sport Word Searches

Welcome to the Team 2025-06-26

23 Items: This person has published a book. (5 letters)I ride a Nija 650 sport Motocycle. (11 letters)Currently training for a Half-Ironman. (7 letters)The office's biggest Ottawa Charge fan! (4 letters)A transplant from the Northwest Territories. (7 letters)Went on a 7-day jungle safari in the Serengeti. (6 letters)...

Pizza Word Search 2026-05-09

20 Items: Name of bride's catCity bride lived inGroom collects theseBride collects theseGroom's favorite foodGroom's favorite teamGroom's favorite cityGroom's favorite bandBride's favorite bandHoneymoon destinationGroom's favorite sportGroom's favorite drinkGroom's favorite movieBride's favorite hobbyBride's favorite movieBride's favorite drink...

6th Grade Unit 1 英単語復習 2026-06-29

25 Items: 教科野球理科社会国語英語書道黄色8月1月5月食べ物バレー誕生日11月スポーツ泳ぐこと踊ることお気に入り料理すること得意 I'm ____ at singing.I'm _______ Okayama, Japan.

Cool and New Word Search 2025-01-03

17 Items: #1's #8Type of gunThe true #1#1 in FrenchAllergy to #1#1 in Italian#1 in Turkish#1 in SpanishCommon in sushiRed fruit flavoring49-51% of my fursonaDemoted in Ovenbreak#8 if it was a sport#1, battered and friedAquatic buggish thingsTreasure in Clam WatersAssociated with this symbol

Unidad 5A.2 2023-04-28

28 Items: socatdogtripsportto openweekendme(dop)to rideactivitysuitcaseus (dop)practicebookstoreyou (dop)every dayto play sportsto take a tripfirst (adverb)a little (bit)them, you (dop)them, you (dop)to take, to carryto pack a suitcaseher, it, you (dop)him, it, you (dop)viene upcoming, nextto call, to telephone

EVA 2026-02-05

13 Items: ton signeune part de toiune belle qualitéton côté bad bichecomment je te trouveun concert incroyableune passion aquatiqueun sport que tu lis bienun nouveau numéro favoriun endroit que tu adoresnos débriefs post soiréenous deux face à nous deuxun accessoire prisé (style et pratique)

Guliver 2022-10-18

84 Items: carmorerukenogegladvodagradhramotokoraodaskakopnoobalakonopglavadesnoljudistrahhranalanacsportvladaporazbijegoceankraljizletzemljalijevomalenitijelocaricavojskaobranastranamjeseczalihehodatidivovikositidijeteguliverpijesakvezanjeliliputvrijemeslobodaigranjenagradastrategsavjetivijestibrodovimornarikapetanseljacibrinutiplatitistijenaengleskabrodolom...

Marisa Shick:¡Qué chévere! 2e Level 1 Unidad 5A.2 2023-04-24

28 Items: socatdogtripsportto openweekendme(dop)to rideactivitysuitcaseus (dop)practiceyou(dop)everydaybookstorefirst(adverb)upcoming,nextto play sportsto take a tripa little (bit)them, you (dop)them, you (dop)her,it, you (dop)to take, to carryto pack a suitcasehim, it, you (dop)to call, to telephone

All About Mr. Ross 2025-08-22

18 Items: My CollegeMy Son's NameMy Food AllergyMy Hidden TalentMy Favorite ColorMy Childhood FearMy Daughter's NameMy Favorite SeasonMy Hogwart's HouseMy College ActivityMy Favorite DessertMy Favorite Thing on TVMy Favorite Sport's TeamMy Favorite Game to PlayMy Favorite Kind of BookMy Favorite Sport to PlayMy Favorite Thing To Drink...

Pete & Eilis 2024-07-05

7 Items: Where we first metWhen did Pete proposeWho said I love you firstOur favourite dessert to shareWhere did we go on our first dateThe sport both of us are members ofThe first concert we went to together

Penny Word Search 2025-12-18

18 Items: BabyOne cent coinA sweet treatEating outsideSinging snowmanAttractive metalSnakes and lizardsAntonym of outsideSmall hopping animalNot pay attention toBlood-sucking monsterRun away and get freeAnother word for a bugBreakfast food with syrupSmile to show this feelingSmall hopping animal, again!Sport with a fuzzy, yellow ball...

križaljka 2025-10-27

9 Items: najveca zvijezdaboja neba i morabiljka s deblom i granamaokrugli predmet za igru i sportdomaća životinja koja daje mljekostvar koja služi za mjerenje vremenavodena životinja koja pliva i ima škrgeveliki kopneni sisavac s dugačkim nosompečeni proizvod od brašna jede se uz obroke

Fall 2025-11-24

20 Items: SPORTFRUITCANDYLEAVES.LEAF COLORON A HOLIDAYKINGS ISLANDON A HOLIDAYGROWN IN FALLSTARTS IN FALLMADE OF APPLESINVOLVES LEAVESCOLOR OF LEAVES.NAME OF A HOLIDAY.STARTING DAY OF FALLAPPLES OR CRANBERRY'SSTARTING MONTH OF FALLHAVE SOMETHING FALLING OFFBOUNCES WHEN RIPE AND FLOATS IN A BOG WHEN RIPE...

