states of matter Word Searches

Noach 2024-10-27

19 Items: “rah”“ohR”“Noach”“Tevah”“shalom”“Kosheck”“Ruach” HebrewNoah’s firstborn“a mighty hunter”“confusion” Hebrew.His name means “hot”“breath of life” Hebrew“The Laws of Noah” aka.The number 7 in Hebrew means ??to act according to one’s own obligations.the number 40 in scripture often refers to ??The number 8 in scripture often means ______ ________....

Analyst Word Search 2025-10-25

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

Word search 2025-10-25

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

cha 2025-10-26

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

Instacart's Puzzle 2022-10-12

9 Items: Logo of instacartInstacart Connect Retailer, uses barcodeWhat do we do for orders that the items out of stock"I understand your frustration, I would be upset too."What do we do to an order when a family emergency comes upSuggesting a friend to join instacart and getting paid for it.Color of the pop up showing batching paused on shopper's profile....

Mexico's Culture 2024-05-09

12 Items: an example of Mexican artofficial name of our countryan example of a Mexican sportofficial language of our countryscientists who study human cultureculture can change when the ___________ changesan example of a thing/element that makes up a cultureanother example of a thing/element that makes up a culture...

ellies wordsearch 2023-12-18

16 Items: to create lighta pattern of starsthe study of planetshas the north star in itfor light to bounse of itthe study of constellationsa rock that falls from spacea person that travels in spacea spoon made of made of 7 starslight in the sky from a meteoroidapath in space around a planet/starwhen night and day are the same length...

Revelation 3 2025-11-14

19 Items: outspueLydiathiefwhiteknockSardiswealthpillarCroesusof Davidand shutof satanLaodicealukewarmeyesalveJerusalemovercomethPhiladelphia

Man-Tastic Word Search 2024-10-26

9 Items: Lifting others to be their best selves.The ability to bounce back after challenges.A memorable time shared with a close friend.Taking ownership of one’s actions and duties.Welcoming everyone, no matter their background.Treating others with kindness and consideration.Lending a helping hand or providing encouragement....

EASTER 2025-04-13

33 Items: TOMBLOTSTHEMLIFELORDJUDASCROSSCHRISTSAVIORSUPPERANGELSSUNDAYSPRINGBROTHERROBBERSREDEEMERADVOCATESOLDIERSEMMANUELPASSOVERNEPHITESAND OMEGAMAGDALENEOF THORNSHAPPINESSROLLED AWAYIS NOT HEREIS FINISHEDSPIRIT WORLDONE OF ISRAELOF GETHSEMANEOF JESUS CHRISTABOUT THE BUNNY

CH6 - Human Impact 2022-12-20

16 Items: Pollutants that are released into the air.________________________Contamination of Earth's land, water, or air.________________________A specific source of pollution that can be identified.________________________The removal of forests to use the land for other reasons.________________________...

Past Participles 2023-11-15

8 Items: The PP of goThe PP of eatThe PP of takeThe PP of giveThe PP of haveThe PP of speakThe PP of drinkThe PP of write

Human Impact Vocabulary 2025-05-19

15 Items: Reusing materialsWhere animals liveA stock of materialsNo longer exists, dies outHumans clear trees to build housesVariety of habitats and ecosystemsPrevention of wasteful use of a resourceProduction and disharge of gas or radiationDeplete the stock of fish in a body of waterWeather conditions over a long period of time...

Pathways Foundation Unit 1.1 2026-06-25

22 Items: ShyKindVennHobbyMusicTwinsAdultWorryof AgeRitualBecomeScienceDiagramJourneycare ofCeremonyFavoriteFriendlyVacationIdenticalFraternaland Different

Science Is Coooooooooool <->: 2015-05-20

36 Items: gasLabSunmasswindsolidSpaceEarthFloodClaimProveenergymatterliquidPotionPlanetweatherSCIENCEHabitatVolcanopressureMr.VulloBillGatesScientistInventionTelescopeLandslideEnviromentEarthquaketemperatureMs.PhillipsSolarSystemObservationThomasEdisonLouisPasteurBillNyetheScienceGuy

End of Third Grade 2024-25 2025-05-28

37 Items: ELEOGMathAreaTimeForceGraphsMatterMotionPlantsCanvasCursiveScienceHistoryDivisionAdditionBookFairDreamboxSTARMathCheckInsJumpRopeFieldDayFractionsPerimeterEconomicsGovernmentReadTheoryMeasurementSubtractionMeasurementSolarSystemBoosterthonSocialStudiesMultiplicationHumanBodySystemsMobilePlanetariumJCRaulstonArboretum

