states of matter Word Searches

Federalism Word Search 2025-10-28

20 Items: CartaLockeSenseof LawBranchCollegeRepubliccontractof powersRebellionDemocracyFederalismCompromisecompromisesovereigntyand balancesAnti-Federalistof ConfederationAmerican revolutionEnglish bill of rights

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

Vaccine Locations 2021-05-24

35 Items: HynesHotelBangsFenwayBostonStatesSeniorCenterMiddleSchoolPalmerFoxboroCollegeAmherstEasternCapeCodOrleansGilletteConverseFalmouthEastfieldDartmouthCommunityConventionNatickMallDoubleTreeMarshfieldExpositionReggieLewisSpringfieldSpringfieldCircuitCityFairgroundsNorthamptonNorthborough

Abraham Lincoln 2024-10-11

35 Items: WarWarFreeCivilHouseMoralOrderPartySlaveUnionPeriodStatesUnitedDividedJanuaryLincolnPurposeSlaveryAmericanNorthernPreserveSouthernAmendmentExecutiveAbolishingChallengesLeadershipRepublicanConfederacyConfederateIndividualsTerritoriesEmancipationProclamationAccomplishments

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

Chapter 3 Vocabulary 2023-10-19

41 Items: Earth's outer layer _____________Earth's thinnest layer______________Earth's innermost layer______________layer beneath the crust __________________when magma reaches the surface _____________layer above the troposphere _____________________water vapor forms water droplets on dust particlesLayer beneath the lithosphere ____________________...

Lesson 4: Reformation and Reaction Word Search Puzzle 2023-03-21

45 Items: sectromejewsbiblejesusspainparisfaithghettoLutherchurchThesesCalvinof GodjesuitsaintsXaviergermanypriestsconventmuslimscatholicof Wormsreformerof AvilaPaul IIIof Trentreligionsacramenttheocracyisolationchristiancalvinismof LoyolacarmeliteindulgencecorruptionprotestantgovernmentreformationtemperamentlutheranismcatholicismInquisitionpredestination

BioMid Review 2025-12-09

31 Items: the study of cellsthe study of cells2nd phase of mitosis1st phase of mitosis3rd phase of mitosis4th phase of mitosiscondensed threads of chromatinDNA to RNA; occurs in the nucleusDNA enables life through this criteriaorganelle responsible for protein synthesisRNA to protein; takes place inthe cytoplasm...

The Legislative Brnach 2025-12-15

20 Items: to make lawsthe House of Representatives + the Senatethe leader of the Senate; also called the "President of the Senate"the "Upper House" of Congress, where each state has 2 representativesa lawmaking body made of two separate chambers or houses (the House of Representatives and the Senate)...

Antropology 2025-12-04

18 Items: – to come together (usually in community)– the study of past peoples and past civilizations.– the study of a person’s individual or familial past– changes that occur as a result of changes in the environment.– beliefs or rituals passed down from one generation to the next– a large population of people organized into a collective society...

Cycle 1 S2 Week 12 2025-05-01

13 Items: the loan on a homea strict adherence to core principlesthe quantity of matter within a given objectthe equation of a straight line in y=mx+b formHaving more than one possible meaning; unclearto express a math expression into its lowest termsa character who recounts the events of a literary work...

Cleaning/ Word Search 2022-11-01

20 Items: dispose of an itemhow well a product worksan item that cannot be reusedpotent disinfectant chemicalsa chemical used to whiten or sterilizethe process of removing dirt and debristhe process of killing all bacteria and microbesthe process that kills most bacteria and microbesan item that is able to be disinfected and reused...

Fantastic Fiction 2025-03-06

20 Items: This title character travels to the islands of Laputa & LilliputPeter Beagle wrote of 'The Last ___' who lived alone "in a lilac wood"Home of House Tyrell, Highgarden is a fertile wine-growing region on this continentThis sword-wielding barbarian from ancient Cimmeria was created by Robert E. Howard...

Sheffield Word Search 2025-06-10

28 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s nameMother of the Bride’s name...