Sports Word Search 2024-09-04

87 Items: MMAgymnetrunbargolfgoalbeamfoultracksportdancerugbyfieldcourtfloorvaultlayuplosercleatBasessoccerskiingjetskihockeydiscussprinthurdlewinnergoaliehelmetjerseySpikesPompomcricketcroquetcurlingshotputhomerunstrikerdefenseoffenseredcardFishingHuntingGetloudStudentAthleteUniformfootballbaseballsoftballtumblingpingpongswimminglacrossediscgolflongjump...

A Word Search 2025-09-19

5 Items: move your body with musicyou can listen to and enjoy.food outside in a park or garden.look at words in a book or story.sport with a bat, a ball, and bases.

Winter Olympics 2026-01-08

15 Items: IceHockeyCeremoniesSkiJumpingAlpineSkiingSpeedSkatingFigureSkatingFreestyleSkiingCrossCountrySkiingTeams race gravity-powered sledHost country for 2026 Winter OlympicsCross-country skiing w/rifle marksmanshipSport combining ski jumping and cross-country skiingAthletes race head-first on small sleds down an ice track...

The Actor Word Search Puzzle 2022-07-29

15 Items: ActorActorActorVideo EquipmentVideo EquipmentWilson's Main JobHenry Loves This AnimalJune Loves Creating ThisWilson Loves To Play This SportVideo Equipment (Use _ As Space)Henry's Main Job (Use _ As Space)June's Favorite Character To Play AsHenry's Favorite Character To Play AsWilson's Favorite Character To Play As...

James Naismith 2025-05-19

5 Items: what sport did he makehow many children did he havewhat country did he go in the armyWhat did he create to protect peoplewhat was his job before making sports

Spanish Vocabulary 5A.2 Word Search 2023-04-25

28 Items: socatdogtripsportto openweekendme(dop)to rideactivitysuitcaseus (dop)practicebookstoreyou (dop)every dayto play sportsto take a tripfirst (adverb)upcoming, nexta little (bit)them, you (dop)them, you (dop)to take, to carryto pack a suitcaseher, it, you (dop)him, it, you (dop)to call, to telephone

Slider Wordsearch 2025-05-05

93 Items: cynmalsagtiechinflowgulpokaypourshinsighslugsmugdavidderekfleshflukegorgejookylatchprizerelicsportbidderbitterbufferdownedgullethealthheymanhoarsehooverlimitspalatequeasytiptoeturretunwrapwaiverboggledcrammeddisgustfreedomobscenequalifystomachwriggleautisticecstaticegonbeltenormousgluttonyheimlichinfamousintentlyopponentpigorinorelevantadvisable...

Mirar/Una/Pelicula Word Search 2025-10-20

20 Items: to eatto runto restto drawto playto drinkto writeto studythe sportto skateboardto go shopinghacer/la/tareathe video gameto read a bookto watch a movieto go for a walkto ride a bicycleto listen to musicto watch televisionto talk on the phone

Megan and Chris 2024-11-17

24 Items: What is Chris' hobby?Where was Megan's first job?What is Chris' favorite food?What was their college mascot?What town did Megan grow up in?What instrument does Chris play?What color are the groom's eyes?What month did they get engaged?Where did David and Eileen meet?What is Megan's favorite tv show?Where is the couple honeymooning?...

Stress Testing Word Search :) 2026-05-28

16 Items: Old photo hueTiny food tridentBread tanning salonRemote's hiding placeA pig who knows karateWikipedia made of treesGets wetter while dryingProfessionally unemployedRetirement's contact sportMint-flavored sink decorationAncient teenage gathering placePancakes with storage compartmentsLaundry's favorite disappearing act...

