science Word Searches

This is Awful 2026-02-11

100 Items: ArtDataGoalFocusRobotSkillMusicTrustCreateHonestEffortPlanetGalaxyEnergyDesignEngineSystemPencilFutureChoiceMysteryExploreJourneyCourageCuriousImagineObserveRespectSuccessImproveScienceHistoryAnalyseGravityClimateWeatherHabitatSpeciesProgramDigitalAthleteFitnessBalanceVictoryCultureTheatreEmotionAnxietyEmpathySupportLibraryUniformTeacherStudent...

World Literacy Day 2022 2022-09-01

12 Items: PE is an exampleMath is an exampleMusic is an exampleThe sciences are examplesEconomics & Business are examplesPsychology and Islamic are examplesEnglish and world languages are examplesJournalism and Film Studies are examplesCreative Writing and English are examplesthe ability to communicate in varying contexts...

Spencer's word search 2023-12-18

6 Items: study of zodiac singsis a person who travels in a spacecrafta group of stars also known as ursa majora ball of ice and dust that orbits the sunbranch of science that deals with space objectsa group of stars forming a recognizable pattern

8G Savvas Elevate Science Topic 7: Energy in the Atmosphere and Ocean 2025-03-03

14 Items: windelninolaninacurrentradiationseabreezejetstreamconvectionconductionlandbreezethermalenergyCorioliseffectgreenhouseeffectelectromagneticwave

types of movies 2024-07-19

10 Items: Aims to evoke fear or suspenseIntended to make audiences laughBuilds suspense and excitement .Centers around love and relationshipsFocuses on serious themes and emotionsUses animation techniques to create the filmPresents factual information or real-life eventsInvolves magic, mythical creatures, or imaginary worlds...

Grade 7-8 MegaFun Word Search 2025-01-14

10 Items: science or logicid, ego and superegoBig fish in a small ......any person who buys a productWilliam..., wrote Lord of the Fliesa town where people lived very longa promise of quality or length of use.symbol of Jesus Christ in Lord of the Fliessystem where the most talented have the powerMalcolm...., wrote David and Goliath and Outliers

MockWorldSearch 2024-01-18

108 Items: catsettaxaircubflypanbeecrydiplionkingjacksoreneatbeefcoolzoomsnowfangpetsbusypestsilkwisehighswaycoatdenyzebrahippoqueenjokerjumpyclosesnaildrinksteepamuckspikybriefstalebikestrailshortgradeawfulimplycravefreezeelatedflowerverifycolourforbiddoctorimmuremotionfavourcannontawdryimperilscienceashamedimperilcrowdedbereaveworriedswallowairportforgive...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Geometry Word Search 2025-04-01

32 Items: gleathgeoancedistanglequingleigletiondistacelesmetryaouteodtusactusecongrucalenethe study of shapesa figure with 3 sidesthe science of numberssame size and same shapea figure formed by 2 raysthe space between two pointstriangle with 2 congruent sidestriangle with 3 congruent sidestriangle with no congruent sidestriangle with 3 congruent angles...

Analytical Word Search 2025-10-01

100 Items: ENTPLOTAUDITERRORNOVELPOWERSQUARECOHORTEDITOREFFECTFIGUREGENOMEIMPACTREVIEWSURVEYTHEORYTHESISAVERAGECARDIACCONTROLCONSENTCONTROLETHICALJOURNALMETHODSOUTCOMEPATIENTRESULTSSCIENCEUROLOGYCITATIONCLINICALDATABASEFINDINGSGENETICSANALYSISONCOLOGYPROTOCOLQUESTIONREVIEWERRIGOROUSSAMPLINGTHEMATICVARIABLEEFFECTIVESECTIONALHISTOGRAMINTERVIEWNARRATIVENEUROLOGY...

Year 5 Semester 1 Wordsearch 2025-11-27

108 Items: moodyirateboughcoughhomeyroughloughweirdchiefniecepieceweighpeacecivilfightploughserenethoughgrumpyfoughtsoughtmoderne-bookrobustalliestreatybordernotionfiniteoptiondroughtthoughtvibrantachieveproteinforeignneitherpopularreceivesciencefictioneconomypeacefulbustlingthrilledhiccoughcharmingspitefuldoughnuttouristycomposedmajesticstunningjubilant...

