pop music Word Searches

1.The 1950s saw the rise of the rock and roll genre, which was heavily influenced by African-American music. 2023-03-03

20 Items: souldoowopmotownthetwistbillhaleydickclarkchuckberryfatsdominobuddyhollysunrecordsedsullivantheplattersthecoastersthedriftersstaxrecordselvispresleylittlerichardjerryleelewisrhythmandbluesamericanbandstand

Hidden Formation 2025-09-19

18 Items: SORRYHOLDUPSIXINCHFORWARDFREEDOMALLNIGHTFORMATIONLOVEDROUGHTSANDCASTLESDADDYLESSONSPRAYYOUCATCHMEDONTHURTYOURSELFThe tennis legend who made a cameo dancing in the “Sorry” music video.Beyoncé and Jay-Z’s daughter who appears in family visuals within the film.Beyoncé’s hometown, where much of her style and storytelling roots trace back....

The Power of Music- The answers from the Scavenger Hunt side are what you are searching for in the wordsearch! 2025-04-30

20 Items: TwoFiveFlagFourSevenPabbieSwedenBelongSpokenHarmonyMacHuffSixteenWildcatsScotlandStrongmanBeethovenWisconsinSandwichesHurryScurryTwentyeight

Jacob Word Search 2024-07-31

3 Items: FANTASYISLAND FUNFAIR ARCADE SANDCASTLEMUM GRANDAD GRANNY KAINE ANGEL ALLAN SKEGNESS WACKYRACESSEA SHELLS SAND WAVES ROCK SUMMER SUN CARAVAN MUSIC FISHANDCHIPS HAT SWIMMING ICECREAM SLUSHIE SEAL SUNCREAM FAMILY

4/23 Italian Word Search 2025-04-18

10 Items: a female ballet dancer – __________the text or script of an opera – __________coffee with steamed milk and foam – __________a mural painting done on fresh plaster – __________short, detached musical notes or sounds – __________a narrow, flat-bottomed boat used in Venice – __________a criminal group, especially with Italian roots – __________...

Event, Word Search 2025-04-17

5 Items: money, spicy, ingredient, potato, noodles, complete, cornfruit, spend, dollar, pardon, packet, coffee, hundred, coupon,music, basketball, favorite, weekend, exhibition, sandcastle, picnic,test, sports, january, school, date, first, interested, festival, noise, piano,...

Random 2023-03-28

113 Items: redwarjenomarkLovedinomarscakeworkkpopfrogdopefirebluetownbookeggslifesnowlimesalehomemoonrocktwicejiminkoreawooziateezoneussantamusicdramalemonmoneybeastbellekarmaswiftloverdracodobbywitchworldsmiledevilstylehoshistucknightwintersummerplanetbananaschooldisneyauroraprincestigmamalfoywizardgastonwatsonorangejisungjaemingoogleshineeamazonsearchlovely...

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

Hollywood Knight Life 2025-04-30

100 Items: DJsetsodacastfilmpropCallCrewFilmPlotReelSongCodepizzadanceactorcameodramagenremoviescenePixarAwardDebutOscarPartyactorMusicThemeVenueCrushFloorDancecinemaextrasmakeupstudiocomedyactionDisneyMarvelBiopicOfficeScreenRemakeSequelDesignDoubleSnacksof fameactresscostumeeditingeffectsromanceDubbingMontageTrailerEffectsclustersfootballauditiondirector...

Bridal Shower Sip and Search 2025-08-01

30 Items: Grooms NameWedding MonthProposal MonthJP is Future MrsWedding LocationBrides Nick NameProposal LocationBrides Middle NameBrides Maiden NameNumber of ChildrenBridal Shower ColorBrides Favorite BarBrides Favorite WineBrides Favorite FoodBrides Birthday MonthBrides Favorite SportHoneymoon DestinationBrides Favorite ColorBrides Favorite Artist...

Dave's Faves ( A 90-year-old knows what he likes.) 2025-06-19

14 Items: What does Dave drive?Who is Dave's trophy wife?What is Dave's fave entree?What is Dave's best feature?What does Dave play music on?What is Dav's favorite treat?What does Dave play every day?What is Dave's fave casserole?What is Dave's drink of choice?Who does Dave root for in spring?Who is Dave's favorite furry girl?...

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

O Carnaval e as Máscaras 2025-03-04

33 Items: MaskGoldPaperPaintShinyScaryFunnyParadeFabricRibbonSilverto useCostumePlasticSequinsGlitterElegantDisguiseFeathersColorfulCreativeto paintBeautifulto createto decorateEye-catchingmeans meat/byeBrazil's famous musicfirst capital of Brazillike Carnival and celebrated in the U.S.Where did Carnival originally begin as a pagan festival?...

