsinertiaionizedkineticmassiveneutronvoltage

science 2026-03-30

40 Items: wavedowncoilwatersoundcrestwavessoundmodletroughliquidmediumdifferspringmatterfigureenergystringspringfriendamountrelatedcarriedforwardmovementpositionpropertyadjusteramplitudefrequencyfrecuencydecreasesincreasesorigionalbrightnesstransversewavelenghtscientistshorizontallycharicteristics

Puzzle 10 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 18 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 20 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 28 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

A BITE OF HISTORY 2026-05-01

15 Items: , upset Japan, USS ship sank, August 2 1945,Germany army, the miracle of?, start of the war, Stalin and hitler, stain's punishments, frace , brittan , U. S, Hitler , Tojo , Stalin, Part of France France, why u.s entered the warlion , Code name for battle, the length of the London bliz, the state of the people during operation Barbarossa

Chapter 6 2026-04-30

14 Items: _______ - Evidence that briefly describes events that have occurred._______ - Evidence that describes in detail events that have occurred._______ - Numerical information about people or events used to ground claims._______ - Evidence in the form of actual objects, audiotapes, videotapes, photographs, or diagrams....

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

High Holy Days 5785! 2024-09-20

15 Items: 'All Vows'Days of ___Day of AtonementGreat with applesHoly, Holy, Holy!Ten Days of ______.Literally 'Good day'Last month of the year'Return' or 'Repentance'Yiddish Holiday GreetingFirst month of the New YearHorn used during High Holy DaysFruit, said to have as many seeds as there are mitzvot.Blessing recited when doing something for the first time...

Cycle 1 S2 Week 11 2025-04-23

11 Items: the loan on a homeHaving more than one possible meaning; unclearto express a math expression into its lowest termsmatter that has come from a recently living organisma character who recounts the events of a literary workThe amount of money required to pay for the basic thingsunrestricted buying and selling of goods between countries...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

The EYEBALL 2026-06-11

12 Items: The whites of the eyefront surface of the eyeallows light into the eyethe colored part of th eyeliquid found in the front of the eyebends light rays coming into the eyeliquid found in the middle of the eyearea where there are no rods or conestiny muscle that keep the lens in placenerve found attached to the back of the eye...

Enjoy Shorty 2025-05-26

15 Items: A citrusCapital of OmanTo be or not to beOne of the Jackson 5Largest Greek islandThe national flower of FranceSomething you no longer get at meetingsWhat is the national animal of Scotland?What is the world's most expensive spice?What color is the skin of an adult polar bear?What is the main ingredient of a Greek tzatziki?...

Unit 1 Matter & Its Interactions Word Search 2023-10-31

58 Items: gasatombonddatamassodorpurecolorsolidchangelengthliquidlustermattermatterplasmaprotonsalinesolutevolumeacidityanalyzeboilingdensityelementformulaformulameltingmixtureneutronchemicalchemicalclassifycompoundelectronevidencefreezinghardnessmoleculephysicalpressurepropertysolutiontoxicityformationsubstanceconclusionelasticityhypothesissolubility...

Pulmonary Genetics 2025-04-01

15 Items: feature of 50% of PCD casesskin findings of Birt Hogg Dubefeature seen in 30% of AFAB with TSCcondition caused by TERT, TERC, DKC1gold standard of cystic fibrosis testinginjury or inflammation to the alveolar spaceoculocutaneous albinism, Puerto Rican founder mutationsymptoms include high pressure in arteries of the lungs...

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Music theory 2026-01-05

16 Items: the volume of musicthe layers of musicA cadence chords V - IA cadence chords IV - Ithe speed or pace of musicA cadence, anything to chord VA key signature with two sharpsA key signature with three flatsA key signature with no sharps or flatsmultiple notes all sounded one after the othera type of texture with two or more main melodies...

Vocabulary - Memory 2026-04-29

14 Items: StrongImprove.ProbableIdentifyRemember.Certain and sureSo that others can hear.From memory, by memorizing.bring memories of somethingAn illness of the mind and body.Correct, exact and without any mistakes.The fact of being unable to do something.The state of not having something anymore.Aware of,knowing what is happening around you.