100 DAYS OF SCHOOL 2026-02-05

100 Items: ArtGymMapPenBookCampDeskTripGameWorkWorkMathTimeSeatTestTimeToolToysWalkZoneBookBullyClerkCubbyGradeMusicRulesSnackStudyYoungFolderLessonMarkerMemoryPencilRecessReportSketchSpeechSupplyZipperFriendsGradingLibraryProjectReadingScienceShuttleStationTeacherUniformWritingActivityBackpackCalendarColoringComputerExerciseHomeworkInteractInternetLearning...

6G Savvas Elevate Science Topic 7: Minerals and Rocks in the Geosphere 2025-03-03

13 Items: crustmantlemineralcrystalsedimentoutercoreinnercorerockcycleseismicwaveigneousrockcrystallizationsedimentaryrockmetamorphicrock

Summer 2023-09-11

100 Items: hotsunhaticesandswimfirewoodjunejulytripfoodcokesodasingreadbakedopegoatyolobeachtowelhumidsunnyriverpartywaterfruitmangograpeguavapaintmoviestudyjapankoreachinasummercastlesportshotdogsmoresforestaugustshortsparadegelatopapayaorangepuzzletravelmexicokaraokecampingweathertouristbandanasandalsindoorssciencewritinghistorycountryecuadorenglandumbrella...

Monkey Word Search 2024-07-05

100 Items: phococogoatlilyendofishGatetentsealikeainyobearcozyjuneloveoceantahoeRanchlemurbunnyitalypratomilansheepotterReyesaamerdonutwhalemarinmochijapanEarthhondabeachquailmonkeysierracarmelsalmonhikingbutterfamilyhusainjennernevadatildencoyotedallasalbanyalpacacactusislandchurrohawaiigordoscampingmammothstinsontomalesseattleraviolipenguinfunstonhammock...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Acceptance Word Search 2025-11-17

100 Items: FunHatTieLoveSionPatsBellworkCampcasePensartsDalyDatesExamsRulesSimondriveMusicBooksTeamsHappyAllmanLockerFamilySmilesMarianSportsNervesGrowthHousesRecessLibraryScienceAnxietyFriendsStadiumCanteenHallwayuniformCharismClassesHopefulLeadersUniformWelcomeRespectKindnessRevisionLaughingRoutinesAssemblyBackpackMaturityMemoriesSubjectsSwimmingTeachers...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

LAB RATS THANKSGIVING 2024-11-20

105 Items: PieHamPPEBuckCornDeerEllaFallMaryYamsArrowAsterBreadCassyFeastGravyPhoneRogieStacySaladButterDanielDinnerGatherGlovesGobbleHaileyLaurieLeavesSalineSodiumSputumSquashSupperTurkeyAlbuminAlcoholBiologyBlessedCarrotsDersheyGibletsGlucoseIndiansLithiumNeedlesPuddingScienceSiobhanStormieCultureBiscuitsBroccoliChlorideEfigenioFoodComaGratefulMacaroni...

Critical Thinking Period 2 and 3 2025-05-22

104 Items: MaxSamartLuisJuanSeanMayaLiamLeviFinnRiyaSaedskimscanreadmathKubuShayRomepeakHorchKrychBrunoCalebEthanGraceBrelyJacobRinoaKhyinYoungAnayaMeloyWellsMoorePricePradaBruniEgyptIndiaChinaearthghosttotalAdonisAndrewAliyahJayleeAstridJamesBJamesMDanicaKalaniAnaleeLeanniWesleycivicsCroucheverfiBrotkaVargasMaranoThomasIsraelGreecepatinaValeriaDerrickAbigail...