Science Word Search 2026-04-24

36 Items: gaspreysolidorbitbioticliquidNewtonmatterScienceabioticgravityinertiamixturethermalcircuitchemicalphysicalconsumercriteriasolutionrotationpredatorproducerbiosphereecosystemgeosphereprototypescavengeratmospheredecomposerrevolutionconductionhydrosphereevaporationconservationconstellation

JEDDAH COURT #86 2026-03-13

14 Items: COURT #86MURDERED OSIRISTHE WELL OF KNOWLEDGEBINDS YOU TO THE ORDERWHAT THE FEZ REPRESENTSGODDESS OF THE EGYPTIANSRAPS TO CALL UP OFFICERS25TH ILLUSTRIOUS COMMANDRESSBADGE OF INSIDE AND OUTSIDE SPYWHAT STARTS THE CREATION PROCESSREPRESENTATIVE OF IMPERIAL COURTBADGE OF ILLUSTRIOUS COMMANDRESSREPRESENTS OSIRIS’ PETRIFIED HEART...

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Units 44 and 45 Part 2 2024-01-18

62 Items: votedpublicnationalby votingto be sent(color) silver(color) copper(neuter) the wood(neuter) the metal(feminine) the voteof or made of glassof or made of plastic(feminine) the revolutionwooden, of or made of wood(feminine) the (law) treatyof or made of stone or rock(neuter) the (rock) diamond(masculine) the (male) slaveof or made of metal, metallic...

Lyric's word search 2026-04-27

19 Items: New moviesYo form of irTu form of irKids play hereShe likes blueLots of loud musicStore for you feetOpposite of difficultKids spend hours hereThe boys are going outMasculine was to say badWhere you buy stuff fromWhere you buy coffee fromMasculine opposite of badYou get medicine from hereWhere you get a sweet treatcomercial Big shopping center...

West African Capitals 2025-02-27

9 Items: Lomé, TogoAccra, The capital of GhanaBamako, The capital of MaliDakar, The capital of SenegalAbuja, The capital of NigeriaConakry, The capital of GuineaCotonou, The capital of BeninAbidjan, The capital of Ivory CoastFreetown, The capital of Sierra Leone

Give me Attention 2026-01-06

20 Items: The singular prime number that marks our official transition into a recognized unit.The ultimate, unmapped destination of a journey that began on a humble back bench in 2019.The smallest digital unit of our history; the only version of you I was allowed to see for half a decade....

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

transformations 2025-07-31

16 Items: proofanglesmotionvectorconverserotationcongruentreflectiontranslationtransversalexterior anglesinterior anglesangle of a polygonangle of a triangleside interior anglesinterior angles of a triangle

R2L2 2026-01-07

16 Items: INGOTROOFFAKEREALHUNGBEGINBEGANON TOTROUBLECOURSE NOTCARTON OF MILKBITTEN BY A DOGGET OUT OF HEREBUNCH OF CARROTSTHROUGH THE GARDEN

july 4 2026-06-30

41 Items: redUSAFlagBlueJulyFordBushchadmoonAdamsbeachriverwhitetrumpobamaemilychrispicnicStatesreaganEdwardpatriotholidayhistoryLibertyPatriotclintonBrandoncoloniesfamiliesbarbequeDemocratfireworksBetsyRossPresidentrevolutionRepublicancelebrationindependencedaySpangled Bannerthirteencolonies

Coach Ross 2026-08-19

45 Items: ELAHandBandworkMathRossCNN10WorldVolumehonestAgendaSportsStatesGlobalPencilGoogleWildcatWildcatheadingleadersRespectOn-TaskmasteryfocusedexcusesOutdoorScienceErasersteachersChouteauOklahomaDeductedTeachersHomeworkComputerProcedureclassmateGeographyownershipdirectionsRespectingprinciplesAccountabletrustworthyResponsibility

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: lawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryo fhopeAdullamcastoutloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationof the Agesking-priestspurificationrighteousness

Crunching For Equality Word Search 2026-04-13

5 Items: Fair treatment under the lawSeparating people based on raceThe supreme law of the United StatesTreating everyone the same under the lawA past decision used to decide future cases