Flick Wedding 2026-03-23

34 Items: Groom's hobbyBride's first nameHobby Bride enjoysGroom's middle nameHoneymoon destinationColor of Groom's eyesGroom's favorite foodGroom's birthday monthGroom's college mascotBride's favorite colorGroom's favorite sportFirst vacation togetherMake of car Groom drivesBride's favorite cocktailThe month the Groom proposedCountry where Groom was born...

homework 2026-05-20

16 Items: a deala sportskatinggiving a notshut somethinga weird screama deal with ingto .... somethingshutting somethingyour giving a notemean to use but with ingswing your arm and say hiyour doing a weird screamuse a pencil and draw a wordyour using a pencil and draw a wordyour doing swing your arm and say hi

La Misteria en Calle Balmes 2024-10-28

30 Items: hensdogscatsmusicyoungsoccertennisto drawyoungerto readto singbetweenfavoriteneighborpreferedto listenbasketballis pleasinghe or she hasfish (plural)he or she playstrack and fieldhe or she livesoldest or olderleft (direction)he or she prefersright (direction)swimming as a sporthe or she practiceshe or she practices

Canada Mid-Chapter Review - ESLDO/EO 2026-02-18

24 Items: __________Canada's capital__________ province we live in__________Official winter sport__________Official summer sport__________symbol on Canada's flag__________most populous city in CanadaThe charter protects ____________ freedomsCanada is made up of provinces and ______________________Meaning "first" or "original" peoples...

HOLIDAYS VOCABULARY 2023-03-18

20 Items: Located in the area near the sea.A small, simple house made of wood.A portable shelter that is used outdoors.Land that is away from big towns and cities.To move or go up using your feet and often your hands.The act or process of putting things into bags or boxes.Cooking on a metal frame over hot coals or an open fire....

Girlfriend word search 2023-10-17

20 Items: Our songOur gameMy eye colorOur first dateSomething I loveSomething I hateMy favorite colorAre we soulmates?My favorite drinkWhat I want to beMy favorite pokémonGotta catch ‘em’ allOur anniversary monthOur go to coffee placeWhat sport did I play?Our favorite restaurantYou know who else likes…My favorite thing about you...

Hutsons Baseball Word Search 2026-08-31

91 Items: BATMLBMVPOUTRBIRUNTAGWINAPEXBALLBASEBUNTCLUBDECKDIRTFOULGAMEGEARHITSHOMELOSEMITTPARKSAFETEAMWALKCATCHERRORFIELDFIRSTMOUNDPITCHSAVESSCORESLIDESPORTSTEALSEEDSTHIRDTHROWVAULTASSISTBATTERCENTERCLEATSDUGOUTPOPFLYHELMETINNINGLEAGUELINEUPSECONDSTRIKETRIPLEUMPIREATHLETEBASEHITBULLPENCATCHERDEFENSEDIAMONDFIELDERHOMERUNINFIELDOFFENSEPITCHERSLUGGERSTADIUM...

kennon 2026-05-14

25 Items: Who is the chef?Who hates clutter more?Austin’s favorite snack?What city is Austin from?What is the best man’s name?What is Austin’s middle name?What does Kennon do for work?What is Austin’s favorite food?What is their orange cat’s name?What dating app did they meet on?Kennon is absolutely terrified of?Does Austin prefer sweet or salty?...

kennon 2026-05-14

25 Items: Who is the chef?Who hates clutter more?Austin’s favorite snack?What city is Austin from?What is the best man’s name?What is Austin’s middle name?What does Kennon do for work?What is Austin’s favorite food?What is their orange cat’s name?What dating app did they meet on?Kennon is absolutely terrified of?Does Austin prefer sweet or salty?...

newspaper 4 2024 2024-04-25

90 Items: rowseabbqheatrainbooktenthikebeesfrogcrabfairbikeboatyardcookbakejuneparkgamebirdcakefarmbeachoceanplanewavescabinporchtowelcreekgrillskirtpizzamoviesportkiteschalktravelfamilybikinisandalshellscoolerdisneyarcadepicnicsunhatsmoressunburnairportgogglessnorkeltanktopsurfingseafoodpeachestanningcampinghammocksunniesconcertseagullfishingpalmtree...

Ananas Word Search 2025-07-21

88 Items: hradkvětlávaměnapěnaroleřasauchobalíkbaštabazénbufetcihlafackahudbakabelkanálkupónlarvaláskalékařlekcelinkaloďkametlamodelmotormumiemyčkanotesodpadperlapůvodříčkaschodsonarsporttuneluliceananasbavlnabobuledetaildohodahazardhřebíkjabloňklapkalžičkamašinanevěraodměnaplakátpotopapříčkaruletašpičkačásticedědičkafanfáraformulepálenkapozdravpřeklad...

spanish 2025-11-13

28 Items: cardopensclosesalmostto sendthe bankdowntownthe ballthe soapto closethe stampthe letterthe skatesthe shampoothe pharmacythe mailboxesthe golf clubtennis racketto go on footgood graciouselsupermercadothe toothpastethe post officeto cash a checkto take care ofto mail a letterthe sport equipmentthe doctors/dentist office