IDEO: idea 2025-11-10

16 Items: ideoIdeaideogramideologyideogenyof ideasideologueideocracyideosphereideophobiaor mistrust of ideasruled strictly by an ideology or set of principlessystem of ideas and ideals, especially in economics or politicsarea where ideas are thought to be created and grown, intellectual space...

Volleyball 2025-03-24

12 Items: total points in a gamemost popular type of servename a type of forearm passhow a ball is put into playhow tall the top of the net isit's in the middle of the courtfast offensive hit to a specific spotChief official of the volleyball gamenumber of players on the volleyball teamDefensive technique for stopping a spike...

2/28 2025-02-28

30 Items: Impeccable – Flawless or perfect.Benevolent – Well-meaning and kindly.Detrimental – Causing harm or damage.Tenuous – Weak or slight; insubstantial.Intricate – Very detailed and complicated.Epiphany – A sudden realization or insight.Imperative – Absolutely necessary or required.Surpass – To exceed or go beyond expectations....

Absolutism 2025-03-25

12 Items: of lawarmadahereticcapitalrepubliccrucifixinflationAbsolutismLegitimatedisciplinepresumptiveright of kings

VOTING & ELECTIONS 2026-03-11

30 Items: PACVOTEGAREYVOTINGEFFECTPUNDITGROUPSCURIAECAUCUSVOTERSSTATESTAWNYAVOTINGFATIGUELEADERSADDRESSEFFICACYPRECINCTLOBBYISTSPECTRUMTAKE ALLELECTIONSELECTORATESPLIT-TICKETPARTISANSHIPGERRYMANDERINGDISENFRANCHISEDSTRAIGHT-TICKETACTION COMMITTEEELECTION COMMISSION

Trigonometry Identities 2025-05-07

21 Items: a² + b² = c²Reciprocal of sineReciprocal of cosineReciprocal of tangentBest pre calc teacherOpposite over adjacentStudy of triangle mathSpace between two linesGreek letter for anglesAdjacent over hypotenuseSays two things are equalMath rule or relationshipFlipped version of a valueFunction where f(–x) = f(x)True equation for all values...

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

Atom - nuclear 2023-10-17

20 Items: protons + neutronssaid electrons travelled in orbitals.radiation with high penetrating powersubatomic particle with neutral chargeparticle that is basically an electronsubatomic particle with positive chargesubatomic particle with negative chargeidentity of element. Number of protons.discovered electrons. Cookie dough model...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

NATP Chapter 14 2025-04-09

22 Items: Heart relaxesSlow breathingRapid breathingHeart is at workNormal breathingDifficulty breathingInhaling air into lungsThe absence of breathingExhaling air out of lungsUsed to measure temperatureWarm soak of the perineal areaUsed to measure blood pressureConsistently low blood pressureConsistently high blood pressure...

Vocab Odd Years 9 2026-03-10

24 Items: freedomto set freea leaning towardto lean back and relaxsomeone who beautifiesa polygon with 10 anglesa mature white blood cella surface that slopes or leansunit of computer storage spacepertaining to a sense of beautya white, crystalline amino acidthe sensation of bodily movementa geometrical figure with 8 angles...

DNA 2026-06-08

21 Items: The D in DNAthe monomer of DNAconnects with thymineSet of genes in an x-shapeDNA is a _ helix structure_ bonds hold together the DNAthymine and cytosine are thisPair Guanine and Cytosine, eg.comparing different strands of DNAThe genetic information in the cellsA process through which DNA is copied_ group holds together the nucleotides...

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

Globalization 2025-08-19

27 Items: In comparison.Public perception.Area of expertise.Provider of goods.A reduction in priceTo use up completely.To take something awayA product not made abroad.To leave out or not include.Operates in several countries.Purchase and use of goods and services.Making something easy to use or access.Most important, powerful, or influential....

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Ch. 33 Arthropoda Word Search 2026-04-05

12 Items: The process of shedding a cuticleArthropods have this type of symmetryArthropods belong to this clade of animalsThe number of tissue layers in an ArthropodArthropods have this type of main body cavityThis is shed for growth and provides protectionExample of an appendage specialized for sensingArthropods have this type of developmental mode...

