spring Word Searches

Conveyor Word Search 2025-08-04

111 Items: podechobeamvoidfluxtubegridductcoreflowwavewailgainminefieldforcerelayprobecloudfilterpapsolplasmamattermagnetmatrixbuffersignalenginespringentityschismshieldbeaconthrustenergyvortextunneljesterimpulsechamberspurtercrevicetendrilboosternetworkcapsulecarriergrindertropismcrystalsyntagmconveyorcapacityparticleenhancerfragmentemissionparallaxrotation...

How Well Do You Know Your Model A 1? 2023-06-17

20 Items: rate of speeddecorative basefinishing piecesprevents blow bycam lobe contactmixes fuel and airhighest temp valvelight weight metalbrand of Model A tirekeeps the door closedreduces 12 to 6 voltscontrols spark timingwhere will you find a forkwhich side is the door lockupholstery fastening deviceprovides support and lubrication...

Seasons 2026-01-27

105 Items: icecoldfallrainsnowbeachbootscandyciderfrostgiftsmusictreesautumneasterfamilyleavesmoviesspringsummertravelwinterbeaniescandlesflowersfriendsharvestmittensnewyearparadespartiespicnicsscarvessnowmenbonfirescarolingcostumesegghuntsflannelsfootballgiftbagsgiftwrapgrillinghayridesholidayslanternsmemoriespumpkinssnowdayssunshineweekendsbarbecues...

èèà 2023-08-09

102 Items: èèeameeeabeeskyvantigvanfoxcubwetyoueerkholamoonvansmisssopanovaladycribrumizynnfallrosewinehugsfishdaisytacosstarsseventatertorchsnugsrocksuraqthoneydrivehiiiifloatyummygoosebonitalizardplantssnoopybirdeasmilesreavenawakencoffeespringtumaloaddictgoslowalwayspiscesflowerscuddlescuddlesvermontredbullworkoutgoosiesallwaysthemoonscorpiomissyoubeeahive...

how well do yk nessa 2025-08-24

24 Items: fav foodfav scentdream jobfav seasonmy fav showmy fav songfav subjectmy fav colorclass we metmy bday monthmy fav singermy fav numberfav sweet treatmy fav restaurantthe activity i dothe thing i collectmy fav clothes storethe instrument I playfav adam sandler moviemy fav guard equipmentfavorite makeup productsport i played for 10 years...

Water Words 35 2025-10-06

110 Items: BayDewIceGulfKelpMistPoolSnowAlgaeBayouBeachCanalCloudFloodHumidMarshPondsRiverShoreSteamSwampVaporWaterDrenchGeyserLagoonLagunaLiquidRunoffSalineSiphonSpringStreamAquaticAquiferChannelClimateDeadSeaErosionEstuaryFlowageGlacierPouringShallowSolubleThunderBrackishChlorineFountainHydrogenLakeErieLakesideMoisturePlanktonSeaWaterTapWaterWaterLog...

Tumble leaf 1 2026-03-23

107 Items: FIGFOXBOGYAKSUBTOPICEFOGSHIPCRABSHIPHOLEBEARPINEWOODLILYFROGSNOWTWIGLONGOKRABULBPARKBEESCLAMKITEBALLTUBEMASKPUMPSANDSLEDSTICKPEACHMAPLEHEDGEGOURDPIANOAROOHGEODESNAKEPAINTGRUBSBLOOMBUNNYTRAINHONEYCOINSSTRAWKAZOOLOGBUGLEGBUGTWITCHTINKERAUNTIEBAMBOOTURTLEBEAVERDRAGONTIMBERPLANTSSPIDERPEBBLEMUFFINSPRINGBUCKETSPONGEFIGLOOSHOVELMAGNETTREEBUGCOOKING...

4.6 The Seasons 2026-05-11

25 Items: nixsnowrainwindimbernimbiarcuscloudventusnimbusrainbowEnglish for 'minime'Latin word for winterLatin word for summerLatin word for springEnglish for 'quid agis?Latin word for fall/autumnEnglish for 'mihi nomen est'English for 'Bene me habeo.'English for 'Gratias tibi ago.'English for 'Quid tibi nomen est?'English for "sic," "certe," and "ita vero."...