Sip & Solve 2025-05-04

10 Items: Nate's middle nameNate's favorite cookiePreferred type of proteinThe bride's favorite liquorYears the couple was long distanceThe city Nate and Christina are fromThe city Nate and Christina live nowThe name of their late jalapeno plantWhere the couple's first apartment wasThe sport that both Nate and Christina did

DinoBean Valentines 2026-02-02

11 Items: Where we first metMy favourite animalYour favourite animalWhere we had our first kissWhere we had our first picnicOne of our favourite figurinesMy soft toy who lives with youMy favourite ice cream flavourThe first drink you made for meThe first dessert I made for youA sport we have been obsessed with

Wedding Wordsearch! 2025-07-06

9 Items: The best man's name.Toms favourite sport.Where they got engaged.Bec's favourite animal.The Man of honour's name.Where they had their first date.The best (men's) football team (according to Bec).The best (men's) football team (according to Tom).Who performed the song Bec walked down the aisle to.

Hatcho Elementary School 2025-10-05

15 Items: What animal is Mr. Tomono afraid of?The groups made from all grades are called what?What disaster experience did you do in 4th grade?What is the name of the 5th grade English textbook?What sport did the 5th graders practice in PE class?What famous Toyohashi food did you make in 3rd grade?Teachers read books to students during Story __________....

Ancient Greek Sports 2026-03-30

9 Items: Means 5 sportsGames to honor ZeusWeights used for jumpingPart of the Panathenaic FestivalUsed to throw during the PentathlonTop 2 athletes face off in this sportWhere the Panathenaic Games were heldPrize at the end of the Panathenaic GamesWhere the first modern Olympics were held

Argentina Word Search 2024-02-29

10 Items: Who designed their flag?What is their money called?Who's Argentinas president?What object is on their flag?what color is their flag mainly?Who's Argentinas vice president?What language do they mostly speak?What's the capital city of Argentina?What's Argentinas most popular sport?What is the sun on the flag specifically called?

olahraga 2023-03-15

2 Items: mother of sportolahraga menggunakan kaki salah satunya club PERSIB

OUR SUMMER 2025-09-01

11 Items: not coldafter springlong break from schoolwater activity or sportbig and noisy flying bugsvery hot period of weathergoing to a place for a holidaysandy place to sunbathe and swimwhat teachers give during long breaksbig event with dancing, food, and gamescolorful lights and loud noises in the night sky

sports across the decades 2026-05-22

6 Items: famous baseball playerwho invented the rules of baseballwhen was the first superbowl played688 BCE was the beginning of what sportGreatest player of all time in basketballwhat sports most popular game was called “miracle on ice”

Kalei & Sam 2026-01-22

19 Items: __ Factor.Kalei’s car.Sam’s degreeKalei’s degreeWhere Sam is at.Sam’s dogs name.Kalei’s cats name.Kalei’s Owala ColorOur lingo for joking.Sam’s Starbucks order.One of our middle names.A sports team we watched.Mr. Robot’s main character.Things we watch on YouTube.Kalei’s sport (abbreviated).Things we send each other daily....

olahraga 2023-03-15

3 Items: mother of sportolahraga menggunakan kaki salah satunya club PERSIBolahraga air dan beberapa macam gaya salah satunya gaya dolphin

Portugal Word Search 2026-04-07

6 Items: What sport does he playWhich club made him famousWhat country does he representWhere is Cristiano Ronaldo fromHow many Ballon d Or awards does he haveIn which team did he become a legend and score many goals

Bday Clue Word Search 2026-05-19

12 Items: A local riverHow to cool offMy favorite sportA step up from a tentCasper the friendly ____Main industry in early CANot a place for the livingOne of cardinalndal directionsWe often camp in national ____Where are all the "hidden gems" near usThe location of your final suprise todayWe visited these often when we lived in SF

BrazilShit 2023-12-21

12 Items: Name of CurrencyRanking in economyName of Largest Rainforestname of the country we're inLocation you're at right nowContinent of country we're inCapital of the country we're inThe Country's National LanguageLocation you were previously athow many timezones the country hasBrazil's Most famous soccer player...

Mihaelova bkagdanska osmosmjerka 2022-12-20

15 Items: ukras za borslatko i finovrsta padalinedan prije Božićavrsta božićnog drvcaukras za božićno drvcedjeca ga rade na snjegu"živi na Sjevernom polu"dio snjegovićevoga tijelastvar ispod božićnog drvcasvi ljudi ih jedu na adventuosvojila ga je Argentina nažalostispraćanje stare godine a doček novesport na koji većina ludi ide po zimi...