DOLPHINS CHIMPS & ELEPHANTS 2025-04-27

21 Items: helpsmart人気のあるthe same特定の(特定の笛)a merit, 利点a high sounddolphin groupsalmsot the samehave fun togethera way of thinkingthe smartest monkeyfriendly, in a groupstrategies & methodsきちんと 正しい / correctlya way to do somethingyou can remember (well)people who study sciencea big, orange chimpanzee?use them to create music 楽器you can do it! Try! 誰かに何かをやろうと勧める

Thomas Family Holidays 2025-11-20

115 Items: BowHamJoyMaxCoalGiftGoldListLoveNiceNoelSackSnowStarTreeMiloJohnErinZaneAngelBellsBootsCandyCarolCocoaCometCupidElvesFrostGhostHappyHollyJollyMusicPeaceSantaScarfVixenDylanSarahJennyJimmyKaylaAdventCandleDancerDasherDonnerEggnogFamilyFrostyGivingGrinchHearthJingleLetterLightsPotatoRibbonSeasonSilentSleighSpiritTinselTurkeyWreathSophieTaylorDakota...

multi word search 2025-12-01

20 Items: where you livea favorite foodbeautiful soundsa place to learnsomething to ridefloating in the skya tall wooden planthow to greet someonea way to call peoplethis shows happinessa male in your familypeople related to youwear this on your headan image from a cameraa female in your familyprotection when it rainsopen this to go in or out...

Finding Purpose: Word Search for Brain Health 2025-10-29

29 Items: Feeling cheerful and positiveExploring new places and culturesMaking handmade projects or giftsAppreciating the good things in lifeShowing care and compassion for othersPreparing and sharing meals with othersTaking classes or learning something newFeeling joy and contentment in daily lifeTaking care of physical and mental health...

Superspeller D-1 2022-10-28

115 Items: ramppushstewmutedwellspendshelfrapidscrapmeantbeganswiftshockflingdrainradiobasicshapefaintcrazyspaceframethiefagreebriefslimybrookcouldwouldshookjuicetunedusingthrewbuglemusiccamperexceptcottoncousinwindowcrunchshrimpswitchphrasechangeeighthweightrangerskaterfamousdangercookiebreezeseasonleaderstreampulledbushelexcusesalutepackagefestivebandage...

Ham Radio Celebrities 2024-11-19

25 Items: Actor with radio hobbyCountry music performerActor and radio hobbyistStar Trek actor licensedPolitical figure licensedActress with radio skillsMedia mogul radio amateurOcean explorer with licenseActor with radio backgroundRock guitarist with callsignLegendary astronaut operatorProfessional golfer licensedComedian with radio interest...

JaTorya Bridal Shower 2025-08-01

30 Items: Grooms NameWedding MonthProposal MonthJP is Future MrsWedding LocationBrides Nick NameProposal LocationBrides Middle NameBrides Maiden NameNumber of ChildrenBridal Shower ColorBrides Favorite BarBrides Favorite WineBrides Favorite FoodBrides Birthday MonthBrides Favorite SportHoneymoon DestinationBrides Favorite ColorBrides Favorite Artist...

Our Wedding Word Search 2025-09-28

117 Items: JoyVowFunHugBondGiftKissRingWifeDateGalaHopeLifeRuthAdoreAltarBrideGroomHeartHonorTrustUnityUnionDanceDreamFeastLightMusicPeaceHoseaPeterAlwaysFiancéMutualSpouseCaringDatingGentleLoversTandemWarmthCheersFloralJoyfulLivelySmilesWishesBelovedCherishEmbraceEternalFiancéeForeverHusbandLoyaltyMarriedPromiseRomanceBondingComfortDevotedEngagedPartner...

In the Kitchen 2025-11-10

112 Items: JamOilPieTeaChefCupsEggsJarsLoveMillMugsNutsOvenPansPotsSageSaltSoapSoupTinsWineApronAuJusBreadClockFlourFruitHerbsHoneyJellyJuiceLatteListsMusicPastaRoastScaleStockStoveSugarSyrupTableThymeTimerToastWhiskBasterBatterButterCarafeCerealCoffeeDinnerDishesGarlicGrainsIceboxKettleKnivesNutmegPantryQuaintSimmerSnacksSpicesTeapotWarmthZesterBaskets...

Common Musical Instruments 2024-08-24

8 Items: Violin A string instrument played with a bow.Trumpet A brass instrument with a powerful sound.Flute wind instrument with a high, clear sound.Guitar string instrument often used in popular music.Saxophone A woodwind instrument developed by Adolphe Sax.Piano A keyboard instrument with hammers striking strings....