Blueback word search 1.0 2025-12-01

111 Items: seakidreefbabylanddoraabelfishsandtidesurfclammaillovereeffinsomenrainswimcoralmarryoceanboatsshorewavesswellgreedmoviesharkstormFamilydiversmotherstellafathernaturewhalesseabedpearlswisdomauthorscalesmarinesewwedcraftywitherfishingabalonefishingashamedsurfingwetsuitfriendsflowerssnorkalsciencecompostharbouranxiousloomingexploithistroyobscure...

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

N5-2C12 2025-01-15

32 Items: jobsoonrecallfuturewriterrapidlylifespanmoreovergraduallyto appearrepeatedlyto decreaseto threatento cope withto be chillyto take awayto come truepromising jobcommunicationto get rid ofto live longerto be automatedto be promisingto be mechanizedto substitute formedical specialistto design the futureto predict, forecastto predict the future...

Third Word Search 2025-05-26

100 Items: GumDayGymFunMathMuchGuggParkAreaTimeBestPensThirdWorldLunchMusicTalesNounsVerbsBonesJointGamesPartyHappyProudBooksPaperGoalsShalomMertonArcadeRecessFablesPoetryMotionTraitsHeroesEventsGrowthPencilReadingWritingStudiesScienceCursiveBretzelBittmanLibraryFictionFictionOpinionAdverbsWeatherClimatePelletsMusclesFriendsPost-itCrayonsPencilsMarkers...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

Kortney Birthday 2025-11-18

10 Items: Your first nameYour birthday monthYou wear these to seeYou celebrate this holidayVolunteer at this science mueseumYour friend that used to work at UNMHYou celebrate this holiday in NovemberYour friend that used to go to Project Search withThe name of your teacher when you were in Project Search...

Forensics CH1 2025-12-15

10 Items: who made the exchange principlespecialized forensics service (dental)what Locard believed connected criminalstype of science, criminal and civil lawspolice analyze __, as an unbiased methodthe other important location besides labmore than 100 countries have one of theseyear the first DNA profiling test came out...

SAGE Diversion 2016-04-20

110 Items: ArtMathLabsTextDeskSageLateBandFireNounVerbPoemsPaperLunchFieldTripsChairBenchTardystartDanceChoirdrillStudyFlashcardsclaimSimileSocialHealthSchoolBreaksSportsLockerBussesIdiomsGradesClaimsAdverbTestingReadingScienceWritingStoriesQuizzesHistoryStudiesPencilsGrammarFriendsLibraryCoachesJanitorFacultyCarpoolCounterLanguageMetaphorPrefixesSuffixes...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

PACE 2025-05-31

100 Items: ELMAIDBARNDORMFERNPLANPACEPONDTEAMDEANSDYSONFAFSALUBINMARKSMEDIANORTHPATONPRIDESANDSSTUDYTBONEALUMNICAMPUSCHOATEGRADESHEALTHHONORSJUNIORKESSELMARTINMILLERNATURESENIORSOCCERSPIRITADJUNCTBUTCHERDIPLOMAFACULTYGANNETTLIBRARYMASTERSMORTOLANURSINGPROVOSTSCIENCESETTERSWELCOMEWILLCOXADVISINGBOUDREAUBUSINESSSERVICESCOMMUTERCOSTELLOFINNERTYFOOTBALLFRESHMAN...

Glossary 2024-11-11

15 Items: Lower than the  adjoining land.Raised, flat ground, higher than plains.A natural feature of the earth's surface.Heigh above a given level, especially sea level.Natural elevation, make mountain ranges when aligned.The tidal mouth of a large river, where the tide meets the streamBroad, flat, low-lying areas, no higher than 200 m above sea level....

Inca and Maya Conflict Project 2022-09-20

15 Items: A female deity.Gods of the wild.We walk or dive on.Science of farming.An event of circumstance.A period of a hundred years.All visible future of an area.Person who designs a building.Largest continental mountain range.Widespread occurrence of a disease.The create and ruler of the universe.A condition of having too many people....

VOCABULARY 1 UNIT 4 2025-12-03

10 Items: an illnessa test to learn somethingopposite of light in weightto move or drop to the groundto show that something is truesomething that allows us to see thingsa person who studies or works in sciencesomething that you take when you are ill or sickto touch someone or something quickly and with force...