Sienna's birthday word search 2022-11-03

18 Items: catintelligentsport you loveMan's best friendyou're a great...i love to watch...month you were bornfavourite audio booki love painting my...you make us ..... lotsfor dinner you want...the other cat's name isfavourite person in the worldsometimes i find him annoyingpeaches is otherwise known asanother word for how brave you are......

One Word Search 2024-03-15

18 Items: What is her favourite food to eat?What is Stacey’s favourite colour?What is her favourite sport to watch?What is her favourite alcoholic drink?How many car accidents has she been in?On what day of the week was Stacey born?What is Stacey’s favourite sport to play?What beverage will she not willingly drink?...

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

w 2025-12-04

10 Items: My pet’s nameMy birth monthYour favorite sportOur favorite activityMy favorite nickname to call youa menu we like to order at ROPANGthe place you asked me to be “yours”Where we first glanced at each othera country you really want to go with meOne of our comfort restaurants to go munch

w 2025-12-04

10 Items: My pet’s nameMy birth monthYour favorite sportOur favorite activityMy favorite nickname to call youa menu we like to order at ROPANGthe place you asked me to be “yours”Where we first glanced at each othera country you really want to go with meOne of our comfort restaurants to go munch

w 2025-12-04

10 Items: My pet’s nameMy birth monthYour favorite sportOur favorite activityMy favorite nickname to call youa menu we like to order at ROPANGthe place you asked me to be “yours”Where we first glanced at each othera country you really want to go with meOne of our comfort restaurants to go munch

Our Summer 2025-09-01

9 Items: very hot periodbig, noisy insectswater activity or sportgo to a place for a holidaysandy place to sunbathe or swimbig event with dancing, food, and gamesgiven by teachers for long school breaksperiod when you don’t have to go to schoolcolorful lights and loud noises in the night sky

Sean and Madeline OO 2024-12-16

20 Items: Proposal MonthSean's birth monthMadeline's eye colorMadeline's maiden nameMadeline's middle name?Sean's military branch?City the couple met in?How did the couple meet?State of Sean's college?Country Sean proposed in?Madeline's hometown (3,5)Sean's most dangerous hobbyCountry the couple lives in?Couple's favorite date food?...

Deutsch IV K3M4 Wortsuchsel 2025-12-02

26 Items: veinskillsquatoxygenpush-upmovementto gradeto foundto stealambitiousto run riotjumping jackimmune systemendurance sportto get on nervesclub, association(body's) defensesto cherish, value(blood) circulation)to rampage, run riotto catch (in the act)to wail, whine, bellyacheto compile, arrange, composedisposition, tendency, make-up...

Lacrosse 2024-09-16

11 Items: Is when a player shots the pearl into the goalie net.The stick in which players use in the sport of Lacrosse.Is the player who is primarily positioned in the goal net.Is an illegal move with the use of a player's body or cross.Its the white ball that is used to play the sport of Lacrosse....

Valentines Day 2026-02-14

30 Items: 24.0914.0211.03Animal____ BarFav Fruit_____ BoxBubble O'Dogs (1/2)Dogs (2/2)Video GameFooty TeamAlmost PetCitrus FruitJewelry BrandBottle ColourOlympic SportHair AccessoryKenya & SearchShopping CentreKeeps Room CoolCamp & BachelorsPermanent Flowers1st Stop When HomeBFs Fav Feature **Green Tea Ingredient__________ Vet ClinicFav type of Fav Animal...

Great American Challenge Word Search 2026 2026-04-24

10 Items: Big 3 (14)Magic hands (4)Junior transfer (3)Zach's grandapa name (7)Music festival at TA (9)What Gavin did at La Salle (5)Sophomore Year Dorm (for some) (6)Assistant Coach, first and last name (12)Number of next years new Allen St house (6)What IM sport does Courtney play on Wednesday's at 8:30pm? (10)

HAPPY FATHERS DAY 2026-06-21

16 Items: who’s born 2021your favorite bbqfavorite relax showyour favorite daughtercurrent sport going onis it Spiers or Speirsthe logo of your companyfavorite type of alcoholwhat your amazing being aswho’s the boss of the houseMost likely/ already is famousteam you played for in englandwho did jadin say you sing likeYour granddaughters middle names...

w 2025-12-04

10 Items: My pet’s nameMy birth monthYour favorite sportOur favorite activityMy favorite nickname to call youa menu we like to order at ROPANGthe place you asked me to be “yours”Where we first glanced at each othera country you really want to go with meOne of our comfort restaurants to go munch

Monthly Challenge S 2023-05-19

100 Items: safesamesandsaveseemsellsendshipshoeshopshowsicksidesignsingsizeskinslowsnowsocksomesongsoonstarstaystepstopsuchsureswimscaresevenshakeshallshapesharesharksheepshirtshortshoutsinceskillsleepsmallsmellsmilesnacksnakesorrysoundspacespeakspendsportstandstartstickstillstompstonestorestorystudysweetswingswishschoolscreamsecondsecretshouldsimplesister...