Monday's not coming by Tiffany D. Jackson 2024-11-29

16 Items: Name of the highschool?What happened to Monday?Name of Monday's sister?Name of Claudia's church?What sound haunted Claudia?What is Monday's moms name?Name of the housing complex?What is Claudia's dads name?Monday's favorite color was?Name of Claudia's boyfriend?Where did everyone think Monday went?What color was the house they spent time in?...

THE TOWER OF LONDON 2026-08-02

20 Items: A male ruler of a kingdom.A female ruler of a kingdom.The capital city of England.The language spoken in England.A symbol worn by kings and queens.A strong building made for defence.Related to a king, queen, or monarchy.A large and beautiful home for royalty.A person who protects an important place.A traditional guard at the Tower of London....

Kenna's word search 2026-03-25

10 Items: sepoymarchcottonempirerailwaysof indiaof plasseyin the crownof india actindia company

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Weathering, Erosion & Deposition Word Search 2026-02-25

15 Items: the force that pulls rocks and soil downhilla large moving mass of ice that shapes the landthe process that breaks rock into smaller piecesthe process where sediment is dropped or settledthe movement of sediment from one place to anothera type of weathering that changes the rock’s composition...

Russia 2025-12-19

14 Items: beet soupfish eggsbiggest countrycapital of Russiaat war with Russiacapital of Ukrainepresident of RussiaSea south of Ukrainerare animal from Siberiadolls inside of each othersecond coldest place on earthclosest American state to Russiacountry with name like a US statesea that connects to the Black Sea

JUST BETWEEN US 2026-06-15

20 Items: kisskissmothbearglobetowerParisPoemscharmDatesAlwaysSafariCuddleexpressCampingKareokeof loveMistletoechocolateof minutes

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

Hausa City States 2024-08-13

7 Items: RanoKanoGobirBiramDauraZazzauKatsina

CLIMATE 2026-03-31

15 Items: What does kWh stand for?What is the "flow" in a wire?What is the "pressure" in a wire?– What is "Output divided by Input"?– What is trash used for energy called?What is the average weather over 30 years?What is the goal for "Net ______" emissions?What type of sunlight is scattered by clouds?– What is decayed organic matter used for soil?...

Chapter 6 2026-04-22

14 Items: _______ - Evidence that briefly describes events that have occurred._______ - Evidence that describes in detail events that have occurred._______ - Numerical information about people or events used to ground claims._______ - Evidence in the form of actual objects, audiotapes, videotapes, photographs, or diagrams....

Global I Review 2024-01-09

30 Items: Be goodBe chillBe good or elsePlebeians and...The first civilizationThe Islamic code of conductChristianity, Judaism, IslamThe Greek word for city-stateThe dynasty started by Liu BangA city-state that rivaled AthensAncient Mesoamerican civilizationCapital of the Eastern Roman EmpireHinduism, ancient Egypt, Rome, Greece...

Unit 14 Word Search 2026-02-14

30 Items: a six-pointed stara seven-sided shapeto multiply by sevena shape with six sidesone of six equal partsa shape with eight sidesa person in their eightiesa group of seven performersa person in their seventiesa group of eight performersto multiply something by sixa sea animal with eight armsa solid figure with six facesto multiply something by eight...

Aerospace Engineering Vocabulary 2026-03-27

30 Items: Main body of an aircraftDownward force due to gravitySpeed and direction of motionForce exerted by air or fluidShape designed to reduce dragFaster than the speed of soundSlower than the speed of soundHeight above sea level or groundAmount of mass in a given volumeAir resistance that opposes motionAirfoil surface that generates lift...

DIwali Word Search 2026-09-04

10 Items: A row of decorative lampsThe name of the final day of DiwaliThe name of the shop Thakorji sits inLiterally translating to a mountain of riceWhen Thakorji whispers in the ears of the cowsThe Hindu calendar month Diwali is celebrated inDecorative sand patterns drawn in front of ThakorjiThe name of the turban offered to Thakorji on Diwali...

Breakthrough Inventions and Innovations 2025-04-14

10 Items: MICROSCOPE : An instrument used to view objects too small for the naked eye.3DPRINTER : A machine that creates three-dimensional objects by adding material layer by layer.FUSION : The process of combining two atoms to form a heavier atom, releasing vast amounts of energy....