Pitch Word Search 2025-12-05

108 Items: rayrobrowskiskytoptoyplotplowplumpolepondringriotrocksaidsandseedsidesizeskipsmogsnowsoilspottailtenttesttoottreetriptrotturnuglyunituponvaseweekyankyardyawnpitchplaceplantpointpoundpuppyquartquietradioranchriverrulersharksheepshellshootsillysleepsliceslidesmellsmilesolidsoundsouthspellspicespoolspoonstampstompstoresweeptabletallythirdtracetrain...

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Around the year (TG 2022) 2022-10-12

104 Items: batowlbeehendigtanfanfallmaskwandsnowslipnestbirdlushthawlentmaskrestcrispghostwitchmummyfrostcoverdaisytulipbulbsbloomrenewhatchspadeautumnwinterspringeastersummerleavessquashscenicgathercobwebspookyspiderwizardfrozensleighsledgevioletcrocuspuddlesproutchicksbucketairbedorchardharvestpumpkincostumevampirehauntedmonstersnowmandrizzleblossomseagull...

January Word Search 2025-04-22

19 Items: Spring startsSpooky seasonDay of the workerMiddle of the weekLast day of weekendWinter's break monthBest day of the weekFirst day of weekendWorst day of the weekThe month of carnivalsChristmas and New yearSecond day of the weekThe first month of the yearThe third month of the yearAutumn starts on this monthThe sixth month of the year...

Autumn Word Search 2026-03-03

13 Items: Bright, clear weather with plenty of direct light from the sun.Having a high temperature that feels intense or creates a lot of heat.Weather characterized by liquid water falling from the sky in droplets.When the sky is mostly or completely covered by clouds, blocking the sun....

Can you find these Spring Break vacation words? 2026-03-16

5 Items: carparktreebugsbirds

Memory Word Search 2025-09-13

19 Items: A TV ShowA Dairy CowA Gem StoneA Rail SidingA Month in Springwhat trains run onBirthday Boys NameSinger of True BlueYamaha AG100 is whatTransport Gangers DroveSinger of Pub with no beerModel of car made by HoldenWhat number birthday is thisWinner of State Of Origin 2025Nail used to hold down rail lineHow many stars on Australia flag...

Peter Pan pgs. 78-83 2024-02-06

13 Items: Who will Peter live with?What is Mr. Darling's name?She can do the _____ cleaning.Who always kept the window open?What was Wendy's mother singing?That life wasn't _______ to him.Who can visit Peter once a year?Who had been wrong about mothers?Where did the children slip into?Where is Peter going to go back to?Who did the Darlings decide to adopt?...

The sound of music 2026-05-27

7 Items: stay nose eye lasheswhite dresses blue satin sasheswhite winters melt into springare a few of my favorite thingsgeese that fly with the moon wingssleigh bells schnitzel with noodles...

Unit 5 (Nature - Animals - Weather) 2026-03-24

15 Items: Messi.Autumn or spring.From water to ice.Weather prediction.Aggressive, violent.A period of cold weather.Cheetahs have this pattern.An animal's sexual partner.When clouds and rain disappear.Walk with no clear purpose/direction.Dalmatian or zebras have this pattern.An animal that chases, kills and eats others....

Leicious Word Search 2026-05-25

4 Items: Hidangan dari Italia mirip pangsit isiLemon Crinkle Cookies adalah dessert yang terdapat di … PackageBahan yang dipakai di minuman Gingerbread Hot Chocolate selain kayu manisSaus klasik dari Prancis berbahan dasar susu dan roux (campuran mentega & tepung)

Secret Santa's Hint Hunt 2025-12-14

11 Items: A dog's rivalA blue-green colorA cool classical elementA place of comfort and peaceA season of birth and renewalTo be determined or persistentA prediction of something grand or divineA small smart canine that is never trustedTo have a small idea or thought of somethingA shape made from a line turning inwards on itself...