Vit/Viv 2025-05-12

9 Items: clear, or brightto bring back to lifeto exist, or to stay alivenecessary, or essential to lifea food substance that aids healththe act of cutting open live animals for scienceattractively animated, or lively (related to a person)friendly, lively, and enjoyable (atmosphere or event)....

Chapter 5 2025-08-01

5 Items: An example of exothermic reaction in daily life.Reaction that absorbs heat energy from the surrounding.When endothermic reaction occurs, the surrounding temperature _____.Branch of science that studies the changes in heat energy in chemical reactions.Exothermic reaction is the chemical reaction that ____ heat energy to the surrounding.

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Proforest Word Search 2024-10-08

51 Items: Mass BalanceGreenhouse gasLand Use ChangeChain of custodyTheory of ChangeHigh Carbon StockSoy working groupZero DeforestationConsumer Goods ForumHuman Rights CoalitionPalm Oil working groupSoft Commodities ForumSocial Risk AssessmentIndependent SmallholderHigh Conservation ValueTropical Forest AllianceForest Positive Coalition...

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

DOLPHINS CHIMPS & ELEPHANTS 2025-04-27

21 Items: helpsmart人気のあるthe same特定の(特定の笛)a merit, 利点a high sounddolphin groupsalmsot the samehave fun togethera way of thinkingthe smartest monkeyfriendly, in a groupstrategies & methodsきちんと 正しい / correctlya way to do somethingyou can remember (well)people who study sciencea big, orange chimpanzee?use them to create music 楽器you can do it! Try! 誰かに何かをやろうと勧める

SAMPSON STALLIONS 2025-09-07

115 Items: FOXLEEMATHALMSDUNNEARLHOODREEDREIDROLLROSERUDDYANGPOLKPREKFIFTHFIRSTARAVEASTONBAKERBONDYBOMBABORAKELETAGOMEZDAVISMOOREMURRYPEREZPERRYPRICEREYESSMITHPEAMSPEREZPERRYTHIRDFOURTHACOSTACDAVISFERRERFRENCHGARCIAHABADAHOPPERKONCIRMARTINMICHELMITTONMOTZNYRIVERASITLERTEMPLETHOMASZAPATASECONDGRAMMARLIBRARYBARAKATBARFUSSBICKHAMBRANDONBRELANDBYGNESSGAMBHIR...

Vocab blast - translate French and find English 2024-01-08

33 Items: je vais écouterelle est...........regarder............souvent.............il est..............c'est...............parce que............jouer.................j'écoute..............j'ai écouté..............je regarde...............écouter...................j'adore.....................normalement..................les infos.........................

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

Proforest Word Search 2024-10-08

51 Items: Mass BalanceGreenhouse gasLand Use ChangeChain of custodyTheory of ChangeHigh Carbon StockSoy working groupZero DeforestationConsumer Goods ForumHuman Rights CoalitionPalm Oil working groupSoft Commodities ForumSocial Risk AssessmentIndependent SmallholderHigh Conservation ValueTropical Forest AllianceForest Positive Coalition...

Ma-Ka-Ja-Wan Merit Badges 2025 2025-06-25

42 Items: ArtNatureRowingArcheryCampingCyclingFishingGeologyBasketryCanoeingClimbingForestryKayakingSwimmingAstronomyFirst AidMetalworkBird StudyLifesavingPioneeringLeatherworkPhotographyWoodcarvingHorsemanshipMammal StudyMotorboatingLearn to SwimFingerprintingPulp and PaperRifle ShootingShotgun ShootingSearch and RescueConservation CorpsSmall Boat Sailing...

Giant Word Search for ESL 6th Grade (1st Version) 2026-02-02

120 Items: hotsadredMayeggcoldcoolbusyfinegoodsickmathstarbluepinkfallJuneJulycornnutsbeefporkfishHellonightsunnyrainysnowyhappysorrytiredmusiccrossheartgreenblackwhitebrownMarchAprilapplebeanslemonmangomelononionpeachcloudyMondayFridaySundayhungrysleepycirclesquareyelloworangepurplespringsummerautumnwinterAugustbananacarrotcherrygrapesorangepotatotomato...