CHRISTMAS 2024 Word Search 2024-12-03

116 Items: ELFEVEJOYBOWSCOALMAGIMARYMILKNICENOELPINESLEDSNOWSTARTREEZUZUBUDDYCIDERCLARKCOATSCOMETCUPIDJESUSJOLLYKEVINMUSICSANTASCARFVIXENADVENTANGELSDANCERDASHERDONKEYDONNEREGGNOGFAMILYFROSTYGIVINGGRINCHJINGLEJOSEPHLIGHTSMANGERMOVIESSLEIGHSTNICKTINSLEWINTERWREATHBLITZENCHIMNEYCOOKIESFRIENDSGARLANDHOLIDAYLEGLAMPMIRACLENAUGHTYPARTIESPRANCERRALPHIERUDOLPHSCROOGE...

Sip & Search 2025-11-16

24 Items: Years togetherThezy’s real nameThezy’s new surnameMonth of the weddingThezy’s birthday monthThezy’s favourite hobbyThezy’s favourite drinkThezy’s favourite colourJonathan’s favourite beerThezy’s favourite holidayWho said I love you firstJonathan’s birthday monthThe couple’s home countryThezy’s favourite dessertThezy’s favourite TV show...

My Chemical Romance 2025-08-02

76 Items: MCREmoEmosPainLyn-ZDeathDrumsAngerHelenaCancerGuitarMelodyDrummerThe-EndSadnessSuicidePop-PunkStrengthEmo-KidsPunk-RockHard-RockSelf-HarmSongwriterPlaywrightPercussionHeartbreakBand-NamesDepressionInsecurityLead-SingerLindsey-WayDoom-PatrolGothic-RockHeavy-MetalDark-ThemesFrustrationDisenchantedGuitar-RiffsSkinny-JeansPost-HardcoreDark-Clothing...

Cruzadinha Musical 2025-01-18

24 Items: RockSambaViolaForróMozartAnittaBeyoncéClarinetecomum em festas de São João e é dançado em pares."do Brasil’ é uma das músicas mais conhecidas desse gênero."é a voz por trás de ‘Show das Poderosas’ e ‘Vai Malandra’."do pop, com músicas como ‘Crazy In Love’ e ‘Run the World’."hino ‘We will rock you’ é um clássico dessa banda britânica."...

20 2025-08-17

15 Items: Protective fabric.Small tool carrier.Bag strapped to tank.Sewn symbols on a cut.Used to lubricate chainRide with card game stopsHeavy footwear for riders.Protect hands while riding.An informal gathering or social event for bikersA high-speed motorcycle competition on public roadsA fundraiser where bikers collect toys for children...

Reading Word Search 2025-09-04

107 Items: REDEYEEARARMLEGRUNMAPSKYSUNHOTDOGCATHEROBOSSKINGFILMSONGBLUEFACEHANDFOOTBODYFOODSWIMJUMPWALKMOVELAKEMOONSTARRAINWINDCOLDCOOLBIRDFISHLIONBEARTREEHOMEROOMMOVIEMUSICDANCESTAGECOLORGREENBLACKWHITEPHOTOSMILEMOUTHFRUITWATERSPORTDANCEHOTELRIVEROCEANSUNNYRAINYTIGERHORSESNAKEHOUSELEADERPRINCEYELLOWCAMERAHEALTHTRAVELTICKETFORESTSEASONSPRINGSUMMERAUTUMNWINTER...

Our Wedding Word Search 2025-09-28

117 Items: JoyVowFunHugBondGiftKissRingWifeDateGalaHopeLifeRuthAdoreAltarBrideGroomHeartHonorTrustUnityUnionDanceDreamFeastLightMusicPeaceHoseaPeterAlwaysFiancéMutualSpouseCaringDatingGentleLoversTandemWarmthCheersFloralJoyfulLivelySmilesWishesBelovedCherishEmbraceEternalFiancéeForeverHusbandLoyaltyMarriedPromiseRomanceBondingComfortDevotedEngagedPartner...

Music Word Search 2025-01-02

1 Item: MUSIC

Music Word Search 2025-01-02

1 Item: MUSIC

Cari Negara 2025-10-02

20 Items: Negara Eropa dengan ibu kota BerlinNegara di Eropa dengan ibu kota RomaNegara Asia yang terkenal dengan K-PopNegara di Asia Barat tempat Ka'bah beradaNegara kepulauan terbesar di Asia TenggaraNegara Asia Tenggara dengan ibu kota HanoiNegara di Asia Timur dengan ibu kota TokyoNegara di Eropa Barat dengan ibu kota Paris...

Vibration 2024-03-28

10 Items: ________ is a type energy.sound travels in ________.sound is made by objects when they ______.what we found from testing our predictions.how we test our prediction in a science lesson.a guitar makes music when its ________ vibrate.an instrument that makes sound when you hit it.what happens when sound vibrations hit a surface?...

Hobbies 2025-10-10

10 Items: You need a camera for this.You need a bike for this hobby.You do it in a pool or the sea.You move to the rhythm of music.You prepare food in the kitchen.guitar A musical hobby using strings.You do this when you visit new countries.You grow flowers and plants in this hobby.You use brushes and colors for this activity....