Grade 9 BIBA 2025-12-04

10 Items: The Chinese eat with theseThis is a lucky color in ChinaThis is over 13,000 miles long.the most endangered animal in ChinaThe largest planet in our solar systemThe most favored food during spring festivalThe Chinese invented this in the 9th centuryare used by fishermen in China to catch fish.This was invented in China over 2000 years ago...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

March 2025-01-12

115 Items: JOYNEWNOWTRYWAYBODYCALMCAREDRAWFEEDGOALGLOWGROWHEREHOPEKINDLEADMAKEMINDMOVENOTEPATHPLANROOTSEEDSLOWSOFTTENDTESTTIMEWARMWORKBEGINBUILDCRAFTDAILYFAITHFOCUSFRESHGREENGUIDEHABITLEARNLIGHTMAGICPEACEPLANTREACHRENEWSHARESHINESKILLTEACHTRACKTRUSTWATERWHOLEWRITEBRANCHBRIGHTCENTERCHANGECREATEEFFORTEVOLVEEXTENDFOLLOWGARDENGENTLEGROUNDNATURENOTICERECORDSKETCH...

word search 2025-02-26

115 Items: bydocatandandourourmomdadcanredlionyourtimejoinokayyesslovecuteheaddeerwordmeannicecoolkindveryfaceflageyesnosekindnikefallalotmathhomezebrahippoWordsAliveplacerykerwatervideomaybecandybullynorthtrashunderfunnyqueenmouthdramaboredhousesucksinviteinvestimpactwithincausesotherspleasebarleypeoplestrongthingsbracescannotsearchdunklepiggyspersonmonday...

Giant Word Search for ESL 6th Grade (1st Version) 2026-02-02

120 Items: hotsadredMayeggcoldcoolbusyfinegoodsickmathstarbluepinkfallJuneJulycornnutsbeefporkfishHellonightsunnyrainysnowyhappysorrytiredmusiccrossheartgreenblackwhitebrownMarchAprilapplebeanslemonmangomelononionpeachcloudyMondayFridaySundayhungrysleepycirclesquareyelloworangepurplespringsummerautumnwinterAugustbananacarrotcherrygrapesorangepotatotomato...

120 Days Wiser, Loved and Luckier 2026-03-01

120 Items: OWLREDAvaLESSWORKFEETLOVEHUGSEvieMilaYusiRyanGOLDLUCKHARPMYTHSTEWWISHFIRSTTOOLSBIRDSBEAKSWINGSMACAWEAGLEHEARTCANDYSMILECARDSMollyScoutBriarJamesAnayaWalshGREENCOINSTRAPSMAGICCLOGGDANCEFEASTJOLLYSTORYOCEANSEXTENDSHAPESMIDDAYSUNSETPARROTFALCONHERONSAndrewAdrianVioletAngeloDanielWallisIzzaraCLOVERFIDDLELEGENDPOTATOSPRINGCLOVERGREATERSORTINGSUNRISE...

TEB 2.8C 2023-04-12

37 Items: fritépicéfarcil'eaucréolel'aidedepuispolluerdétruithaïtienun crabeun lambiun puitsla terreune morueun rougetinstallerremplacerdes accrasles amandesles secoursune crevetteune langousteune brochetteune spécialitéêtre chargé dela canalisationune source d'eaule ravitaillementla reconstructionrendre un serviceles premiers soinsun tremblement de terre...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Ancient civilizations 2025-06-08

27 Items: SPQRMoanaOldestAlexanderBig Heads5th monthPunic WarsFrom TurkeyChandraguptaIlliad heroesHorn of AfricaHanging gardensWalk like an...Big wooden horseBoston basketballformer name of IranPost Alexander IranWess Anderson movieThe month after Springhorrible at a video gameEverything is made thereTheseus killed a bull personFrench colony in West Africa...

Reading Word Search 2025-09-04

107 Items: REDEYEEARARMLEGRUNMAPSKYSUNHOTDOGCATHEROBOSSKINGFILMSONGBLUEFACEHANDFOOTBODYFOODSWIMJUMPWALKMOVELAKEMOONSTARRAINWINDCOLDCOOLBIRDFISHLIONBEARTREEHOMEROOMMOVIEMUSICDANCESTAGECOLORGREENBLACKWHITEPHOTOSMILEMOUTHFRUITWATERSPORTDANCEHOTELRIVEROCEANSUNNYRAINYTIGERHORSESNAKEHOUSELEADERPRINCEYELLOWCAMERAHEALTHTRAVELTICKETFORESTSEASONSPRINGSUMMERAUTUMNWINTER...