Sharks Word Search 2025-03-25

22 Items: What are mermaid’s purses? ________What are baby sharks are called? ________What type of skeleton do sharks have? ________What is the fastest species of shark? ________What is the smallest species of shark? ________How do sharks communicate with each other? ________What is an excessive fear of sharks called? ________...

Water from the Rock 2025-06-02

26 Items: Israel's leaderMoses' successorPast tense of bringSet up, as in a tent_____________ of IsraelAnother word for a rockA hard geographical itemThe children of ___________Another word for "traveled"Meaning "based upon all this"To take in liquids into the bodyWhere the rock was (Exodus 17:6)God told Moses to _______ the rock....

Chapter 7F - Electricity & Electrical Safety 2026-07-22

37 Items: 1/1,000th of an ampereabbreviated as kw; 1,000 wattsany material that conducts electricityalso known as cold light or actinic lightuse of electric currents to treat the skinsubstances that speed up chemical reactionsopposite electrode from the active electrodepositive electrode of an electrotherapy device...

Places in a Town, Directions & Prepositions of Place 2026-06-29

20 Items: bankeastwestnearnorthsouthbridgebehindlibrarynext-tohospitalturn-leftturn-rightbus-stationin-front-ofmovie-theatertrain-stationpolice-stationsubway-stationon-the-corner-of

Child Welfare Information Gateway 2024-03-19

48 Items: kindatapivottoolsyouthaspirecourtsequitystatestraumatribesexpertslibraryneglectparentswebsiteadoptionlivechatoutreachresearchbelongingdiversityinclusionknowledgewellbeingworkforcecaregiversengagementevaluationfostercarepermanencypreventiontechnologycommunitiespartnershipchildwelfaremaltreatmentpublicationscollaborationgrandfamiliesmodernization...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Module 3: Matter and Energy in Ecosystem 2025-11-19

47 Items: CellChainCycleCycleCycleBioticEffectEnergyManureOxygenLevelsAbioticof CellDioxideEcologyPyramidGlucoseConsumerMembraneNitrogenFixationOmnivorePigmentsProducerCarnivoreCytoplasmEcosystemHerbivoreMesophyllAtmosphereDecomposerExhalationGlycolysisRespirationChloroplastEvaporationRespirationUnicellularCondensationDetritivoresMitochondriaDecomposition...

Macbeth 2024-10-30

10 Items: his heirs will be kingthe author of the playthe protagonist of the playmanipulates Macbeth with magiccomes up with the plan to kill Duncanthe son of Duncan who flees to Englandthe son of Duncan who flees to Irelandthe only person Macbeth should beware ofthe king of Scotland at the beginning of the play...

JAMES MADISON 2026-05-15

10 Items: FilesMadisonMansionof 1812soldiersAmericansbuildingsPayne Toddof Americaof the Constitution

social studies vocabulary 2022-06-14

14 Items: jurycivilgroupenlistof lawappealvaluesdonatedemandsupplyinquiryof rightsconventionpoint cabinet

Caribbean & Central America 2026-04-16

16 Items: Music found in JamaicaLargest country by sizeNatives of the CaribbeanMajor waterway in PanamaIsland with swimming pigsMain economy of the CaribbeanThe #1 export in the CaribbeanMix of native and Spanish bloodMost populated in Central AmericaMost dangerous country in the worldPopular tourist resort in Nassau, Bahamas...

Ancient Greece Chapter 8 Section 2 2026-04-09

10 Items: state-owned slaves captured from conquered landspowerful ancient Greek city-state devoted to warPersian emperor after Darius I who invaded Athens in 480 BCfast, lightweight Greek warships with three levels of rowerspartnerships, usually between nations, to help defend against enemies...

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Kim's Word Search 2025-03-12

15 Items: CampYorkBearsGolferGivingHawaiiLovingSpunkySkiingof fourHostessPiedmontShoppingFargo Bankof Southern California

Econ concepts 2023-07-16

16 Items: iloveeconomicsmyfavoriteclassbestteacherevergreatlifelessonsThe study of the economic behavior of individuals and firms.A situation in which extra units of something produce successively smaller benefits.A school of economic thought advocating government spending to pull economies out of recession....