Vocab - G Words 2025-09-09

13 Items: Not a specific brandTo take a brief lookVery cautious or carefulInspiring horror or disgustThe rate of ascent or descentEasily cheated or duped/trickedTaxing to the point of exhaustionMoving or changing by slight degreesA source of satisfaction or pleasureTo be attracted to or toward somethingTo shine by reflection with a soft luster or sparkle...

Word Study 11/17/25 2025-11-19

10 Items: relating to schoolrelating to the tropicsthe middle of the day, noonrelating to irony, amusingly unexpectedto have a small or half amount of sweeteningin a state of complete confusion and disorderrelating to music; sounding pleasant or musicala game or competition that comes before the final oneoccurring in or characteristic of myths or folk tales...

Prefixes Week 1 2024-04-24

10 Items: To _____ means to cycle or to use again.Prefixes will _____ in next weeks spelling packet.To _____ means to not follow rules or instructions.If you plan something ahead of time then it is _____ .Before you style your hair, you need to _____ it first.I am _____ to change your grade if you do not do your work....

ww4 u8 2024-04-29

15 Items: a roomto finda way invery valuableto go or come downhaving lots of roomthe outside layer, the topvery old; of a long time agothe inside part of somethinga part or share of the wholea period of one hundred yearsa part of a written work or piece of musicto come or go in without permission or welcomea deep pit where stone is cut out of the ground...

33 2025-08-17

15 Items: Wallet with chain.Gathering at night.Common biker jewelry.Outdoor meal with bikers.Lubricant essential for engine healthEvent celebrating biker independence.Substance burned to power a motorcycleMeasure of gasoline quality and performanceDevice for communication or music on a rideAnimal that riders watch out for on forest roads...

POSTIES 0401 Cover 2024-03-12

6 Items: a period of 100 yearsopposite of "beautiful"unable to remember something that happeneda large black bird that makes a loud noisea type of dance that is usually performed in a theatre and tells a story with musica piece of flat glass that reflects images so you can see yourself when you look into it

SPN I 3-1 Vocabulary (no "the") 2024-10-21

35 Items: mallto goto eatto runsoccernovelstennisto singto drawto readto swimwith meto wantto skatewith youmagazinesto go outall rightto exerciseboard gamesmovie theaterto rent videosto do homeworkto ride a bikeI have no ideato write letterI want to go...with my friendsto go for a walkto download filesto listen to musicto spend time aloneto watch television...

singers 2023-05-19

6 Items: /Your name doesn't match your height/Participated in the band One Direction/Produced, directed and will star in a series on hbo/Participated in the Teen Wolf series as a lead actor/Started dedicating music to her ex when he cheated on her/This year he participated in the Superbowl where she performed after many years and announced the second child

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

Performing Arts 2025-12-16

32 Items: A performance by one person alone.The written text of a play or film.All the performers in a show or play.The raised platform where performers act.The person who writes the scripts for plays.The group of people watching a play or concert.A long speech given by one actor alone on stage.The art of composing dance routines and movements....

English 8H Independent Reading Project : Maggie T 2025-12-06

10 Items: Who is Daisy's best friend?Who is the producer of The Six?Who is the male lead of The Six?Who is the female lead of The Six?Who does Graham fall in love with?Where does Simone go to pursue music?What was Billy and Daisy's first big hit?Where does Daisy go after her fight with Billy?What is the name of Billy and Camilla's daughter?...

Turkey Word Search 2025-06-22

12 Items: A big meal with lots of foodA warm sauce poured over foodFeeling happy for what you haveThe people you love and live withWhere everyone sits to eat togetherA soft, yellow bread made with cornWhen fruits and vegetables are pickedA big bird often eaten on ThanksgivingA sweet dessert, often pumpkin or appleBread and herbs cooked inside the turkey...

5-2 ch 6 나만의 공부법 2024-09-29

34 Items: oftenreviewpreviewproperlyteachingto scoldto repeateffectiveto mastergeographyto memorizeto memorizeto be happysheet musicto associategrade, scorecalligrapherto look aftercourse, subject되다 to be focusedto greet, welcomesteadily, constantlylater; in the future짜다 to schedule a plan좋다 to be good qualityto play an instrumentmaster of calligraphy...

Emily & Aiden 2025-07-20

25 Items: Our first holidayOur favorite hobbyName of 'our' songNumber of GroomsmenAiden's middle nameWhere we got engagedWhere they first metAiden's favorite cityName of wedding venueAiden's favorite sportEmily's favorite sportEmily's favorite hobbyFirst date destinationEmily's favorite colourThe month we got engagedAiden's favorite takeaway...

wedding word search 2025-08-22

20 Items: – Party after the ceremony.– The woman getting married.– Path the bride walks down.– The man on his wedding day.– Used to decorate the venue.– Flowers carried by the bride.– Family and friends attending.– Trip taken after the wedding.– Exchanged as a symbol of love.– The reason behind the wedding.– Card sent before the ceremony....