April theme for journal 2026-02-06

22 Items: 420EasterTaxDayRenewalThis monthQuote theme____ CleaningNephew turns_____National holiday?Theme of this monthGiven out at holidaysFor the flowers to growJesus goes up to heavenOne of the flowers i hand drewSacrificed himself for our sinsBlossoms in the springtime in JapanThe first of the month (non religious)Jesus did many miracles in this chapter...

Sussing out the Freeport Seuss 2026-02-05

20 Items: Our mascotTheodor GeiselMr. Brandt's slangThe Spring musicalLet's make this...Where the Whos liveHow Mr. Stell studies"Everybody needs a..."Our broadcasting networkMidway mental health dayBut let's make that our...Mr. Cooper's favorite bandWhat thneeds are made out ofSam-I-Am learns to love theseFreeport's favorite gas station...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

How well do you know me? 2025-03-28

23 Items: My last name?My eye color?Dogs or cats?Marvel or DC?My first name?My middle name?My sisters name?My schools name?My favorite color?My favorite season?My favorite animal?My 1st brothers name?My 2nd brothers name?Month of my birthday?Sport I used to play?The day of my birthday?What number car am I on?Where was our first date?...

Simple Present Word Search! 2025-04-19

20 Items: My aunt ______ to work.It ______ a lot in April.His mom ______ dinner at 6.I ______ breakfast at 7 a.m.Her cat ______ on the couch.The dog ______ at strangers.We ______ movies on weekends.Your sister ______ very well.You ______ to school every day.Tom ______ math in the evening.They ______ soccer after school.The teacher ______ on the board....

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Fly High 3 2026-05-05

113 Items: upshymapArtskiMaysunbuyauntflagtaximeatleafshowbirdlateJuneJulyrainsnowwindcooktalkmakewashdishropewaitmovestopunclecreamshirtsmileplanemoneyMathsalbumpandaearlyMarchAprillearnboredfloortastechasethiefbravefightswingtowelargueAfricacousinFranceGreececheesedinnerTurkeyshortsticketMondayFridaySundayletterparcelwintersummerspringautumnAugustcinema...

Para Empezar Buscapalabras 2024-08-19

50 Items: MaypeneyelegJuneJulyhandfootheadMarchAprilpaperHelloMondayFridaySundayAugustpencilfolderWinterSpringSummerfingerTuesdayJanuaryOctoberstudentGoodbyestomachThursdaySaturdayFebruaryNovemberDecembernotebookAnd you?WednesdaySeptemberIt's coldIt's cloudyIt's rainingIt's snowingFall (Autumn)See you laterGood afternoonteacher (female)Good morning/day...

Dave's Faves ( A 90-year-old knows what he likes.) 2025-06-19

14 Items: What does Dave drive?Who is Dave's trophy wife?What is Dave's fave entree?What is Dave's best feature?What does Dave play music on?What is Dav's favorite treat?What does Dave play every day?What is Dave's fave casserole?What is Dave's drink of choice?Who does Dave root for in spring?Who is Dave's favorite furry girl?...

Greek Gods 2026-05-26

16 Items: Ares-God of warNyx-Goddess of nightCirce-Goddess of magicHades-God of underworldHera-Goddess of marriageHestia-Goddess of the hearthPersephone-Goddess of springAthena-Goddess of wisdom and warAphrodite-Goddess of love and beautyHermes-Mischief, trade, wealth, languageArtemis-Goddess of the hunt and the moon...

Garrett’s Christmas 2025-12-08

19 Items: ur dads nameur last nameur moms namebrother in lawname of the dogur favorite colorworks at CHTM and CNTplayed in the springMLB team that we likedelegation we play withhockey played in the winteraids wear them to help u hearfood bank where u volunteer atthats in June July and AugustMilb team that we go to watchworks at the Albuquerque Ambulance...