Earth and Its Neighbors 2025-12-18

11 Items: our planetthe star of our solar systemsomeone who travels in spaceis the closest to planet eartha vehicle used to launch somethingthere are 9 of these in our solar systema device used to see things that are far awaycollection of planets that revolve around a suna force that moves something quickly and powerfully...

vocab 2026-01-12

10 Items: quiet and modesta difficult choiceinequality; differencelacking in self-confidence; shyone who studies an art or science for mere amusementto express disapproval of; to depreciate one’s effortextremely poor; lacking necessities like food and shelterconformity to accepted standards of conduct; proper behavior...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

Vit/Viv 2025-05-08

10 Items: To bring back to lifefriendly, lively, andExtremely clear, or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay alive(related to an atmosphere or event)The act of cutting open live animals for scienceAttractively animated; lively (related to a person)...

Revive Word Search 2025-05-07

9 Items: To bring back to lifeExtremely clear or brightNecessary, or essential to lifeTo endure,exist, or to stay aliveA food substance that aids healthAct of cutting open live animals for scienceAttractively animated;lively(used for people)Friendly, lively, and enjoyable (related to an atmosphere of event)...

Uppingham 2025-12-03

15 Items: OUR SCHOOL NAME (14)OUR HEAD MISTRESS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 6 CREATOR OF MAGASINE (15)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPE (8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

English Discovery Words 2025-09-22

15 Items: an animal who barksthe king of the junglea white drink from a cowsomething you use to drinkto move your body in watera place where the doctor worksa place in school with many booksa big room for meetings or eventsa long yellow fruit that is sweetsomething you use to sweep the floora place where children playing around...

Uppingham Cairo 2025-12-03

15 Items: Our School Name (14)OUR HEAD MISTRISS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)6 CREATOR OF MAGASINE (15)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPETETION(8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

Unit 2 vocabulary revision 2025-02-27

10 Items: To go down in water.To stay on top of water.To make something dirty or unsafe.To wash something quickly with water.To block something so it cannot move.Special glasses that protect your eyes.A tool that helps you see very small things.A cup used in science to hold and mix liquids.To make a liquid go from one container to another....

1.2 NATURE OF SCIENTIFIC KNOWLEDGE 2026-01-07

6 Items: Science is ___________-based.Qualitative data involve senses and is __________.Quantitative data involve senses and __________ using instruments.Scientific knowledge is built on the ___________ collection analysis of evidence.In light of new evidence, ________ explanations may be proposed and scientific knowledge is subject to change....

English Vocabulary Test "Vit/Viv" 2025-05-04

9 Items: To bring back to lifeExtremely clear or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay aliveThe act of cutting open live animals for scienceAttractively animated; lively (related to a person)Friendly, lively, and enjoyable (related to an atmosphere or an event)...

mixed 2025-05-01

122 Items: buscardogcatpigyatewizztaxilegogoatlambrungrangtrainguardfaultleedsplanegreenblackwhitemathsblankqueenbleekplacemusicpianocelloviolabrasssignaldundeeticketenginedieselyellowspookyburialguitarrailwaystationjourneydelayedjubileetauntonsaltasheasyjetenglishsciencephysicsbiologybeetleshamstertrumpetstringsbakerloovictorianorthernpenzanceplyomuth...

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

Random word search for Mr. Scully 2026-01-27

123 Items: anbycatanticesunbadlionsockdarkrockmilemealdutytestrentloseruinheadAIDSwearparkhangbombrareballdrawrockrearzebrahippoplantkittyfalsechainpettysmellradiolayerheartweighenemyscalemuggyswellshoutcoachpanictrailschoollitterdegustmosquechargerevealgarliccandlelistenmethodsmoothwonderrevivetrenchrejecthunterunlikemakeupsciencespanishgirafeeglaciermusical...