Stress Word Search 2025-04-14

100 Items: BadFunJoySadZenBlueBodyBusyCalmCoolFlowGoodHardHelpLifeTimeWalkWorkYogaAngryExamsGoalsHappyHumanJollyMerryMusicPeaceProudQuietReadyRelaxSpaceSportStudyUpsetVibesWorryCourseEnergyFamilyHealthMemoryMentalNatureSchoolStressStrongTemperUnsureUnwindAnxietyBalanceBoredomBreatheCapableCollegeContentFailureFlowersFreedomHobbiesLessonsLibraryReadingSuccess...

Fiu Word Search 2024-07-27

8 Items: The bride’s maiden nameThe groom was born hereThis is the bride’s hometownThe groom plays this sport oftenThe bride and groom’s favorite foodThis is where the bride and groom metThe first country the bride and groom visited togetherThe amount of years they dated before moving in together

Jonathan & Stephanie 2024-09-30

31 Items: Jonathan's hometownThe wedding hashtagStephanie's hometownStephanie's catch-phraseJonathan’s favorite colorJonathan's drink of choiceStephanie's favorite colorJonathan's favorite cookieThe field Stephanie works inJonathan's preferred airlineJonathan’s favorite NFL teamStephanie’s favorite NFL teamThe full name of their tortoise...

A Search for Us 2025-02-19

30 Items: how we metyou make me soa dog and a drugmy favorite candysomething we losta superior toppingmy seat in the caryour favorite sportMad Jack’s sandwicha couple hobby for usvessel for whipped creamyour least favorite fruitmy favorite sport to watchto save your poor dry facemy recurring injury locationwe’ve watched three of these...

w 2025-12-04

10 Items: My pet’s nameMy birth monthYour favorite sportOur favorite activityMy favorite nickname to call youa menu we like to order at ROPANGthe place you asked me to be “yours”Where we first glanced at each othera country you really want to go with meOne of our comfort restaurants to go munch

RANDOM WORD SEARCH 2023-03-02

100 Items: draftcabinroughsportbearsshootcheapblockbreadadmitbuilderrorensurelayoutthreatbeaverspiderdebatedesireextentigniteabsentburialrotatesuckerignitetrenchstinkychargetrancecattletextureconfuseimpulsebiologymusicalluggagerummagereversegesturehallwayinstallvoicingpreventprosperwaitingcontextsuspectmassivebuscuitdilemmavillainsavingsfactorycollectprogram...

Reception 2023-10-22

23 Items: First dateAustin's jobKaitlyn's jobWho is older?years togetherour cat's nameTown of first homeAustin's first namecouple's dog's nameAustin's birth monthname of the best manKaitlyn's middle nameKaitlyn's birth monthKaitlyn's maiden namewhere did he propose?Austin's favorite sportour nontraditional petsnumber of months engagednumber of total siblings...

Vwo 1: Unit 2 2025-02-21

102 Items: ACTBUYCANDAYEATEGGFITHATTIECOATDISHDRAWHOURLAMBMAINMEALPASTPLAYREADSHOESIDESINGSIZESOCKSUITWEARYEARAPPLEBREADCLOCKDAILYDAIRYDANCEDRAMADRESSFRUITJEANSLUNCHMATCHMONTHMUSICNIGHTORDERPAINTPANTSSCARFSERVESHIRTSKIRTSPORTWRITEBAKINGBLOUSECARROTCHEESECHOOSECINEMACOOKIEGAMINGJACKETJUMPERLISTENMINUTEMOMENTMOVIESOUTFITPOTATOSHORTSTOMATOWEEKLYBISCUITCENTURY...

Les 100 jours 2025-04-12

100 Items: artmotamicentfêtejourdéfirirelirerirephotoécolestylogommerèglelivrecollepairemathssportélèvedrôlejouermimercréeréquipepuzzleballongâteaubougieclassecrayoncahierbureauchaisecasierpoésiedictéecalculprojetexposéphrasemaîtrejoyeuxcolorérigologénialmotivécollercourirécriresauterlancerdansergagnerdiplômefresquesouriretableautroussefeuilleciseauxhorloge...

Sarah & Ben 2025-05-18

21 Items: bride's jobgroom's jobbest man's namecouples dog's namehen do destinationstag go destinationbride's middle namegroom's middle namemonth we got engagedhoneymoon destinationmaid of honour's namename of couples housegroom's favourite drinkbride's favourite drinkwhere did we get engagedcouple's favourite sportcouple's first abroad holiday...

klg 2024-11-09

5 Items: TeamwAn athlete trains rigorously to excel in their sport.Endurance is key for long-distance runners to finish strong.The champion celebrated their victory with a triumphant smile.The referee made a crucial call that changed the game's outcome.