Biomass Energy 2026-03-31

15 Items: What is the most common traditional form of biomass?Organic matter used as a fuel source is called ______.AN alcohol fuel made from corn or sugar cane is ______.A fuel made from vegetable oils or animal fats is ______.Decomposition in the absence of oxygen is ______ digestion.Biomass gets its initial energy from the sun through ______....

Wedding 2025-02-09

14 Items: doManLoveVowsWifeKissBrideGroomDanceHusbandof HonorBridesmaidsof the Brideof the Bride

Leo Lens - April 2026 2026-04-30

10 Items: The writer of a bookA main division of a bookA long work of fictional proseA list of sources cited in a bookAn introductory section of a bookThe protective outer binding of a bookThe edge of a book where pages are bound togetherA drawing or picture that decorates or explains a bookAn author's handwritten or typed text before publication...

Lesson 4: Father of Many Nations 2024-04-05

14 Items: heirisaacshieldrewardnationnationsbehavioralmightyoffspringtestamentof promisedemonstrateof the earthrighteousness

Pope Word Search 2025-06-10

26 Items: ofMaypopeheadawaybornfromstaypoorhopeAprilpapalpeaceEarthbravefaithchosencaringleaderhumblenaturememoirprotectencouragethe age ofguesthouse

The word search of Hathor 2026-04-24

14 Items: COWDISKMENATOF RASISTRUMGAZELLEHATHORSHET-HERTTURQUOISEMALACHITESOVEREIGNJUBILATIONOF SYCAMOREDISTANT ONE

2026-06-28: The Goodness of Being Near God 2026-06-28

22 Items: God with usPoint 4: ___ to GodIn___ is not trans___Like a mobile Mount SinaiPoint 1: The ___ of Nearness to GodPoint 2: The ___ to Nearness to GodHave you experienced the ___ of prayer?Point 3: The ___ of our Nearness to GodWay 1 the Spirit relates to us: to ___ usWay 2 the Spirit relates to us: to ___ usWay 3 the Spirit relates to us: to ___ us...

La Chasseuse de la Particule - Vocabulaire 2025-05-21

17 Items: sofileproudprizematterweightcountrycenturyMoroccounknownpowerfulto teachto reactbuildingapparatusconservativeselementary particles

Solar System 2025-10-22

14 Items: orbits star directlyfails to clear orbitorbits planet directlysame as asteroid but smallerSun-based solar system modelEarth-based solar system modelmass from space hitting surfaceforce of attraction between massescelestial mass of rock, gas, & dustmass from space striking atmospherefield of comets & debris past Neptune...

WEEK 1 SPELLING SEARCH 2026-04-06

20 Items: MORE THAN ONE OXTO SEIZE OR CAPTUREWITH THE EXCLUSION OFUNABLE TO DO SOMETHINGA REFLEXIVE FORM OF ITA SPRING OR SOURCE OF WATERA CHILD WHO LOST BOTH PARENTSFREE FROM DOUBT OR RESERVATIONFREE FROM IMPERFECTION, COMPLETEA VISIBLE IMPRESSION OF SOMETHINGEAST OR WEST ON THE EARTH'S SURFACEA SENTENCE IN AN INTERROGATIVE FORM...

Chapter 7, Part 4: Digestive Terms 2026-05-13

26 Items: A CLEFT PALATEA SWELLING OF SALIVAPERTAINING TO ORGANSPERTAINPERIODONTAL WALLAROUND/NEAR CONTRACTIONPERTAINING TO THE PALATEPERTAINING TO THE THROATTHE ACT OF BACK FLOODINGPERTAINING TO THE PYLORUSINFLAMMATION OF THE MOUTHPERTAINING TO THE PANCREASPERTAINING TO AROUND TEETHPERTAINING TO AFTER A MEALRECONSTRUCTION OF THE PALATE...

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Famous Tourist Attractions 2026-07-08

10 Items: BenTowerFallsMahalPicchuof GizaColosseumof LibertyOpera HouseWall of China

Game Online of Colaboration Project (National Hero, Province/Capital City, Local Foods, Tradition, and Culture) 2025-11-12

10 Items: A hero from MalukuOne of Palembang's typical foodsThe capital of North Sulawesi provinceThe capital of West Kalimantan provinceThe name of the capital of Central JavaThe name of the capital of East KalimantanAngklung and gamelan musical instruments come fromLompat Batu is a traditional culture from the island of...