Idk 2026-02-09

17 Items: _____ SlayerMC from One PieceThe ____ Piece is realDemon Slayer Michel JacksonThe (un)objectively best teacherCreator of One Piece (Last name)MC from Demon Slayer (Last name)MC from Demon Slayer (First name)Author of Demon Slayer (Last name)Tanjiro’s sister from Demon SlayerThe (un)objectively best teacher‘s room...

UNC (medium) 2026-01-17

25 Items: UNC hoops legacySchool pride vibeSignature UNC colorUNC live ram mascotGraduation ceremonyUNC athletic nicknameMain street near campusAdmin building on campusRare collections libraryStudent housing buildingTown where UNC is locatedBasketball arena nicknameGym and recreation centerFans and alumni communityFootball stadium on campus...

Word search puzzle 2023-05-12

124 Items: upoilartrugdeafswimvarydietcalmpackvastareasilkworldquietgrasspointexistrangespacesugarbreadonionbloodhabitimagemetalnativementalnoticeeuropesimpledollorcheesequincerarelyweightrecentmiddayreplaycarpetuniquecustommuseumsurfingbesidesprojectregionspopularpercentimaginecenturysocietyabilitydespitehealthymeasureservingharmfulpreventdiseasenatural...

Español 2A 2024-02-01

50 Items: IheforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringI havespanishenglishseventhamusingto teachto studyto speakyou needfavoritelets seeyou haveart classdifficultmore…thantechnology(feminine)mathematicsyou(formal)the class ofthe schedulethe homeworkyou (formal)science classin the…..houryou(familiar)...

Roots, Prefixes, and Suffixes Mastery 2025-04-14

10 Items: BIOGENIC : Produced by living organisms.GRAPHIC : A visual representation or image.BIOGRAPHY : A written account of someone's life.AUTOMATIC : Operating without human intervention.BIOLOGY : The science of life and living organisms.PHOTOGRAPH : A picture made using light and a camera.AUTOMOBILE : A self-powered vehicle used for transportation....

Math Word Search 2025-06-21

10 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to stay healthyA subject where you practice letters and words...

YLC8 - Unit 6 - Reading 2025-11-25

10 Items: Not deep. (nông)Liked by many people. (phổ biến)Almost, very close to. (gần như)Tell someone about danger. (cảnh báo)Harm or break something. (làm hư hại)Used in science or factories. (hóa chất)Stays and does not leave. (ở lại / còn lại)Makes people or things come closer. (thu hút)A long, curved tooth of an animal like an elephant. (ngà)...

Technology & Its Impact 2023-05-17

10 Items: compass, wheel, simple toolsa negative impact of technologya positive impact of technologyprinting press, satellite, engineContinent where the first technologies developedthe age in which the printing press was developedsector that has improved by the Internet technologythe first tools are said to be developed in this age...

Perfect 12 #7 2026-01-12

10 Items: quiet and modestinequality; differencelacking in self-confidence; shyone who studies an art or science for mere amusementto express disapproval of; to depreciate one’s effortextremely poor; lacking necessities like food and shelterconformity to accepted standards of conduct; proper behaviour...

6th Grade Sight words 2024-03-18

120 Items: agebadnorcatledbithitsonsitedgesoftwallmeetcopyhe'sunitflatskini'vetestpairsandtailwaitsignhugeriderichteamnoteracedeadthinwifebornrulepullleadkingcornbearhopesongshapeeightsouthpartyforceaheadwrongcoverisn'tguessbloodstonewe'llsensewomenmeantthicksighttrainfreshdrivebreakradioboardbrowncleanobjectminuterecordforestwasn'tyellowregionperiodcorner...

Atomic Wordsearch 2025-08-12

11 Items: A noble gas with atomic mass 39.9First element of the periodic tableA vertical column on periodic tableA horizontal row on the periodic tableThe branch of science relative to atomssimplified atomic structure by Niels Bohratomic model proposed by JJ Thomson in 1904Found in our bones, number 20 of periodic table...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

Wordly Wise UNIT 12 2025-10-12

9 Items: My body is made up of many ____________.The family decided to ____________ a dog.The dress has a striped ______________ on it.The CREO library is _______________ by reading level.The girl's _____________ is bad so she wears glasses.His interest in space was ______________ by the science museum....