LS - Mod 1 - Matter and Energy in Ecosystems 2022-10-05

38 Items: co2h20snowalgaewaterdecaycyclesleetvaporspongyoxygencarbonmatterexhalematterenergyglucosetrophicrecyclestomataprocessbacterianitrogenomnivorecarnivoreherbivorefossilizeecosystemdecomposerdetritivorechloroplastchlorophyllevaporationrespirationcondensationprecipitationphotosynthesischemosynthesis

5-403 Winter Word Search 2024-12-20

37 Items: DATASOILALIAADAMADLATOMANOAHGIFTSRETAJSARAHDYLANAILYNVERNATYMURWINTERGRINCHSLEIGHENERGYMATTERGODSONMARTINJULIANATHINAMICHAELCHARLIESUSANNAVACATIONPRESENTSEVIDENCEZAKARIYATHEODORECANDYCANEECOLOGISTECOSYSTEMVALENTINADECOMPOSERENVIRONMENT

World Landmarks 2023-02-10

20 Items: BenTowerMahaluluruFallsSophiaMosqueMosqueMosqueAlHaramKhalifaAnNabawicolosseumof Libertyof CordobaOpera HouseGate BridgeBlue MosqueLane MosqueWall of China

All About Antibodies 2026-02-25

18 Items: Is one or two types of light chains present in ~1/3 immunoglobulins.Is one or two types of light chains present in ~2/3 of immunoglobulins.Is One of the polypeptide units that make up an immunoglobulin molecule.Is a two-dimensional structure consisting of 2 heavy chains and 2 light chains....

Lipids 2025-09-12

17 Items: reaction to make soapsugar-containing lipidthe simplest type of glycolipidthe most common glycosphingolipidbackbone of all phosphoglyceridesproteins that allow for membrane fusionprocess responsible for making trans double bondscarbon found at the distal end of a fatty acid chainproteins that span the membrane and are embedded in it...

History and Governemt 2026-02-02

18 Items: FlagLawsAprilSpeechAfricaLoyaltyLibertyAssemblyPetitionReligionMilitaryEighteenNew YorkMarylandBear ArmsExpressionUnited StatesJames Madison

Countries and Capitals 2024-12-18

18 Items: - Rome- Paris- Tokyo- Cairo- Ottawa- Berlin- Moscow- Madrid- Athens- Beijing- Brasília- Canberra- New Delhi- Mexico City- Buenos AiresKingdom - LondonAfrica - PretoriaStates - Washington, D.C.

Galaxy Word Search 2026-05-19

8 Items: Galaxy with no definite shapeOval shaped galaxy without armsDistance light travels in one yearDisk-shaped galaxy with spiral armsInfinite space containing all thingsThe Galaxy our planet is located in.Force pulling matter toward the center of the Earth...

Greek Gods 2026-02-24

10 Items: Who is the God of prophecy?Who is the king of the Gods?Who is assosciated with owls?Who is the protector of girls?Who is king of the Underworld?Who is the Goddess of marriage?Who is the Goddess of the hearth?Who is the Goddess of the harvest?Who is the queen of the Underworld?Who is the protector of travellers and messengers?

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Pure Substances and Mixtures 2018-02-21

37 Items: gasalloyfluidsolidsolutetheorymatterdiluteliquidsiftingsortingsolventelementmixturemeltingboilingsolutionparticlecompoundchemicaldissolvefreezingmagnetismsubstancefiltrationsolubilitymechanicalsaturationevaporationhomogeneoussublimationtemperaturedistillationcondensationheterogeneousconcentrationchromatography

Atom Word Search 2024-10-06

37 Items: DNAATOMMASSGENECELLFORCELIGHTSOUNDVIRUSPROTONENERGYMATTERWEIGHTFOSSILENZYMEGENOMEGRAVITYNEUTRONPHYSICSBIOLOGYCIRCUITPROTEINELECTRONMOLECULEFRICTIONVELOCITYPRESSUREORGANISMBACTERIACHEMISTRYMAGNETISMEVOLUTIONECOSYSTEMTEMPERATUREELECTRICITYACCELERATIONPHOTOSYNTHESIS

End of Year Review 2026-05-18

37 Items: iongasatomacidbasemetalionicsolidprotonchargemattervolumeliquidelementmixtureneutronnucleusbondingchangesnonmetalcompoundelectroncovalentpressurephysicalchemicalreactionproductsmetalloidreactantspropertiestemperatureelectrolytehomogeneousequilibriumheterogeneousneutralization

Reading Fun Unit 22 - 24 2026-07-27

36 Items: hugbowkisssafetooltypewakedeskfindgreetshakeallowtouchstealbreakdependmattercustomsecretsleepydecidecoffeeasleepstreetcornerculturecountrymeetingbankingprotectprivatewithoutcenturybirthdaywonderfulinformation

Reagan's Presidency 2025-04-01

15 Items: 40th President of the United StatesWhat sport did Reagan play in college?Reagan was born in Tampico, in what state?Most popular and memorable film Reagan acted inJohn W ________ tried to assassinate Reagan in 1981First President to have this status with his relationshipMain profession Reagan had before he was elected President...