MENTOR 2026-04-14

1 Item: Spring

Spring Word Search 2025-04-12

1 Item: spring

trs23 3b w13 2023-05-11

15 Items: MRT.Happy.Not interesting.Really don't like.Place to watch a movie.A place for someone to sit.I write a ___ to my friend.A place to get on a bus or train.Books are ___. You can learn a lot.A lot of musicians playing together.The box is ___! Who ate all my cookies?Spring, summer, autumn/fall and winter....

trs23 3b w13 2023-05-11

15 Items: Happy.Not interesting.Really don't like.Place to watch a movie.MRT / underground train.A place for someone to sit.I write a ___ to my friend.A place to get on a bus or train.Books are ___. You can learn a lot.A lot of musicians playing together.Spring, summer, autumn/fall and winter.The box is ___! Who ate all my cookies?...

may 2025-05-01

5 Items: the season after winter and before summera hobby involving plants, crops, and flowersthe start of new beginnings, the process of changea word representing what you've learned and done, and what its changed for yougreek goddess of nature and growing plants that influenced the month of may was named after

Word Search Level 3 2023-10-19

2 Items: ugly funsummer autumn spring sunny windy rainy cloudy hot cold warm cool cute scary difficult interesting boring delicious disgusting

March 2025-02-26

124 Items: AWEJOYNEWNOWTRYWAYGROWBODYCALMCAREDRAWFEEDGLOWGOALGROWHEREHOPEKINDLEADMAKEMINDMOVENOTEPATHPLANROOTSEEDSLOWSOFTTENDTESTTIMEWARMWORKBEGINBLOOMBUILDCRAFTDAILYDREAMFAITHFOCUSFRESHGREENGUIDEHABITLEARNLIGHTMAGICPEACEPLANTREACHRENEWSHARESHINESKILLSTARTTEACHTRACKTRUSTWATERWHOLEWRITEBRANCHBRIGHTCENTERCHANGECREATEEFFORTEVOLVEEXPANDEXTENDFOLLOWGARDENGENTLE...

test4 2025-03-13

125 Items: FUNNEWOLDTRYCALMCOZYDESKEASYEDITFLOWHOMELISTMAKENOTEOPENPLANPLAYPREPSORTTIDYBEGINCLEANCLEARENJOYFOCUSFRESHLIGHTORDERPEACEQUIETREADYRELAXRESETSHIFTSPACESTARTTRACKTWEAKADJUSTBRIGHTCENTERCHOOSECORNERCREATEDOODLEREDUCERHYTHMSELECTSIMPLESPRINGSTEADYUNWINDUPDATEWINDOWARRANGEBALANCEBREATHECLARITYCOLLECTCOMFORTEXPLOREHARMONYIMPROVEINSPIREJOURNALMINDFUL...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

Quintus' word search 2023-12-19

20 Items: our galaxyglow on it ownpeople draw linesknow as big dippera icy and gassy balllight bounces off itknow as small dipperthe research of spacelook like a big spoonbelief in constellationlook like a small spoonpeople that go into spacefirst day of spring or fallsomething that orbit the sunfirst day of winter or summerwhen a space rock reach earth...

SPRING 2026-03-29

1 Item: FLOWER BIRD GREEN GRASS BUTTERFLY RAIN RAINBOW STORK FROG

Unit 6 : Las Compras 2026-04-08

50 Items: bighat1hat2coatFalllongshirtdressskirtpantssocksshoesmoneystoresmallshortjacketjeans1Jeans2shortsblouseSummerWinterSpringmediumTo putTo buyshouldgarmentt-shirtseasonsTo wearTo haveclothingIt’s hotIt’s coldTo preferIt’s sunnyIt’s sunnyIt’s windyIt’s clearCredit cardIt’s cloudyBathing suitIt’s rainingIt’s snowingTo want/loveIt’s necessary...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

Seasons 2024-03-31

12 Items: The hottest season of the yearTrees shed these during autumnFlowers bloom during this seasonFarmers gather crops during this seasonFlowers open up and bloom during this timeEach one is unique and falls during winterWhat falls from the sky during rainy seasonsBright, warm rays often associated with summer...

spring 2023-07-26

1 Item: bee sun flowers butterfly leaf

On the Move! Animal Migration 2024-11-06

10 Items: To go from one place to anotherTo stay alive, even in hard conditionsA very large number of things or animalsWhat animals and people eat to stay aliveAnimals with feathers and wings that can flyA word to describe when temperatures are higherLiving creatures, like birds, fish, and mammalsSmall creatures with six legs, like ants and butterflies...