Federal Bureau of Investigation Word Search 2025-09-04

5 Items: the act of examining someone or somethingcriminal activities used through computers or the internetpractices and techniques used to suppress and avoid acts of terrorisma system of government in which states unify together but still internal affairs independently...

Memory 2025-09-09

17 Items: loss of memoryfirst step in memorytype of memory for skillsmemory that is relatively permanentretention of information or experiencethe retention of information over timethe memory of emotionally specific eventsconcentrating on more than one activity at the same timememory loss for a segment of the past but not for new events...

Main Sciences Word Search 2024-12-14

3 Items: The study of matter (9 letters)The study of living organisms (7 letters)The study of the natural world (7 letters)

christmas history 2022-12-03

15 Items: A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.For some Romans, this god's birthday was the most celebrated day of the year.This reindeer was created to advertise for the Montgomery Ward stores in 1939....

Earth Science CH 2 2016-01-18

30 Items: IonGasBohrMassBondAtomsForceIonicStateSolidMatterLiquidPlasmaProtonsmixtureDensityElementsNeutronsisotopesCompoundMoleculeCovalentMetallicHydrogenSolutionElectronsMassnumberhomogeneousAtomicnumberHeterogeneous

Logic Word Search 2024-03-19

30 Items: mindsoulformlogiccauseethicsvirtuemattermotionbiologypoeticspoliticsrhetorictheologysyllogismintellectknowledgereasoningaristotlesubstancehappinesseducationteleologyactualityphilosophygoldenmeaneudaimoniaempiricismmetaphysicspotentiality

Fluid Word Search 2024-10-14

30 Items: PumpFluidBoatsWHMISValveSoluteMatterPascalEnergyAqueousSolventDensityBouancyGravityNewtonsGalileoSolutionParticlePressureCohesiveViscosityHydraulicPneumaticBarometerSubmarineSolubilityHydrometerTemperatureConcentrationChromatography

Evolution Word Search 2024-11-14

20 Items: LyellAnningLamarckFossilRecordSexualSelectionHomologousStructure"Survival of the fittest"type of bird Darwin studiedchange is a species over timea change in the sequence of DNApreserved remains of an organismselective breeding done by humansdifferences in traits of a speciesmost broad classification of organism...

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Nasso 5.0 2025-06-02

25 Items: “Kohen”“Asah” Englishson of Shedeur“Nasso” English“Shema” English“Shamar” EnglishThe prince of the tribe of Gad.This clan of Levi totaled 3,200.The prince of the tribe of Judah.resentment against another person.This vow separates you for Adonai.This gift can never be taken away.The Hebrew “Gershon” means _______.The prince of the tribe of Zebulun....

Voters and Voter Behavior 2022-10-04

25 Items: having an influence on politicsa person with no party affiliationillegal voting or tampering in an electiona person who has been convicted of a serious crimethe practice of voting for candidates from only one partythe practice of voting for candidates of more than one partya set of basic beliefs about life, culture, government, and society....

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Dani & Jake 2025-05-25

30 Items: Bride's SiblingBest Man's NameGroom's SibilingCouple Coaches AtGroom's Birth MonthBride's Birth MonthPlace of EngagementMonth Groom ProposedMaid of Honor's NameHoneymoon DestinationTown Groom Grew Up InBreed of Couple's CatsCouple's 1st Cat's NameCouple's 2nd Cat's NameName of Bride's CollegeCouple's Favorite SportDating App Couple Met On...

matter properties 2025-09-16

6 Items: catlionzebrahippoelephantMan's best friend

Baron Alexander von Humboldt 2023-10-24

20 Items: ofvontheageship17691859¨of¨baronlarrysouthamericaexplorerhumboldtspyglass"father¨¨modern¨alexanderdiscovery¨geography."