Vocab terms of Civil War 2025-03-18

20 Items: the freeing of the slavesa complete end to slaveryVirginia's federal arsenalA person whose owned by another persona warship that's heavily armored with irona political party formed in the 1850s to stop the spread of slavery in the Westa Union victory in the Civil War that marked bloodiest single day battle in American history...

Alexander the Great 2026-04-21

12 Items: producer)abiotic factor)Limiting factor)An biotic factor)An abiotic factor)Energy from outside)Example of decomposer)Example of primary consumer)Non-living factor of an enviroment)Living factors from an environment)Type of succession that starts with soilType of succession that slows the development of the community

Muscles 2026-05-13

20 Items: closes eyesynergist to tricepsmoves eye down and outextends and adducts the wristantagonistic to erector spinaecommon origin of forearm flexorsmost medial of the hip adductorsinnervated by CN XI; flexes neckperforms abduction of the humeruscommon origin of forearm extensorsiliocostalis, longissimus, spinalistailor's muscle; crosses two joints...

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

Cell Word Search 2026-05-01

13 Items: Unit of life.Site of protein synthesis.Contains DNA; controls cell activities.Site of aerobic respiration; releases energy.Contains chlorophyll; site of photosynthesis.Difference in concentration between two regions.Made of cellulose; supports and protects the cell.Jelly-like substance where chemical reactions occur....

Motiondiagram Word Search 2025-09-15

18 Items: Displacementthe sum of two or more vectorsthe difference between two timestotal distance divided by total timeThe length of a path between two pointsGreatness of size, strength, or importanceA quantity that has magnitude and directionA physical quantity that has magnitude only.the location of an object at a particular instant...

LGAW Crossword 2024-02-28

18 Items: The Tla'amin Nation NewsletterElected Executive Head of the Tla'amin Nation.How staff present information to elected officialsElected Executive Head of the City of Powell River.The name of elected officials for the Tla'amin NationCampsite and Park managed by the City of Powell River.Elected Executive head of the qathet Regional District....

Collins word search 2026-02-19

15 Items: need forvery littleto approve ofvery difficultshowing wealthto start a firethe highest pointshrewd and carefulhappy and exitefulbrave of couragousskillful and quickwise friend or advisorgreat enjoyment of or exitementpleasing in manner of appearancebody of water where two rivers meet

Elements of Art & Principles of Design 2024-11-01

17 Items: the lightness or darkness of a colora mark that is longer than it is widecreated by lines and are two-dimensionalelements that are repeated in a predictable wayis using different versions of elements in one work of artcreated when light strikes an object and reflects to an eyeused to create a sense of organized movement in a work of art...

Classic Horror Movies 2022-10-20

15 Items: ManManblobkongmummyof waxpeopledraculanosferatufrankensteinof the operadangerous gameon haunted hillof Frankenstein"from the Black Lagoon

Animal 2023-10-24

20 Items: The fastest land animal.The world's largest land animal.Bat The world's smallest mammal.Shark The largest species of shark.Penguin The largest species of penguin.An animal that sleeps upside down in caves.A snake known for its hood and deadly bite.An animal often called "man's best friend."Eagle The national bird of the United States....

Crust Word Search 2024-11-14

25 Items: - What is the innermost part of the Earth called?- What is the outermost layer of the Earth called?Ridge - What is an example of a divergent boundary?- What forms when magma reaches the Earth's surface?- What is the layer beneath the Earth's crust called?Wegener - Who proposed the theory of continental drift?...

Polish Verb Mogę 2025-11-04

30 Items: the form of "móc" in present tense for "ja" (I) meaning "I am able to"the form of "móc" in past tense for "on" (he) meaning "he was able to"the form of "móc" in present tense for "my" (we) meaning "we are able to"the form of "móc" in past tense for "ona" (she) meaning "she was able to"...