Vocabulary Surge Week 8 Word Search 2026-05-01

10 Items: The ________________ sped down the highway.She made great ______________ in reading this year.Our trip to the mountains was a fun ________________.The cat stayed ______________ while watching the bird.Without practice, his skills may ____________ over time.Please ___________ your shoes before entering the house....

Elbolígrafo Word Search 2023-02-13

51 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustpleaseseasonwinterspringsummerteacherTuesdayJanuaryOctobernotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotclassroomWednesdaySeptemberhow many?It's coldIt's sunnyIt's windystudent deskIt's rainingIt's snowingfall, autumnteacher(female)...

April/Spring word search 2026-04-01

2 Items: Aprilfools

Groundhog Word Search 2025-02-02

16 Items: An animal’s feetA space in the groundA long sleep in winterThe cold season with snowA hole where animals liveWhen the temperature is lowThe season when flowers bloomA prediction about the weatherThe soft hair on an animal’s bodyThe bright star that gives us lightHow hot, cold, rainy, or sunny it isFrozen water that falls from the sky...

unit 2 wk 3 2025-12-13

8 Items: To intensely admire a person.Wild, noisy disorder or confusionIn an unfortunately, unhappy or very bad state.To move with a slow, shuffling, awkward gait. TTo suddenly spring or flinch back in fear, horror, or disgust.A short period of rest or relief from something difficult or unpleasant....

Peranakan Food 2025-03-09

8 Items: Spicy coconut-based noodle soupsiam Vermicelli noodles in a tangy and spicy gravySpiced fish paste wrapped in banana leaves and grilledbuah keluak Chicken braised with unique buah keluak nutfried rice Fragrant fried rice with Peranakan-style spicesulam Her-innfused rice with shredded vegetables and spices...

Pg. 39 2026-06-10

15 Items: comes from treesa groundwater sourcenot planned in advancea surge of water pressureavailable amount of somethingcommunicate info using a radioend of a rope used to tie a knota large container for holding waterthe condition of being fully in placedevice placed over the end of a suctionthe level of groundwater under the Earth...

Energy Review Word Search 2025-05-12

9 Items: Energy possessed by hot objects.Form of energy possessed by moving objects.Energy stored by doing work against a force.Energy stored in chemical elements and compounds.A way energy is transferred in the form of sound.A way to transfer energy using an electric current.Energy stored by lifting an object against gravity....

VocabMan 2 2024-09-17

63 Items: inpendaymayhotbookyearweekjunejulycoldfallmonthtodaymarchaprilwindyfolderpencilmondayfridaysundayaugustpleaseseasonwinterspringsummertuesdayjanuaryoctoberhowmanyrainingsnowingnotebookthursdaysaturdayfebruarynovemberdecemberHacesol.classroomtommorrowwednesdayseptemberyousay...itmeans...studentdeskwhatdayisitLaestudiantestudent(male)teacher(male)...

Camille & Keegan 2025-03-19

30 Items: Couples Alma materCouple’s next tripKeegan’s professionCity Keegan is fromCouple’s first tripCouples church homeKeegan’s birth monthCamille’s professionKeegan’s middle nameCity Camille is fromKeegan’s High schoolCouples’s first dateMonth Keegan proposedCamille’s middle nameHoneymoon destinationCamille’s birth monthCamille’s High school...

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Present Simple Word Search 2025-11-03

15 Items: I ________ (to have) a big family.She ________ (to go) to school by bus.You ________ (to like) pizza, correct?It ________ (to rain) a lot in spring.My dad ________ (to work) in an office.The professor ________ (to teach) math.We ________ (to eat) eggs for breakfast.They ________ (to live) in a small town.She ________ (to read) a book before bed....

How Well Do You Know Us/Me? 2026-05-14

21 Items: My favorite foodMy favorite fruitMy favorite seasonFirst date locationMy favorite TV showMy favorite F1 teamMy betta fish's namee month I was born inOur future dog's nameWhat's my middle name?What color are my eyes?What are my dog's names?Am I a cat or dog person?What soda is my favorite?My favorite day of the weekOne of our favorite restaurants...

Ocean Word Search 2025-03-28

10 Items: Bright yellow ball in the sky.Overall the most popular shark.Largest bodies of water on earth.You know! Never believe it's not so!Activity that requires a long, narrow, board.Winter, Fall, Spring....what's missing again?A beautiful place near Florida and The Bahamas.Shark that well.... has a head that looks like a hammer....