Welcome to Biology 2025-07-21

15 Items: - Measurable data- perceive something- Non-measurable data- Occurrence that is always true- Educated guess based on observation- The study of life and living organisms- Scientific idea backed by experiments- Shows relationship between 2 variables- Variable that goes on x-axis (can be changed)...

SCIENCE 2025-06-10

1 Item: STOMACH OESOPHAGUS MOUTH SMALL INTESTINE LIVE PANCREAS LARGE INTESTINE PREDATOR PRODUCER CONSUMER SECONDARY TERTIARY PRIMARY CARBOHYDRATES PROTEIN SUGAR FAT OBESITY HEART DISEASE CARNIVORE HERBIVORE

franciscos wordsearch 2025-05-14

9 Items: v. - to bring back to lifeadj. - extremely clear or brightv.-to endure, exist, or stay aliveadj.- necessary, or essential to lifen. - a food substance that aids healthn. - act of cutting open live animals for scienceadj. - attractively animated; lively (related to a person)...

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

Spanish 2025-01-29

56 Items: iheweforyouyousheeasywho?theytheylunchclassfirstthirdfifthsixtheigthninthtentha loty'allsecondfourthi needboringi haveEnglishseventhyou allto teachto studyyou needfavoriteyou haveart classdifficultpracticallet's seetechnologycalculatordictionarymathematicsinterestingmore...thanthe class ofthe schedulethe homeworkamusing, funSpanish class...

What club do you want to join? 2026-02-06

20 Items: Art club 美術部Kendo club 剣道部Dance club ダンス部Brass band 吹奏楽部Karate club 空手部Tennis club テニス部Track team 陸上競技部Cooking club 料理部Fishing club 釣り部Soccer team サッカー部Climbing club 登山部Science club 理科・科学部Esports club eスポーツ部Calligraphy club 書道部Outdoor club 野外・自然活動部Volleyball team バレーボール部Board game club ボードゲーム部Go and shogi club囲碁・将棋部Basketball team バスケットボール部...

Amanda 2025-11-06

23 Items: Last nameMiddle nameBirth monthTabby gray kittenFavorite MLB teamFavorite NFL teamYour age currentlyFavorite MiLB teamYour mom and caregiverBlack and White kittenName of your sisters catSister and Physics studentMiddle school you attendedFavorite Disney movie franchiseFriend you play Basketball withFriend you play Poly Hockey with...

Lost 2025-11-13

129 Items: jinsunekovanconrumconjackwaltkaterosealexjohnyemifatetarpraftswanhugogolfboargunsbookfilmjeepwinesayidjameslockeboonerogerpennyjacobaaronlibbycagessharkhorsehatchflamepearlstaffhydrapurgeknifekeamymilesnaomibonesfaithplanecabinwaterheartjulietsawyerclaireeloisehurleyharperpylonsbuttonstatuetempleorchidcoffinhoraceotherspriestmichaelvincentgoodwin...

Getting to Know Ms. Considine 2025-07-30

20 Items: Her favorite holidayWhere she went to collegeHow old her oldest son isHer favorite baseball teamWhat Ms. Considine teachesWhen Ms. Considine was bornHow old her youngest son isWhere Ms. Considine was bornHer favorite basketball teamThe math teacher on this teamMs. Considine's favorite colorHow many pets Ms. Considine has...

Science 2026-01-20

1 Item: laboratory experiments research chemicals maths space elements biology chemistry physics solar system inventions medicine

Introduction to Physics & Scientific Method 2022-10-29

8 Items: Everything around us is made of _____.An example of a career related to physics.A branch of science that studies the physical world.Patterns or procedures every investigation usually follows.Physics uses ______ to describe observations and predictions.An example of a technology (device) developed with the help of physics....