Josh Birthday Word Search 2025-11-27

8 Items: Your last nameYour mom's nameYour birthday monthThe blue hedgehog with speedy powersYou like to watch this with popcorn and candysport you play with sticks, helmets, and, pucksYour favorite football team out of Green Bay,WisconsinSpecial Olympics team you play with. Coach Dooley is the head of delegation

Liigajoukkueet ja SaiPan pelaajat 2025-2026 2025-05-04

38 Items: #30 Kari#50 Saku#10 Otto#27 Samu#25 Emil#57 Otto#62 Miro#81 Eero#7 Samuli#22 Karri#46 Peetu#18 Juuso#19 Lenni#51 Antti#70 Janne#82 HenriMikkelistäPorilaisetOululaisetKouvolasta#6 Santeri#55 Ondrej#21 Niklas#41 Maxime#75 PatrikRaumalaisetTurkulaisetLahtelaisetEspoolaisetVaasalaiset#31 GustavsKuopiolaisetJyväskylästäHelsinkiläisetHämeenlinnasta...

Word Search 2025-12-02

100 Items: SkyDogCatCarSunTeaIceArtGymTreeStarFireLeafBookDoorBirdFishMoonRainSnowWindSandRockSoilSeedMeatMilkSaltSoupCakeFilmGameTeamMallCityTownAppleRiverOceanCloudChairTableLightGrassHorseTrainStormEarthFruitBreadWaterJuiceSugarSpiceSauceSaladCandyMusicDancePaintColorSportCoachFieldCourtClassStoreWorldWindowShadowFlowerRocketPlanetCoffeePepperCookiePlayer...

Coach Word Search 2026-04-15

100 Items: NETOUTLOSEFoulTEAMBESTFIFAChipSaveGOALSHOTTRAPCOACHBENCHSPORTPitchMatchSOCKSSHORTSPAINSCARFSTARTFINALGRASSSHOOTRULEDMEDALCrossWINNERASSISTJERSEYSOCCERPLAYERTROPHYCORNERTackleHeaderCleatsVICTORYDEFENSEDRIBBLEOffsidePLAYOFFRIVALRYSTADIUMRedCardSTRIKERPenaltyWHISTLESCORINGPassingOWNGOALENDLINERefereeUniformKickoffThrowinFOOTBALLRUNNERUPFAIRPLAY...

Sip & Search 2026-03-18

34 Items: Bride's first nameHobby Bride enjoysGroom's middle nameHoneymoon destinationColor of Groom's eyesGroom's favorite foodGroom's birthday monthGroom's college mascotBride's favorite colorGroom's favorite sportMake of car Groom drivesBride's favorite cocktailGroom's profession (abbrv.)The month the Groom proposedCountry where Groom was born...

Word List 1 2026-05-18

7 Items: ___________ One full time around___________ The sport of running___________ To run as fast as you can___________ To get better from injury or illness___________ The act of exercising to become healthy again___________ Surprised because someone is very good at something...

Vocabulary Week 21 2025-05-05

5 Items: A car with 2 doorsThe company that makes a carA car with 4 doors and a trunkA type of car that is made by a companyA sport utility vehicle that is larger than a traditional car

Chiaka Ogbogu 2026-02-23

11 Items: her last nameher first namesport she playedher name means God ____where did she go to collegewhich g is silent in her namewhen a player starts the volleywhen you hit the ball with your forearmsbiggest athletic competition in the worldwhen a player sets up another player for a strikewhen a player hits the ball while jumping in the air

Physical Activity 2026-04-24

19 Items: Outdoor spaceBad consequencesGood consequencesActivity with rulesrules and regulationsYoung people aged 13-17The state of being activePeoples views and beliefsChanging physical positionpaid position of employmentMāori holistic view of healthmore opportunities than othersless opportunities than othersA result of something happening...

Welsh Wordsearch 2025-04-29

15 Items: A Welsh HugA Hearty Welsh Stew"Thank You" in WelshWelsh name for SwanseaSymbol on the Welsh FlagNative Language of WalesNational Flower of WalesScenic Views near SwanseaThe Patron Saint of WalesCoastal Village in SwanseaThe Most Popular Sport in WalesThe River that runs through SwanseaThe Campus where The College is based...

Leo Lens: The Monthly Challenge 2025-08-30

10 Items: Capital city of Sri LankaMost popular sport in the countryLocal currency used for transactionsStaple food grain grown in paddy fieldsOfficial language spoken by the majorityTropical fruit used in many local dishesTraditional system of medicine and healingFamous Ceylon export grown in the highlandsNational animal often seen in wildlife parks...