Plant Puzzles: Find the Hidden Flora 2024-07-19

10 Items: A plant with feather-like leavesA classic flower associated with loveA large tree known for its strength and longevityA tree known for its distinctive leaves and syrupA spring-blooming flower with a cup-shaped blossomA plant adapted to dry environments with spiky stemsA fast-growing plant used in construction and furniture...

Groundhog Word Search 2026-01-19

10 Items: - a guess about what will happen next- the cold season with snow and short days- a hole in the ground where an animal lives- the bright light in the sky that makes shadows- something people do every year in the same way- to do something special for a holiday or event- a dark shape made when something blocks the light...

Class VII Water 2025-03-30

15 Items: The sun’s heat causes evaporation of water into vapour.When the water vapour cools down, it condenses and forms clouds.Oceans contain 97.3% of the total water on Earth, which is mostly salty.The rhythmic rise and fall of ocean water twice in a day is called tide.The major sources of fresh water are rivers, ponds, springs and glaciers....

Petal Word Search 2025-12-10

18 Items: – When a flower opens.– A flower before it opens.– Small purple woodland flower.– The colorful part of a flower.– Tall flower that follows the sun.– White, fragrant evergreen flower.– White petals with a yellow center.– Exotic flower often found indoors.– Spring flower that grows from a bulb.– Another word for a flower in full form....

Homograph 2025-09-04

20 Items: A season / To jump upNot heavy / BrightnessTo guide / A heavy metalLine of seats / To argueTo bend / Used with arrowsA small clock / To look atDrop from the eye / To ripGreen area / Place your carA container / To be able toA stage drama / To have funA bird / To bend down quicklyHealthy / A deep hole for waterA game / Something to light fire...

Watercycle Word Search 2025-12-17

29 Items: bends or curves in a streammaximum load a stream can carrywater within the zone of saturationcourse the water in a stream followsnaturally formed underground chamberupper limit of the zone of saturationunending cycle of Earth's water supplyslope or steepness of a stream channelarea where water fills all pore spaces...

Aaron Word Search 2024-09-03

73 Items: MeOTSOrbSrlYouModsGuysBabyDanaDaveSormFarmjackSprayBocksTowerHeHowRiverPtreeRealmSwockMelonsFUCKERSpringTraceyFasterLinmanPhaserSorm'sTrenchAtlantaChromerFramingGluemanHatreonHuntersPodcastRealmerof LarryChemicalFabriciaMeMoreTVWilliamsWagstaffSkelCorpBeastingAndersonCurtainsCivil WarBleichnerNewsWorldQuikLinksTeaseballTurkeymenBong GamesStephenson...

WEEK 1 SPELLING SEARCH 2026-04-06

20 Items: MORE THAN ONE OXTO SEIZE OR CAPTUREWITH THE EXCLUSION OFUNABLE TO DO SOMETHINGA REFLEXIVE FORM OF ITA SPRING OR SOURCE OF WATERA CHILD WHO LOST BOTH PARENTSFREE FROM DOUBT OR RESERVATIONFREE FROM IMPERFECTION, COMPLETEA VISIBLE IMPRESSION OF SOMETHINGEAST OR WEST ON THE EARTH'S SURFACEA SENTENCE IN AN INTERROGATIVE FORM...

Spanish Vocab 2026-04-10

51 Items: bigcoatfalllongshirtdressskirtpantsmoneysocksshoesstoreshortsmallhat(1)hat(2)jacketshortsblousesummerwinterspringmediumto putto buyshouldclothesgarmentT-shirtseasonsto wearto havejeans(1)jeans(2)It's hotIt's coldto preferIt's windyIt's clearcredit cardIt's cloudybathing suitIt's rainingIt's snowingto want/loveIt's sunny(1)It's sunny(2)...

Seasons and Tides 2024-01-11

12 Items: The direction the Earth spins.Earth's only natural satellite.Tides produced during quarter moons.Type of light that hits Earth at an angle.Tides that produce higher high tides and lower low tides.This is what the Earth rotates on; also called it's tilt.Type of light that hits Earth straight on with more energy....