JULY 2024-07-03

36 Items: redflagjulyblueadamsgamespartywhitestarsfamilyparadepicnicstatessummerfourthnationsummeramericafreedomfriendsholidayhotdogslibertystripescampingbarbecuecoloniescongressunclesamvacationfireworksjeffersonpatrioticdeclarationindependencedayfoundingfathers

Sheffield Word Search 2025-06-10

30 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Grooms hometownThe Bride’s hometownThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s name...

Waves and Their Behaviors 2023-10-09

11 Items: A form of radiation wave that travels though the universe.To cause (light, heat, sound, etc.) to pass through a medium.The number of waves that pass a fixed point in unit time (Hertz).A point on a wave where the displacement of the medium is at a maximum.The distance between identical points in the adjacent cycles of a waveform....

schwa sound /er/spelling list 2013-05-27

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteroysterclamortremoranswercollardoctortheaterthunderburglartractorquarterscholarchamber

Science Word Search 2023-06-02

30 Items: sungasbiomheatsolidearthatomsforceliquidmatterphasesvolumeenergyscienceprotonsdensitysolutionneutronsevidencedissolveconsumergeosphereecosystemmoleculesparticleselectronsatmospheredecomposerhydrospherecondensation

Science Practices & Crosscutting Concepts 2023-08-31

30 Items: dataplanmodelcausescaleeffectenergymatterchangeengagedsystemsdevelopanalyzethinkingargumentpatternsquantityfunctioncarryoutquestionsstructurestabilityinterpretconstructconceptualproportionexplanationcommunicateinformationinvestigation

Grade 3 Science - Scientific Method 2024-09-11

30 Items: datahelpspaceearthrecordmatterenergylivingbiologygeologyresultszoologyvariablediscovercomputerinterpretscientistquestionspersevereequipmentcooperatebrainstormentomologyexperimentlaboratorypredictioninvestigateconclusionsobservationsinterconnected

The Search 2024-10-26

30 Items: blutriobaolpelolevimaterleechdeityliderflakesnowymaskyhingerainermatterheraldentitypyritepicklebasuraintentstewardrasgadobracketmanifestvestatronindividualglowsterioantimatterthirdentity

space 2024-12-18

25 Items: WayStarHoleYearCometOrbitGalaxyPlanetNebulaMeteorSystemRocketCosmosQuasarMatterEclipseGravityAsteroidSatelliteTelescopeAstronautExoplanetSupernovaAndromedaSpacecraft

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

Discover Italy 2024-09-03

21 Items: Capital of ItalyItaly's currencyMeans "Cathedral"Italian famous cheeseItaly's national sportSea to the east of ItalySea to the south of ItalyLives in the Vatican CityCity famous for its fashionVolcano that destroyed PompeiTasty meal originated in Naples95% of Italians are this religionA country that borders with Italy...

Greek Vocab 2025-10-03

31 Items: Before SocratesA circular buildingA citadel or "high city"An enigmatic facial expressionThe square top of a Doric capitalTwo handled jar with a narrow neckSlight bulge in the middle of a columnAncient Greek satue of a standing nude manAn independent city-state in ancient GreeceAncient Greek statue of a standing clothed woman...

Foot Pathologies - 2025 2025-10-16

25 Items: Also known as 'bunion'Also known as 'pump bumps'Also known as Tailor's bunionAnomalous fusion of two or more tarsal bonesAbnormally flattened medial longitudinal archInflammation along the entire ball of the footThis is rupture of the Posterior Tibial TendonResults in heel pain first thing in the morning...

roman gods 2025-11-17

10 Items: god of the seagoddess of loveking of the godsgoddess of grainqueen of the godsgoddess of wisdomgoddess of huntingmessenger of the godsgod of the forge / blacksmithsgod of music / the sun / healing

Math Vocab 2023-10-05

24 Items: basetermsfactorsvariableexponentdiscretemonomialbinomialpropertyequationtrinomialrewritingexpressionsubstitutecontinuouspolynomialtrichotomyexpressionscoefficientcoefficientof equalityof a monomialof operationsof a polynomial