Science investigation 2025-09-10

1 Item: Model, Matter, Mass, Weight, Inertia, Density, Deposition, Sublimation, Freezing, Condensation, Melting, Vaporization, Recombination, Ionization, Plasma, Mixture, Compound, Element, Atom, Molecules, Physical Science, Earth Science, Life Science, Objectivi

Galen Faculty Word Search 2024-06-28

14 Items: Dean of FAST.The newest dean.Dean of Business.Email him if you can't access Moodle.Very knowledgeable on indigenous rights.Environmental science students know her well.She has a long history and experience in tourism.He's another tourism teacher with vast experience.He's criminal justice students' favorite lecturer....

École 2023-04-25

2 Items: apprendrescience musique gymnase français histoire bibliothèque amusant élève autobus livre pupitre chaise art enseignant directeur travaille papier crayons règle test écrire gomme à effacer

Spanish Vocab 5 2024-10-30

51 Items: heweforwhosheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthI needboringI haveenglishseventhto teachto studyyou needfavoriteyou haveart classdifficultpracticalcalculatordictionarythey(fem.)mathematicsinterestingyou(formal)they(masc.)the class ofthe schedulethe homeworkamusing, funspanish classscience classsocial studies...

POSTIES 0729 COVER 2024-06-26

6 Items: another word for "smartphone"The Yellow Crane Tower is located in _____.a formal talk that someone gives to a group of peopleIBEL helps disadvantaged ethnic minority students learn ______ after school.a building where you can look at important objects connected with art, history, or science...

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

Elementary School Life 2025-06-28

2 Items: ChatGPTpencil recess teacher library desk eraser lunchbox playground crayons math reading music glue scissors chalk notebook science hallway principal friends swings giggles stickers fieldtrip

Review Unit 1 and Unit 2 2025-10-04

2 Items: gym, reading, science, math, English, art, computers,homework, grade, flowers, rice, fruit, bike, camera, markers, building, bricks, guitar, robot, skateboard, tablet, cool, old, new, borrow

Experimenting In The Unknown 2025-04-06

11 Items: First antibioticDeveloped the atomic bombItalian physicist discovered atomic fissionScottish scientist that discovered penicillinPolish-born French scientist that worked in radioactivityFreud’s method of studying the unconscious and its effect on behavior.Splitting of the nuclei of atoms in two to create a huge burst of energy...

December Final Review Word Search 2025-12-08

15 Items: Stored energy.What a design should do.Opposite magnetic poles do this.Technology exists to solve these.Unit used to measure force/weight.Using science and math to solve problems.Starting materials in a chemical reaction.A type of change where a new substance forms.State of matter with tightly packed particles....

Subjects 2026-01-19

15 Items: The official language of Mexico, Costa Rica and Spain.The study of past events, particularly in human affairs.An exciting, emotional, or unexpected event or circumstance.The science and study of quality, structure, space, change and numbers.The language of England, widely used in many varieties throughout the world...

Vocab blast - translate French and find the English 2024-01-08

38 Items: je fais...........écouter.............j'écoute.............jouer.................faire.................il est................souvent...............parce que..............elle est...............regarder................je regarde..............la lecture..............c'est....................normalement..............j'ai fait du vélo...........

Section 3 Unit 15 (46) Word Search 2 2024-02-16

30 Items: (η) the physics(η) the science(το) the cause, reasonto discover, uncover, invent(η) the chemistry (fig or lit)(η) the (genre) science fiction(η) the method, system, fashion(το) the sample, specimen, tokento research, investigate, search(η) the energy, action, potential(ο) the (male) astronaut, cosmonautanalog, proportional, proportionate...

Space Exploration People 2025-11-19

24 Items: First woman to travel into space.First American to orbit the Earth.First human to perform a spacewalk.First person to walk on the Moon during Apollo 11.First human to travel into space and orbit the Earth.Flight director who led the successful rescue of Apollo 13.First American woman in space and advocate for science education....

Elalmuerzo Word Search 2024-10-31

56 Items: ihewefunforwhoyousheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringi haveenglishto talkseventhto teachto studyyou needfavoritelets seeyou haveart classdifficultpracticalmore thantechnologycalculatordictionarymathematicsin the hourinterestingthe class ofthe schedulethe homeworkyou (formal)spanish classscience class...