Christmas Bonanza Wordsearch 2025-12-14

124 Items: bowboxelffirfunhamjoyredcardcoalgiftlistlovesnowstartreewishxmasangelbellscandycheercometelvesfaithfeastgracegreenhollyjollymagicmerrymusicpartypeacesantavixenwhiteadventbakingcandlecaringcarolschurchdancerdonnerfamilyfrostygrinchhohoholightsparaderibbonsleightinselturkeyunwrapwinterwreathbaublescharitychimneycookiesdisplayfestivegarlandholiday...

Hispanic Cultural Traditions & Celebrations 2024-10-10

20 Items: What dance originated in Argentina and Uruguay?What is the celebration on September 16 in Mexico?What is the festival that celebrates the Virgin of Guadalupe?What is the Spanish New Year’s Eve tradition involving grapes?What is the religious celebration before Easter in Spain called?What is the Mexican celebration of a girl’s 15th birthday called?...

Fences Word Search 2023-05-22

40 Items: johnmary1weekfencesplantsfencesjospehflowersbaseballheisretiringplaybaseball1dayand1nightPeter’s Gatescryoutfortroyhefellofacliffnineteenforties2daysand2nightstendtothegardennineteenthirtiesheisdivorcinghernineteenseventiesheisdyingofcancerhewasinacaraccidenthewantedgabe'smoneyTroywerebeingharassedhecouldn'tpaygabe'sbailthecompanylessenedtheirpay...

Camp Tucker Week 8 - Relax and Recharge Week 2025-07-22

118 Items: SPAGELTUBSPASUNZENBATHBODYCALMCAMPCARECOMBCOOLCOVECOZYIRONEYESHAIRMASKROBESANDSKINCARESOAKSOAPSOFTTOESWARMWASHBROWSCLEANDETOXGRANDDRYERHAPPYHOTELMUSICBRUSHOASISPARTYRELAXA DUBSALONSAUNASTEAMTOWELWATERWRAPSBAMBOOBEAUTYCANDLEENERGYFACIALFLUFFYGENTLEHEALTHLASHESLIGHTSLOTIONLUXURYMAKEUPMIRRORPOLISHRESORTSERENESMELLSTICKLETUCKERWAXINGBALANCEBLANKET...

Bailey & Justin's Search for Love 2025-11-18

22 Items: Where Justin worksBailey's maiden nameName of the best manJustin's middle nameNumber of bridesmaidsTheir favorite seasonColor of Bailey's eyesFavorite meal for bothTheir favorite NFL teamThe trip newlyweds takeBailey's cute dog's nameName of town they live inWhat month did he propose?Justin referee's this sportGroom's favorite college team...

Wedding WORD SEARCH 2024-08-16

14 Items: The star of the day.The partner of the bride.The nature of your commitment.The event celebrating your union.The symbol of your unending love.The celebration with music and joy.The promises you make to each other.The emotion that brought you together.The people who support and celebrate you.The first trip you take as a married couple....

trs22 3b bt4 wk15 pt2 2022-07-06

10 Items: adj.Not tidy.n.The wife of a king.n.Special or fun clothes.n.The son of a king and queen.n.The daughter of a king and queen.n.A computer that can fold and be put in a bag.n.Use your hand make something move through the air.n.Stuff that is made of very tiny pieces, like flour.n.A big party in the street with music, dancing and costumes....

Pamela 2023-03-11

31 Items: VERBATIMACCURATECORRECTINGJUST YOURSPERPLEXINGWINDY MUSICTATTOO DELAYYOU’RE OLDESTCLOSEST FRIENDMAKING STENCILSYOU’RE YOUNGESTPAM BUT WRITTENYOUR APPEARANCETIFFS CUTE SPAWNTIFFS CUTE SPAWNTHE WAY YOU DRIVEPART OF YOUR TITLEPART OF YOUR TITLEONE OF YOUR HOBBIESPASSIONATELY SPEAKINGINTERESTINGLY ENGAGINGFUN HOLIDAY TO DECORATEIMPROVING A DULL PICTURE...

Holly Jolly Christmas 2024-12-04

126 Items: BowjoyPiepipRedBellcoalgiftmilkNiceNoelpinesledsnowstartoystreeYuleAngelblissCandyCardscheercidercoatscometCupidElvesFeastGreenHollyjollyMerrymusicnightPartySantascarfVixenadventCandleCarolsDancerDasherDonnereggnogfamilyfrostyfrostygivinggrinchLightsmangerribbonsilentSleighstNicktinselTurkeyWinterWreathblitzenchimneyCookiesGarlandgrandmagrandpa...