A Fun Word Search 🤩🤩🤩 2026-06-13

11 Items: English or Spanish?A province in ThailandTryta gettin’ strongerA country, not far from here(v.) to study a lot (KVIS slang)The most wonderful dish ever createdThe highest area of the mountain rangeA good source of protein, unique to KVISAnother favorite subject of พี่รหัสน้องคิดดีOne of the favorite subjects of พี่รหัสน้องคลัง...

Denton Word Search 2025-06-23

15 Items: Lexi's Middle Name?The City They Met In?The HS Nick Attended?The HS Lexi Attended?The Breed of Their Dog Henry?The Month They Started Dating?What Month is Lexi's Birthday?What Month is Nick's Birthday?What is Lexi's Favorite Movie?Their Favorite Ice Cream Brand?What are Lexi's Brothers names'?The City Did They Went To College?...

The Olympics 2025-02-27

15 Items: a country’s official songsomeone who is in the same team as yousomeone who competes in sports competitionssomeone who has won a medal in a competitionto achiehe best result in a sport, competition, etc.fair, honest, and polite behavior in a sports competitiona small platform on which someone stands in front of an audience...

Word List 2026-06-08

14 Items: __________ the sport of running__________ to say something loudly__________ when your face turns red__________ belongs to you not shared__________ to run as fast as you can__________ one full time around a track__________ to move shoulders up and down______________ hard and not easy to move__________ to not listen or pay attention...

Tam & Steven 2025-05-23

18 Items: Bride's first jobGroom's birth monthWedding cake flavorMaid of honor's ageWhere the couple metThe groom's eye colorGroom's favorite drinkThe bride's birth monthThe couple's middle nameGroom's favorite NFL teamBride's father's nicknameFirst plane ride togetherThe state the groom is fromMonth the couple got engagedThe name of the couple's dog...

Final Revision 2024-04-22

78 Items: ledmíčhračasmítdvatřipětosmbýtlyžehrátobědrybakolostůlzubyšestsedmčístspáttaneckartahudbajednačtyřidevětdesetknihadělatkopanáklavírhodinyvečeřepostelsbíratkomiksnácvikchytitsprchapřítelplavánípočítačpoplachautobusploutvesnídaněmít rádnástrojčasopisodznáčkylyžovánípracovatposlouchathra s pukemdomácí úkoldomácí prácepříčná flétnaskupina hráčů...

Volleyball 2025-09-14

20 Items: A serve that lands untouched for a pointMen’s team that won the 1976 Olympic gold medalThe men’s net height in volleyball is 2.43 metersDefensive move at the net to stop an opponent’s spikeNation that dominated women’s volleyball in the 1990sCity and year where volleyball made its Olympic debutPlayer responsible for attacking the ball over the net...

Looking for Alaska 2025-03-10

8 Items: Pudges roommateSimón Bolívar last wordsWhat sport was played in the fall?Who was Alaska's roommate going to be?Something Pudge counts when he is close to Alaska.What holiday did Pudge and Alaska stay on campus for?Where Pudge's parents were going during Thanksgiving.What happens to Pudge during their triple and a shelf date?

r-controlled vowels, part 1 2025-12-11

8 Items: More smart.Able to think well.A game involving the body.To have a lot of a quality.To begin; the place where you begin.A mistake; something someone did not mean to do.A place where you can buy a lot of types of things.Ask something you expect to be done; what was asked for.

Level 3 Chapter 5 Vocabulary 2022-10-13

20 Items: ImprovementTo reach a goalTo no longer tryGreat, fantasticNo longer workingRelated to the bodyRelated to the mindNot the right amountOver the amount neededTo go on a trip/journeyAnother word for achieveWhere a person was raisedA fun activity or journeyNo more of that species leftVery few of that species leftItems needed for a sport or task...

spanish 2025-12-04

39 Items: iheboyshebutgoodneatlazynicei amgirlverymessyfunnydaringpatientseriousare youartisticstudiousreservedsociabletalentedi am notimpatienthe/she issometimesintelligenthardworkingmale friendsport mindedhe/she likesaccording tofemale friendwhat are you likewhats his/her namehe/she doesnt likewhat is he/she likeaccording to my family

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

Stanley Word Search 2025-06-03

17 Items: Ryan's jobFlower GirlBest Man's nameRyan's rugby teamHoneymoon locationFather of the BrideThe name of this venueFirst holiday togetherThe stag do was held hereThe couple's first born sonName of our wedding coordinatorThe father of the Groom lives hereThe Bride & Groom got engaged hereThe sport that Rach aced at her hen do...