Nick-Of-Time Word Search 2026-03-31

15 Items: no-timeno-timetime-offovertimepunctualsave-timeextra-timenick-of-timetime-to-timetime-to-killoccasionallywaste-of-timetake-your-timetime-consumingwhale-of-a-time

Benchmark 2025-09-30

18 Items: inferthemeclaimrevealpropeleffectexcerptarticlepassageconveyssuggestof viewdevelopsnarratorargumentchallengecontributesof an article

Agency Administration 2021-04-22

19 Items: BeatZoneSectorBriberyPerjuryPrecinctMoochingShoppingChiselingShakedownExtortionCorruptionMeat-EaterFavoritismGrass-EaterRank-StructureCode-of-EthicsUnity-of-CommandOperational-Strategies

End of Term Ramadaan 2026-03-10

12 Items: SuhoorFastingEidulfitrEidprayerZakaatulfitrA night only found in RamadaanThere are 8 of these for ParadiseDate of Eid that follows RamadaanOrder of Ramadaan in the Islamic monthsNumber of times the fasting person rejoicesLarger than the skies and smaller than the ArshNumber of years walking distance depth of one sky

Heads of Houses Word Search 2026-06-09

8 Items: Head of Derham: Mr ____Head of Steven: Dr ____Head of Macneil: Ms ____Head of Summons: Mr ____Head of Clifford: Mr ____Head of Robinson: Ms ____Head of Bridgland: Mr ____Head of Schofield: Dr ____

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Ch. 11 Hair Removal Vocab 2025-11-06

31 Items: Also known as bandingThe border of the lip lineThe anatomical name for the underarmThe soft, downy hair found on a fetusNecessary for hair growth and nourishmentA resin used in the manufacture of soft waxSecretes sebum to lubricate the skin and the hairThe area between the eyebrows at the top of the nose...

US States and Capitals I 2019-04-06

15 Items: AlaskaJuneauDenverAlabamaArizonaPhoenixArkansasColoradoHartfordDelawareMontgomeryLittleRockCaliforniaSacramentoConnecticut

US States and Capitals III 2019-04-06

15 Items: MaineKansasTopekaBostonAugustaLansingKentuckyMarylandMichiganFrankfortLouisianaAnnapolisMinnesotaBatonRougeMassachusetts

US States and Capitals IV 2019-04-06

15 Items: HelenaNevadaJacksonMontanaLincolnConcordTrentonMissouriNebraskaSaintPaulNewJerseyCarsonCityMississippiNewHampshireJeffersonCity

US States and Capitals VI 2019-04-06

15 Items: UtahTexasPierreAustinVermontColumbiaTennesseeNashvilleHarrisburgProvidenceMontpelierRhodeIslandSouthDakotaSaltLakeCitySouthCarolina

U.S. States Word Search 2 2025-04-13

15 Items: MaineAlaskaHawaiiOregonAlabamaColoradoMissouriMarylandKentuckyWisconsinMinnesotaLouisianaNewJerseyConnecticutSouthCarolina

Nindita, Maisya & Shofia Riddle 2023-02-23

25 Items: : separating the room: another name for loft: vertical height in stairs: the bottom part of the door: a very common type flooring: different levels of building: the bottom part of the window: highest level in the apartment: the lowest load-bearing part of building: the top element that covering the building...

Environmental Science- Species 2025-02-18

17 Items: Likely to become endangeredIn immediate jeopardy of extinctionType of limiting factor; ex. diseaseType of limiting factor; ex. droughtspecies with no living individuals remainingType of growth represented by a J-shaped curveType of growth represented by a S-shaped curveSurvivorship curve that shows consistent mortality...

Cycle 4 Science Review 2026-02-13

18 Items: All the water on EarthAll living things on EarthThe solid, rocky part of EarthRock changed by heat and pressureRock formed from layers of sedimentMelted rock beneath Earth’s surfaceThe layer of gases surrounding EarthRock formed from cooled magma or lavaMelted rock that reaches Earth’s surfaceA resource that cannot be replaced quickly...