Density and Matter (Try to define all the words) 2017-03-09

30 Items: gassinksizemasswaterfloatsolidcolorshapematterliquidvolumedensitymeltingboilingtexturemixturefreezingpropertydissolvesolutionchemicalphysicalparticlemoleculesevaporatemagnetismcondensatesolubilitycharacteristic

Biology Word Search 2024-02-29

30 Items: cellatomforcetheoryenergymatterbiologyphysicselementorganicecologyspeciesnaturalgeneticsmoleculecompoundreactionresearchanalysischemistryevolutioninorganicecosystemexperimenthypothesismicroscopeartificiallaboratoryconclusionbiodiversity

Chemical Processes & Thermal Energy WORD SEARCH 2024-11-12

30 Items: heatflowmuirmodelinputarrowenergysystemoutputmatterokeefechangeabsorbthermalprocessreleasesciencetransferproductsequationreactionradiationparticlesreactantscomponentsconductionconvectionexothermictemperatureendothermic

Week 10 Spelling 2024-11-14

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteranswercollardoctorclamortremortheaterburglartractorquarterscholarchamperthuundercharacter

Photosynthesis 2025-01-07

30 Items: leafgreensugarwaterenergymatteroxygenplantsgrowthglucoseproductconvertstorageradiantreactionreactantsunlightcytoplasmabsorptionchloroplastcalvincyclechlorophyllchloroplastrespirationmitochondriareproductionmicroorganismphytoplanktoncarbondioxidephotosynthesis

Rocks Word Search - Bonus 2025-02-06

30 Items: rocklavaheatmeltcoolcyclemagmamatterenergybasaltcementlayersOKeefemineralcrystaligneousgranitecompacterosionScienceobsidianpressureconserveintrusiveextrusiveweatheringdepositionsedimentarymetamorphicunderground

Atomic Structure Word Search 2025-10-06

30 Items: atommasscorebondgroupwaterionictableshellouterchargematterenergyprotoncarbonperiodoxygencentervalenceelementmixtureneutronnucleusorbitalelectroncompoundhydrogenmoleculereactionchemistry

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Odin Word Search 2023-06-21

34 Items: EyeGodGododinthorgeriyuleHuntymirwodanbaldrfrekimimirof Warfenrirwolvesravenswisdomhuginnmuninnasgardmidgardsleipnirmagicianof poetswandererwednesdayand Emblayggdrasilberserkerallfatherof Wisdomof Vili & Veof Bestla & Borr

2nd Quarter Literature 2022-11-25

28 Items: The main character of a story _____________A type or category of literature _____________Prose that tells of real people and events _____________A literary tool to make the audience laugh _____________An expression of one thing in terms of another _____________The major turning point for the main character _____________...

Rojo Word Search 2023-03-07

20 Items: color of grasscolor of the sunMan's best friendcolor of the oceanking of the junglefruits grown on vinestom from tom and jerrySpongeBob lives in onejerry from tom and jerrymonkeys ¨favorite¨ fruithad a color named after itthe color of cirrus cloudsbiggest animal in the worldthe color of stratus cloudsfruit that rhymes with tango...

Liquid Word Search 2023-11-14

30 Items: gasflowlenssolidforcelightsoundliquidmattervolumeopaqueabsorbdensitymixturegravitythermalcircuitsolutionpositionmagnetismdirectionconductorevaporateelectricalmechanicalrefractionreflectiontransparenttranslucenttemperature

Selfcare Is Not Selfish 2024-05-02

30 Items: tapcaregrowhopelikeliveloveplanreadselfsingcolorcountdanceenjoyfocusmusicrelaxrenewsmellwritebreathfamilylistenmatterfriendsrefreshregroupmeditateboundaries

8th Grade Science 2025-03-27

30 Items: PHUVATOMBOHRLABSPHASEFORCEWAVESMATTERSAFETYMOTIONNEWTONENERGYDESIGNDENSITYHALOGENTHERMALBUOYANCYPHYSICALMOLECULEPHILLIPSELEMENTSCHEMISTRYAMORPHOUSVARIABLESPROPERTIESEXOTHERMICPERIODICITYOBSERVATIONSHOOGENHUIZEN