Church Word Search 2025-01-20

25 Items: Years togetherTheir first dateRichard's nicknameMakayla's dream jobWhere the couple metMakayla's birth stateThe proposal backdropMakayla's middle nameCouple's favorite foodMakayla's new last nameWhere they both graduatedMakayla's favorite flowerThe place Richard proposedThe month Richard proposedTheir honeymoon destination...

Renaissance Word Quest 2025-02-23

10 Items: A French song.A gradual increase in speed or tempo.A gradual decrease in speed or tempo.The period of music between 1400-1600.An instrument like a small U-shaped harp.When two or more independent melodies coincide.The most influential invention of the Renaissance.A string instrument with a long neck and angled tuning pegs....

Sebastian & Deanna 2024-05-17

29 Items: Winter jobFirst dateHome stateAnniversaryWinter sportBoyscout campCollege sportFour-legged sonEngagement MonthSebastian's tradeSebass's nicknameNew family memberWhere we first metDeanna's birth monthHoneymoon destinationSebastian's home townSebastian's birth monthDeanna's degree subjectUniversity, abbreviatedDeanna's childhood camp...

Venitia & Stephan 2024-11-07

23 Items: Groom’s NicknameBride’s HometownCity couple met inGroom’s middle nameCouple’s Dog’s nameBride’s Middle NameMonth Groom proposedBride’s new last nameGroom’s birthday monthGroom’s favorite sportBride’s favorite sportBride’s birthday monthPrairie Groom’s HometownCouple’s Favorite Music GenreWhere did the proposal happen?Couple’s first date restaurant...

Mr & Mrs. Stephan Smith Wedding 2024-11-09

23 Items: Groom’s NicknameBride’s HometownGroom’s HometownCity couple met inGroom’s middle nameCouple’s Dog’s nameBride’s Middle NameMonth Groom proposedBride’s new last nameGroom’s birthday monthGroom’s favorite sportBride’s favorite sportBride’s birthday monthCouple’s Favorite Music GenreWhere did the proposal happen?Couple’s first date restaurant...

mixed 2025-05-01

122 Items: buscardogcatpigyatewizztaxilegogoatlambrungrangtrainguardfaultleedsplanegreenblackwhitemathsblankqueenbleekplacemusicpianocelloviolabrasssignaldundeeticketenginedieselyellowspookyburialguitarrailwaystationjourneydelayedjubileetauntonsaltasheasyjetenglishsciencephysicsbiologybeetleshamstertrumpetstringsbakerloovictorianorthernpenzanceplyomuth...

The Honeymooners 2025-05-29

12 Items: The loud but lovable main character.Ralph’s sharp-witted and patient wife.The heart of most of the show’s scenes.The modest home where the Kramdens live.Ralph’s job that he often complains about.The New York borough where the show is set.Central theme, despite the constant bickering.Ralph’s last name; also refers to the household....

Music Class 2025-09-23

1 Item: Jagvir Jamari Na'Talya Zachary Logan Kinley Levi Aaliyah Alexandria Maverick Caitlin Demi Kylie Khari Kiletta Blake Isaiah Jaylen Milli Jaiden Inderjit Junter Ciomhe

Music Comprehension 2025-12-15

1 Item: rock guitar bohemian london freddymercury bass champions drums energy piano vocals liveaid concert dust lambert legacy iconic tour mtv rundmc rap golden tricky unforgettable myadidas pioneers leather sneakers blackhats cool nolaces

Math Word Search 2025-06-21

10 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to stay healthyA subject where you practice letters and words...

cantates hispanos de los 60' y 70' 2024-08-21

13 Items: Este joven cantante fusionó rock and roll con música latina, dejando una huella importante con su famoso tema "La Bamba".Famoso por sus baladas y su estilo romántico, este cantante español se convirtió en una figura global en la música latina....

Making Music 2023-01-03

1 Item: bugle cello clarinet drums flute

BESA Wordsearch 2025-07-21

10 Items: Which exec is Part V ENGSCI?What is Dharshan’s spirit animal?Which club was the Friendship Beads event in collaboration with?What is the surname of the exec with first name starting with ‘Y’?What popular game did Day 1 of the BESA Exec Retreat kick off with?Kevin, BESA’s Treasurer, loves which K-pop girl group (starts with L)?...

Verbs 2023-12-16

16 Items: You make food to eat.You do this with music.You say the numbers out.You do this to your hair.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words in a book.You do this with a toothbrush.You do this in a swimming pool.Birds do this with their wings....

Kerstmis Word Search 2024-12-07

30 Items: Een ster met kerstAvondeten met kerstZit boven in de boomKleine sfeer lampjesFeest brood met kerstDe kerstman rijd er inDe avond voor kerstmisEen mooi versierde boomEen figuur met vleugelsGooien met sneeuwballenHet seizoen na de herfstHier kun je op schaatsenDe vier weken voor kerstRendier met een rode neusHet bed waar Jezus in lag...