Hempstead: Word Search 2025-10-07

3 Items: Hempstead: Great Neck, Manhasset, Port Washington, Roslyn, New Hyde Park, Manhasset Bay, Hempstead HarborFreeport, Garden City, Rockville Centre, Merrick, Valley Stream, Bellmore, East Meadow, Jones Beach, Eisenhower ParkBay: Bayville, Brookville, Glen Cove, Oyster Bay, Farmingdale (partly), Massapequa, Sagamore Hill, Cold Spring Harbor

The Final Countdown Word Search 2026-05-14

12 Items: The dictionary definition of a wordThe season after spring and before fallplace many people visit to swim and relaxA character who changes throughout a storyA reference to another text, person, or eventThe sequence in which events happen in a storyWords or phrases that appeal to the senses in writing...

The Fir Tree pgs. 75-81 2023-11-17

18 Items: I _____ my life.Who came with an axe?What season is it now?Who took the tree outside?Where did the tree burn in?What couldn't the tree move?Who stopped visiting the tree?But it was too late for ____ now.What color were the tree's branches?What did the gardener to the Fir tree?How did the tree feel in the dark room?...

March 2026 Wordsearch 2026-02-18

20 Items: a light gentle windthe state of floweringa brief period of rainmoderate heat in the airdirect light from the sunto begin growing from a seeda colored segment of a flowera new shoot growing from a seeda field of grass and wildflowerssweet liquid produced by flowersprecipitation in the form of raina plant embryo capable of growing...

PHILLY MTCC Word Search - Cycling 2024-01-16

32 Items: PowerBike SeatWho We AreCycling TopLeft BehindCycling RaceGroup Of CogsFollow The...100 Mile RideWheel To WheelBike’s BackboneMountain ClimberBring Up The RearHow Much You ClimbCorrect PositioningSuspenders/OverallsFrench Water BottleRotations Per MinuteLoop Of Roller LinksAt Home Training ToolSpring Training EventHow Fast You Are Going...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

Draft of Game for Gala 2024-01-16

33 Items: PowerBike SeatWho We AreLeft BehindCycling TopCycling RaceGroup Of CogsFollow The...100 Mile RideSlow Bike DownWheel To WheelBike’s BackboneMountain ClimberBring Up The RearHow Much You ClimbCorrect PositioningFrench Water BottleSuspenders/OverallsRotations Per MinuteLoop Of Roller LinksAt Home Training ToolSpring Training Event...

January Word Search 2024-08-18

30 Items: Proposal MonthTracy’s CollegeTracy’s hometownTracy’s first carRobert’s hometownMonth of First DateTracy’s middle nameTracy’s favorite dogTracy’s favorite showRobert’s favorite fruitRobert’s middle name(s)Robert’s favorite snackTracy’s favorite seasonTracy’s favorite dessertRobert’s favorite seasonRobert’s favorite dessertMake of Robert’s first car...

Tourism in Rotorua #2 2025-07-11

20 Items: Rotorua iwi central to Māori tourism.Land shaped by both people and nature.Places for tourists to stay overnight.Māori value of hospitality to visitors.Customs and rules shared with tourists.Turning culture into tourist attractions.Museum in a historic Bath House building.Area where many tourist sites are grouped....

o 2025-10-19

1 Item: SUMMER AUTUMN WINTER HOT WARM COLD FREEZING

MAG1 NFS Unit 7 Review 2026-06-16

19 Items: Air that moves.A tool to measure rainfall.Swirling wind storms on land.One of four times of the year.A strong storm with lots of snow.A scientist who tells the forecast.A word to describe the air outside.A chilly season with falling leaves.The coldest season with lots of snow.Low temperature, usually during winter....

Spring Word Search 2026-03-11

1 Item: tulip roses deer spring trees grass birds

Lesson 19 2023-04-18

1 Item: king string ring wrong song wrong tongs

Je vais à... 2025-09-26

16 Items: my neighborhoodQuand je nage je vais à la...Je suis malade(sick), je vais...Quand il fait beau je vais au...Quand je lis(read) je vais à la...Je vais à Spring Valley, je vais au...Quand je regarde un film je vais au...Quand je mange des crêpes je vais au...Quand je prend le train je vais à la...Quand j'achète un parfum je vais à la......