Oobleck! 2025-10-18

25 Items: gassolidforcewaterpaintcreamfluidsmatteroobleckketchuppressuredilatantviscosityparticlestoothpastcornstarchshear-ratesuspensionRheopecticthixotropicshear-stressnon-newtonianshear-thiningpseudoplasticshear-thickening

Roof Word Search 2023-02-24

26 Items: highest limitdivide into parts.Top of the buildingheavy base supportingsupport building structurecontact two vertical levelsextend from side to side ofthe entrance to a building, roomplace giving temporary protectionvertical brick or stone structurebuilding materials used ascoatingsthe top surface of a step or stair....

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Ash & Bhav 2025-04-25

24 Items: Their surnameMonth they metFirst movie dateBhavik's dream carBride's middle nameCity where they metAashini's dogs nameMaid of honor's nameMonth Bhavik proposedBride's brothers nameHoneymoon destinationBhavik's brothers nameBhavik's football teamBhavik's birthday monthColour of bride's dressAashini's birthday monthDream holiday destination...

Pathophysiology, Word Search 2024-09-09

20 Items: something that is subjectivedefects that are present at birththe form and structure of organismsobjective and observed manifestationthe likely outcome or course of a diseasethe increase in severity signs or symptomsthe decreased in severity signs or symptomsthe study of reasons for certain decease phenomena...

Anatomical Directional Terms 2025-09-08

14 Items: Part of body located toward the backPart of body located toward the frontBody part that is located near the surfacePart of body that is located away from the surfacePart of body that is below another part or toward the feetPart of body that is situated at the enter of the body or organ...

Medical Terminology 2025-09-11

46 Items: cellfrontskullfiberbloodbelowspineabovechestcancertissuepelvisabdomenstomachnucleusdiseaseformationcartilagecast; throwsame; equaltone; tensiondeveloping cellinternal organsback of the bodystar; star-shapedthe study of diseaseumbilicus (belly button)Near the point of origin.Normal standing position.above; above normal; excessive...

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

Abgeordnete Word Search 2025-01-31

19 Items: lawto forbidto breachjudgementfemale mayorfemale judgeConstitutionto recommendrepresentativefemale citizenmale chancellormale head of stateFederal Armed Forceslower house of parliamentupper house of parliamentFederal Constitutional courtprotection of the ConstitutionGerman Basic Law, constitutionrule of law, state under the rule of law

WORDSEARCH 2: IRREGULAR VERBS 1º BACHILLERATO-D 2025-10-08

10 Items: PAST SIMPLE OF "BUY"PAST SIMPLE OF "SAY"PAST SIMPLE OF "BLOW"PAST SIMPLE OF "HIDE"PAST SIMPLE OF "RISE"PAST PARTICIPLE OF "PAY"PAST PARTICIPLE OF "SINK"PAST TARTICIPLE OF "GROW"PAST PARTICIPLE OF "RIDE"PAST PARTICIPLE OF "WRITE"

Estates Word Search 2023-11-24

18 Items: 1793, January 21: Execution of _____.1793, October 16: Execution of Marie _____.1789, August 4: _____ abolished in France.1789, May 5: _____-General convened in Versailles.1795: Establishment of the _____, a five-member committee.1799-1804: The Consulate period, with _____ as First Consul....

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Ash & Bhav 2025-04-25

24 Items: Their surnameMonth they metFirst movie dateBhavik's dream carBride's middle nameCity where they metAashini's dogs nameMaid of honor's nameMonth Bhavik proposedBride's brothers nameHoneymoon destinationBhavik's brothers nameBhavik's football teamBhavik's birthday monthColour of bride's dressAashini's birthday monthDream holiday destination...