Word search <Level MAX> 2023-07-20

3 Items: beautifulenglish music grandmother sister tuesday saturday hungrydance draw drink enjoy like listen look make meet play practice read ride sound stay swim visit walk want watch write three seven eleven dinner season winter basketball homework

23 2025-08-17

15 Items: Rules bikers live by.Serious loyalty pledge.Ink showing club loyalty.Process of proving loyalty.Common outlaw biker symbol.Seasonal ride to welcome warmer weatherTribute ride held to honor a fallen riderYearly organized motorcycle ride or eventGroup ride organized to raise funds for a causeHigh-speed motorcycle competition on a paved track...

Questions faciles ! 2022-11-12

45 Items: PANIERTISSAGEMON AINÉMA VILLEBÉNÉVOLATMON JARDINMON CERCLEUN BEAU LACLEGUME FRUITPOUR LA TOUXSAISON FROIDEPLAT RÉGIONALJE LES ARROSEÎLE DE MYRIAMMA VIELLE AMIEDIMANCHE MATINLÉGUME DE LAPINFETE DE FAMILLEPOUR LES TARTESDESSERT DE NOELMENU ENTRE AMISCHEF DU VATICAN1ER PETIT ENFANTVIVE LE CHOCOLATPROVINCE ET VILLELUMIERE ET CHALEURCOULEUR DE L'AMOUR...

x 2023-02-03

191 Items: menasddsmmomdadsonhugpopseesawyouonetwokinnewoldfunaceawekeylabpepskyvexwaywhywhowrytoyslyspyorbactadohexeastwestalpsmaleboysadhdpureshutmemegoodfineauntcarenicekindloveaxispingpeekpokefeelfeltfaceseekwisegemsgoalminemindmorejustkindsingplaygamebossusedfreefunkheadopenwhennorthsouthbraingirlswomenloyaleagertruthplainquickshortreadyalertrulesblush...

Chemical Reactions and Reactivity 2025-10-01

23 Items: react with oxygenbreakdown of a chemicalthe chemical name for rustgases form these in liquidsa chemical made by a reactiona sign of a chemical reactionspeeds up the rate of reactiona reaction that gives out heatthe common name for iron oxidemade up of only one type of atomremove oxygen by chemical reactionbreak down slowly by chemical reaction...

Present Simple Word Search 2025-11-03

15 Items: I ________ (to have) a big family.She ________ (to go) to school by bus.You ________ (to like) pizza, correct?It ________ (to rain) a lot in spring.My dad ________ (to work) in an office.The professor ________ (to teach) math.We ________ (to eat) eggs for breakfast.They ________ (to live) in a small town.She ________ (to read) a book before bed....

Verbs with -ING 2025-11-12

18 Items: Jason is ............. a book.Jaime is ........... to David.Jonas is ................ his car.The teacher is ........... a story.Mrs Smith is ........... her tablet.My friends are ............. a film.I'm ................... to music now.Mike is .............. on his notebook.I'm ............ a photo of my friends....

Nicholas and Leslie 2024-10-29

15 Items: When did Nick propose?Who said "I love you" first?What is Nick's favorite color?What city did the couple meet?Where did Leslie go to college?What is Leslie's favorite color?What is Leslie’s favorite animal?Where did Nick go to high school?How many kids do the newlyweds want?Which of the two enjoys driving more?What is Nick's favorite hobby/pastime?...

UNIT 7 FINE ARTS MAS 2024-03-17

18 Items: A Mexican art movement after the RevolutionArt made by ordinary people using traditional methodsPictures or words painted or drawn on a wall, building, etcMexican art era where more images within Christianity were usedTraditional Mexican musical style during the end of the 19th century...

Happy Mother’s Day! 2025-05-10

7 Items: Musical instrument with strings (6)Fill in the lyrics “Blue Ain’t Your ___” (5)The month in which we celebrate Halloween (7)Event we like to sing and dance at together (7)Country music heartthrob with the best hair in the business (5/5)Continent known for its outback and animals like kangaroos and koalas (9)...

our freetime activities 2024-07-22

9 Items: keep our homes tidy and cleanuse our legs to get some fresh airtravel to see your mom or dad's parentsgive the plants a drink to help them growhit a fluffy thing with a net in the middleshoot a ball through a hoop high above the groundmake music on the instrument that look like guitarlook at pictures and speech bubbles to follow a story...

one tree hill (season 9) 2023-07-16

130 Items: fatgunbodycopsfearfiretourtricbeachdeathdramadrugsfugueguilthoteljerrylyingmusicnaleyoceantasertwinsdebleeeuropefamilyflyinghotcarinternlaurenplanesairportbrulianburgerscompanyconcertfashiongolfinghatesexhistoryhostagemadisonopenmicreunionrivalryroachessingingsisterstherapybakermandanscottdirectorfightingflirtinghospitaljealousymarriageproposal...