Unit 1: Matter and Change 2023-08-29

13 Items: gassolidliquidchangechangemixtureelementcompoundpropertypropertysubstancehomogeneousheterogeneous

Memory Word Search 2024-12-17

18 Items: "Flash Drive" of the brain​Inferior to hippocampus proper​Paired, almond-shaped structure​Learning stage of memory creation​Ability for brain to adapt and learn​A type of memory correlated with smell​Receiving input from Entorhinal Cortex​A type of memory correlated with hearing​gateway between hippocampus and neocortex...

Chapter 14 - The Nervous System 2026-05-08

18 Items: gap between neuronsmeans "little brain"largest part of the braincommand center for the bodychemical messangers in your bodygroup of cells near base of brainelectrical message sent by neuronsan action that happens before you think about itcarries information from your nose to your braincarries information from your ears to your brain...

Stem List 3 - Find the example words hidden in this puzzle. Look at the clues and definitions at the bottom of the paper for clues on which words are hidden. Use your stem notes! 2024-11-04

22 Items: the act of forgivingcapable of being submergedaffected with or inclined to claustrophobiaattended by or causing suffering or disasterShe suffers from some ____ without her glasses.one of the same or nearly the same age as anotheran undertaking usually involving danger and unknown risksthe adhesive friction of a body on a surface on which it moves...

Quality Definitions 2025-03-27

20 Items: waste materialrequirements have been metDoing it right when no one is lookingexisting, happening, or done at the same time.for a specific intended use have been fulfilledWhere requirements for a procedure are retrievedrelating to a corporation, especially a large company or group.a thing that makes something better or is better than something else....

MS Drama Music Vocabulary 2026-03-19

27 Items: to invent or create musicpublic performance of musicdirector of a musical groupthe highest-pitched male voiceItalian dynamic term for “loud.”Italian dynamic marking for “soft”the regular repeated pulse in musica piece of music for two performersItalian dynamic term for “very loud.”the rate of speed of a piece of music...

Q1, Weeks 1-5 Vocabulary (12) 2026-08-14

30 Items: a general agreementblameless, impeccablekeenness of perceptionobvious to the eye or mindtraveling from place to placehabitually complaining; whiningdeliberately affected; theatricalto enroll into service by compulsionimpossible to refute, break, or alternot possible to take back; unalterableto cause to become less harsh or hostile...

CHAPTER 14 2023-04-21

16 Items: eraeonfossilepochsperiodshalf-lifekt-boundrypaleontologistplatetectonicsrelative-datingradiometricdatingcambrian-explosionlaw-of-superpostiongeologic-time-scaleendosymboint-theorytheory-of-biogenesis

People to Know - Civil War Word Search 2025-04-29

50 Items: WarLeewarArmyCivilUnionGrantBrownnorthsouthunitepeaceBartonTubmanTurnerSmallsbattlesecederightsstatesescapeLincolnJacksonShermanCavalryAtlantafreedomgeneralofficercountryAmericaRichmondDouglasscampaignenslavedvirginiainfantryrailroadfugitiveStonewallsurrenderconductorreligiousCharlestonRepublicanemancipategovernmentcompromiseConfederate...

Fourth Grade 2025-06-06

39 Items: BCTimArtGymJaneIslaLilyRyanAndyHuntWillGradeGraceMauraReganChloeMylesAidanMusicEssaysLizzieStatesMuseumFridaySTREAMProjectExpressCharlieLibraryLibrarySpanishResearchTo DreamDivisionCharlotteLandformsand HattieSkinnybonesBiographies

states and abbreviation 2014-10-05

7 Items: DaresayflourishWreathedGrizzledGutteringHesitantlyunaccountably

Geometry 2026-04-21

11 Items: Having the same size and shapeA transformation across a lineA transformation that shifts or slidesThe original figure in a transformationA transformation known as the center of rotationSymbols used to label the image in a transformationA transformation that does not change the size or shape of a figure...