Solid Word Search 2024-10-02

30 Items: gasmeltheatatompuresolidphasestateliquidfreezeenergymotionexpandchangeOKeefematterthermalkineticelementmixturecontractmoleculesubstancedepositionevaporationsublimationtemperaturevaporizationcondensationclassification

Geology and Mineralogy 2025-11-19

30 Items: OreCoreLavaPolarPolesEarthCrustDenseMagmaMantleMatterGeologyEquatorOceanicIgneousOrganicPressureVolcanicPlutonicGeologistEvolutionExtrusiveIntrusiveLimestoneInorganicAdaptationLithosphereContinentalCompositionSedimentary

Foreign Policy 2015-04-06

36 Items: aidwarforceunionpolicytreatysovietunitedstatesspherealliesactionscultureamericaforeignVietnamconflictmilitarydiplomacymediationsanctionsinfluencecommunismeconomicsdemocracyconditionscapitalismpropagandacooperationmotivationscontainmentisolationismnegotiationsdictatorshipinternationalinternationalism

Solid Word Search 2024-12-02

36 Items: gasatomheatsolidratioliquidstatesvolumesampleoxygencarbonballoonkineticthermalelementformulaparticleperiodicmoleculecompoundhydrogenchemicalpressurefreezingcondenseprocedurepotentialsubstancemagnesiumexpansionpropertiesattractiontemperaturethermometercontractionvaporization

Islamyat Word Search 2025-11-20

20 Items: Muttalib Restored the well of Zam ZamNumber of men who migrated to AbyssiniaNumber of women who migrated to Abyssinia“Paradise lies at the ____ of the mother.”Number of Muslims who migrated to AbyssiniaEmbraced Islam in the sixth year of prophethoodEmbraced Islam in the sixth year of prophethoodNaufal Khadijah was a rich widow from this clan...

Literary Terms, Elements & Devices Word Search 2022-10-05

40 Items: A voice behind the peomThe objective meaning of a wordThe choice of words a writer usesThe Central character and a storySomething is given human attributesThe classification of literary workThe perspective a story is told fromThe highest point Tension in the plotThe use of informal language in writingThe struggle between two opposing forces...

ENVIR 302 Final Project - Technology and its Environmental Impacts 2022-12-08

23 Items: The use of resources.The creation of gases or radiation.The act of getting rid of something.The amount of energy used per unit time.Using less energy to perform the same task.A form of energy resource like coal, oil, and natural gas.An energy resource that is not able to grow again or be made again....

~Science Vocab Search~ 2023-05-22

20 Items: Change in moisture contentMeasures the direction of the blowing wind.Intense tropical storm formed over warm ocean water.Measures the amount of precipitation that has fallen.The weight of the pressure of air pushing down on Earth.When cold air moves under warm air and forces warm air up.Narrow bands of high winds near the top of the troposphere....

nosotros commands 2025-11-30

10 Items: Nosotros command of irNosotros command of hacerNosotros command of ponerNosotros command of dormirNosotros command of buscarNosotros command of llegarNosotros command of empezarNosotros command of preferirNosotros command of levantarseNegative nosotros command of sentarse

Months of the Year 2022-10-16

12 Items: Fill in the blank: April, May, June, ________, AugustWrite the name of the last month of the year. __________Write the name of the third month of the year. __________Write the name of the sixth month of the year. __________Write the name of the first month of the year. ___________Write the name of the second month of the year. __________...

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

Griot Word Search 2025-11-19

25 Items: rulerinbetweensStorytellerCapital citymeans peoplegroup of travelerssole control of tradeclans joined togetherimportant trading cityboat with triangular sailscenter of trade and learningMusa Ruled from 1307 to 1332founder of a line of emperorsenclosure large circular wallbakni reported Muslim historydescendants from a common ancestor...

Nominating Word Search 2025-02-16

23 Items: HawkPartyPartySystemCrisisCabinetWebsterof 1837SequoyaOsceolaDoctrineof TearsDemocracyVan BurenTerritoryC. Calhounv. GeorgiaConventionsv. MarylandRemoval ActHenry Harrisonof Abominationsof Indian Affairs

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Greek Myths 2025-04-08

12 Items: God of warZeus's wifeArtemis' twingod of the seaFather of ZeusWife of KronosGod known as Venushalf man, half horseFather of the titansMessenger of the godsgoddess of the hearthgod of the wild, shepherds, and flocks

Unit 1 Review 2025-09-01

10 Items: Which branch makes laws?Which branch enforces laws?Who is one Senator from Indiana?Who is one Senator from Indiana?Which branch judges or interprets laws?Who is Indiana's district 5 Representative?What are the freedoms people have in a society?What is the division of power between the state and federal government?...