Rates of reaction 2025-10-08

1 Item: reaction concentration particle reactants temperature balance syringe surface area catalyst enzyme collision mass volume pop limewater relight

Rates of reaction 2025-10-08

1 Item: reaction, concentration, particle, reactants, temperature, balance, syringe, surface area, catalyst, enzyme, collision, mass, volume, pop, limewater, relight

Vocabulario 1.1 2023-09-27

39 Items: orbutmorealsowaterfruitjuicefriespizzato eatto buyto runcookiebeforeto restto drawto workto swimto drinkto writeto studyactivityice creamsoft drinkto do homeworkto play soccerto read a bookto ride a biketo ride a horseto learn Spanishto go for a walkafterward, afterto listen to musicto practice sportsto play the guitarto watch television...

Christmas 2025-12-04

128 Items: DadElfFunJoyBowsHopeLordLoveMagiNoelSnowStarSwagBellsCheerCocoaGamesGiftsGravyHappyHavenHollyJesusMusicPeaceRollsSauceScarfAdventCarolsChristEggnogFamilyGloriaHeirynGrinchLightsMangerMomMomnutmegSaviorShovelSleighSpiritTinselTopperTurkeyWesleyWreathAaryonaChickenChimneyCookiesFriendsGarlandglitterHolidayHosannaIciclesMessiahMittensNewYearRibbons...

Los Pasatiempos 2024-01-06

27 Items: to runto walkto singto cookto restto drawto danceto sleepto studyto travelto exerciseto watch TVto read booksto ride a biketo do homeworkto go shoppingto take photosto stay at hometo play a sportto watch moviesto listen to musicto play videogamesto watch videos onto play the guitarto go to the moviesto use social mediato talk with friends

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

Kimetsu Gakuen!! 2025-04-24

133 Items: ArtRuiMathGotoSumiKiyoNahoEnmuMizuZuhaYunaDoumaMusicCivicsTamayoHealthMakomoManagiTakadaSabitoPlacesYahabaRokuroHistoryBiologyEnglishCherukaParentsKotetsuKengYinPotionsSumaUzuiLawGroupStudentsCuteShopAkiraYinKokushiboChemistryLibrarianMakioUzuiKieKamadoSweetShopRumorClubDramaClubLowermoonsKanaeKochoTengenUzuiTennisClubAoiKanzakiUmeShabana...

MARTINEZ FAMILY 2025-01-10

27 Items: IS A DANCERIS AN ARTISTBORN IN 2023LOVES TO COOKIS FROM MEXICOHAS 2 DAUGHTERSWORKS FOR NASDAQLOVES LIVE MUSICPLAYS THE GUITARPLAYS BASKETBALLWAS BORN IN 2024IS A GRANDMA OF 2NICKNAME IS VIEJAMAKES APPLE BUTTERUSED TO OWN A PORSCHESAM'S OLDEST DAUGHTERSHARES A NAME WITH YOUWANTS TO LEARN SPANISHNICKNAMED AFTER A DOLLIS FROM GRAND JUNCTION...

Pobre Ana ch 6-7 Vocab 2025-10-01

32 Items: hugsoonnexttableagainkissesslowlycheeksI givein frontperfectlyonly / justto visit youlittle sisterhe/she explainsbigger / largeryou describe meyou write to meI put / I placetoward / towardsto say goodbye toquickly / rapidlythey give each otherthey greet each otherthey shout / they yellHow great / That’s goodhe/she was / he/she went...

U1 vocab 2025-08-14

8 Items: Like a river, but made by people.A shop that sells old and valuable things.A circle in the road that cars drive around.A big building where people listen to music.A garden with many kinds of plants and flowers.A small place where doctors and nurses help people.A part of a town where only people can walk, not cars....

Merit Badges 2024-09-02

134 Items: ArtLawGolfPetsChessMusicRadioStudyHikingEnergyNatureRowingSafetySportsCookingCampingCyclingArcheryBuglingDogCareFishingGeologyPotteryReadingSkatingTextileTheaterWeatherWeldingFirstAidSwimmingAviationBasketryCanoeingClimbingDraftingForestryKayakingMedicinePaintingPlumbingRoboticsWoodworkAstronomyAthleticsBirdStudyChemistryDentistryGardeningGenealogy...

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

Danser Word Search 2025-01-22

39 Items: orpianoI liketo askto eatI loveI hateguitarto failto workto giveto playto singto swimto drawto liveto danseto studyfootballto sharelacrosseto startto speakI preferto forgetto arriveto travelto meet upto watch TVI like bestDo you likeI don't likeI really likeDo you preferto like / loveto take a testto listen to musicto play video games...