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

June 5-11 2023-05-13

24 Items: joylifeloveseeknisanfriendwisdomloyaltyhonestyjehovahprosperinherittogetherhezekiahpassoverhumilityholinessmarriagegatheringjerusalemof jehovahmotivationneutralityof Unleavened Bread

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

United States v. Madoff 2023-11-27

11 Items: mailwirefraudtheftperjuryunlawfulsecuritiesinvestmentfalsefilinginternationalmoneylaundering

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

Saints 2026-09-18

25 Items: MaryPaulAnnePeterClareJosephMonicaof ArcXavierLoyolaFrancisPatrickAnthonyCeciliaThereseDominicAquinasNicholasAugustineCatherineValentineMagdaleneMacKillopChampagnatof Calcutta

Compact Word Search 2023-10-06

11 Items: a compact's usual shapea synonym of compactingwhat a compact can carryan antonym of compactingtype of makeup that boldens lipstype of makeup that tans your facetype of makeup that boldens eyelashestype of makeup that colors your eyelidssomething to apply powder onto your facetype of makeup that makes your cheeks rosey...

Forensics Wordsearch 2026-03-23

15 Items: The study of poisons, drugs, and toxins and their effects on the human body.The physical location where a crime has occurred or is suspected of having occurred.The scientific study of blood and other bodily fluids to identify biological materials.The scientific study of projectiles (bullets) and firearms, including their motion and effects....

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

35 2025-08-17

15 Items: Independent biker.Riding across the U.S.Central U.S. biker route.Non-member showing loyalty.Ride through desert states.Strong biker culture region.Banner featuring the motor club’s emblemEssential gear for motor club bike upkeepLarge flag representing the motorcycle clubBasic set of letters used for communication...

The Magic of the World Cup 2026-08-03

10 Items: Moving very quickly on your feet.Groups of players who work together.To shout with joy to support a team.Distinct nations or political states.The net where the ball goes in to score.To make a loud call with a strong voice.A large cup or prize given to the winner.People who love and support a sports team.Making you feel very happy and enthusiastic....

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

Bailey & Justin's Search for Love 2025-11-18

22 Items: Where Justin worksBailey's maiden nameName of the best manJustin's middle nameNumber of bridesmaidsTheir favorite seasonColor of Bailey's eyesFavorite meal for bothTheir favorite NFL teamThe trip newlyweds takeBailey's cute dog's nameName of town they live inWhat month did he propose?Justin referee's this sportGroom's favorite college team...

Periodic Puzzle 2026-09-07

18 Items: Attraction between water moleculesAttraction of water to other surfacesAn interaction that connects atoms or moleculesA positively charged ion involved in ionic bondingA negatively charged ion involved in ionic bondingthe basic building block of all matter in the universeThe maintenance of relatively stable internal conditions...

Here Word Search 2024-12-16

26 Items: VetoCabinetDemocracyDiplomacyFederalismImpeachmentBureaucracyTerm LimitsSupreme LawConstitutionSupreme CourtLandmark CaseBill of RightsThree BranchesElectoral VotesAge RequirementDirect DemocracyMajority OpinionFreedom of SpeechCommander in ChiefPopular SovereigntySeparation of PowersElectoral Vote ProcessRepresentative Democracy...

Creation 2024-12-06

25 Items: SeaSkyManSinDayGodLandDeepLightWomanFruitImagePlantsBreathAnimalsof Edenof LifeSerpentEveningSabbathMorningDarknessCreationCovenantBlessing

Energy word search 2026-08-06

27 Items: Another name for heat energyEnergy associated with movementThe unit used to measure energyType of energy in an atomic bombEnergy which is stored or yet to be usedAssociated with kinetic energy - but not massType of energy which has north and south polesType of energy which spins a turbine or propellers...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Skeletal System Word Search 2025-12-05

42 Items: Knee CapSolid boneCheek bonePorous boneMovable jointUpper jaw boneUpper arm boneImmovable jointMature bone cellBone building cellBone breaking cellBones of the wristBones of the ankleAny break in a boneConnects bone to boneVertebrae in the neckBone of the upper legSlightly movable jointOnly movable skull boneThe unit of compact bone...

Written Reports in Law Enforcement 2026-04-03

13 Items: A thing that is known or proved to be true.Ability for a text to be read quickly in a glanceClearly defined or identified with precise detail.A sentence in which the subject performs the actionRecord of facts & events in a logical, order sequenceSpoken or written account of something observed, heard or done...

The Age of Jackson 2026-04-14

20 Items: Jackson hated themNew political partyTax on imported goodsLand Natives moved toOwned a important bankJackson was called thisElected President in 1828Jackson's idea of democracyLegal way to get native landJackson wanted to promote thisStates rejecting a federal lawJackson's second vice presidentRan against Jackson for President...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....