Term 1 RE 2024-03-26

16 Items: Ordersspiritbaptismof workcatholicreligionpresenceeucharistmatrimonyimmersionsacramentssimplicityof the Sickconfirmationreconciliationthe way of Mary

Jake and Bailey OO 2024-07-10

27 Items: Bailey’s talentName of the bandMother of the brideMother of the groomFather of the brideFather of the groomCouple’s street nameBailey’s maiden nameCity Bailey was bornMonth the couple metLocation of proposalNumber of bridesmaidsHoneymoon destinationJake’s birthday monthNumber of venues touredBailey’s birthday monthJake’s favorite wrestler...

World War 1 Aftermath 2025-01-30

20 Items: founder of fascismeconomy slows downbook Adolf Hitler wroteGermany, Italy, and Japanleader of German Nazi partyfather of modern physiologyJapan longest serving monarchknown for Theory of Relativitystrong leader has full controlfounder of modern macroeconomicsmajor influence of existentalistspresident during Great Depression...

GEOGRAPHY & PLACES 2025-10-07

25 Items: Largest oceanThe Big AppleHome of Big BenCapital of JapanLand of kangaroosLargest rainforestSmallest continentLand of the pyramidsColdest place on EarthWorld’s largest desertCity of love and lightsCity with the ColosseumLongest river in AfricaFamous mountain in JapanTallest mountain on EarthSmall but rich city-stateCapital of the Philippines...

Relativeatomicmass Word Search 2025-09-21

38 Items: two or more atoms bonded togetheratoms with the same number of protonscolumns going down the periodic tablerows that go across on the periodic tableA spherical orbital found in all energy levels.Outer most shell that is occupied by electrons.Electrons occupy orbitals singly before pairing up.A substance formed as a result of a chemical reaction....

Age of Enlightenment 2025-03-12

23 Items: LawsLockeLogicof GodRightsNewtonChangeMozartVermeerFrancisFarmersMonarchyChurchesRousseauVoltaireof Powersof ReasonPrincipiaRevolutionRevolutionEarthquakeEnlightenmentWollstonecraft

Economics Ch. 17.1 2025-01-07

9 Items: Revenue minus expensesLack of a particular resourceWhen business owners may operate however they see fitEconomic system where decisions are made by IndividualsWhen a company is the only one selling a product or providing a serviceeconomic market where you have the right to buy and sell goods as you want...

Oculator Word Search 2024-09-26

23 Items: "Grandpa" SmedryAlcatraz's motherfather of Alcatraza Librarian defectormakes the Translator's Lenseshas the Talent of breaking thingsa literary critic for the Nalhallan Dailyare a sapient species in the Free KingdomsLeavenworth's daughter and Attica's sistereditor of Alcatraz Smedry's autobiographiesknight of Crystallia and princess of Nalhalla...

Unit 4 Review 2025-02-06

18 Items: way of Romanizing the Chinese wordsthe Latin spoken by the common peoplearticulator engaged to nasalize a soundsounds made without the use of the lungssound made with little obstruction of airthe forcing of air through the nasal cavitywhat the letter "h" is on French and Spanishlangauge family to which French and Spanish belong...

U.S.A states 2022-02-12

7 Items: NewYorkHawaiiAlaskaMarylandOklahomaColorado

Parts of an Essay 2025-05-12

6 Items: Something that proves an ideaSummarizes the main idea of an essayA statement that expresses the focus of your writingThe sentence that states the main idea of a paragraphAn opening statement that grabs the reader's attentionThe final sentence in a body paragraph that explains how the example supports the topic sentence