plants Word Searches

Things We Learn about in Agriculture 2023-09-26

70 Items: ffasaesoillandpigsplowcorncostfeedmilkwoolboerbeefmeatrootscreedacresducksmulchdairysheepgoatstreesbreedcropspestswheatlaborseedslambspigmydairywaterdicotplantscattlenaturecottonsupplydemandchicksgrowthgrowingtiffanyanimalscombineerosionfarmersdroughtgroceryproducemonocotchickensnotchingproductssunlightlivestocknutrientsmachinerymarketingleadership...

Summer Camp 2025-07-21

70 Items: recbowtugwardyebagcampmesshalllakedockfistbumphighfivesnapclapjoinshowplayflagropelovecuteleaftreesalttotecabinrangearrowshakehandsswingloyalwaterbandssummercamperhikingtalentwisdomcleverplantsforestbucketglovesrubberarcheryfirepitcampingcaptureanimalsvinegarplasticcrackercampfireswimmingcanoeingkayakinghandsomestrengthcounselorhappinessbeautiful...

April 2026 Word Search 2026-03-23

70 Items: MudPalmRainThawBudsWarmGrowMeltEggsWormKiteAprilMonthBloomFoolsJokesGreenTreesGrassTaxesMuddyBunnyNestsWalksRainyRisenLambsSheepFreshEarthReuseCleanWorldFourthEasterSundaySpringPranksGardenPlantsSproutTulipsRabbitRobinsChicksHikingBreezeBonnetJoyfulPastelPlanetReduceOceansShowersBlossomRainbowPuddlesThawingRejoiceRecycleRainfallPassoverSunshine...

Plants and Their Parents 2025-12-05

4 Items: parentinheritseedlingoffspring

Pests of Foliage & Flowering Plants 2025-12-01

5 Items: AphidMealyBugWhiteflySpiderMiteFungusGnat

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

Things Found in a Library 2026-02-05

67 Items: meCDsToysMazeNookDVDsSinkBooksMangaTablesChairsPlantsNoExitLaptopCoffeeHeavenCouchesWeepingPigeonsHistoryLostKidBeanbagBindersBlu-rayCamerasWormholeStudyingarchivesDatabaseBathroomLibrarianComputersPaintingsBookShelfCorkBoard3DprinteraudiobookmagazinesmicrofilmCassettesDictionaryCrimeSceneSpecticalsManuscriptNewspapersBoardGamesFiveBodies...

What Do Plants Need To Grow? 2025-03-24

6 Items: SunAirSoilSpaceWaterNutrition

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

ROGELIO'S Word Search 2026-02-02

76 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightSuperBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenExpandSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootball...

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

Planty Word Search 2024-08-28

67 Items: IVYPOTMIXHOYAFERNLEAFSOILMOSSGREGLEAFBARKCOIRFICUSPILEALIGHTWATERSEEDSPLANTPESTSROOTSPILEAHERBSPOTHOSCACTUSGARDENPLANTSGROWTHAROIDSPOWDERFLUVALGARDENBEGONIAPERLITEFOILAGEORGANICMARANTAMONSTERADRACAENAALOCASIACALATHEAAERATIONDRAINAGEALOCASIASUNLIGHTHUMIDITYTROPICALANTHURIUMAGLAONEMAKALANCHOEPEPEROMIASUCCULENTSYNGONIUMBOTANICALSUBSTRATEZAMIIFOLIA...

Vocabulary Word Search #3 2023-04-14

12 Items: shakingstrangeannoyingreliablevery pleasinga quiet crying sounda musical instrumentused logical thinkingability to make plants growdoing things in a particular ordermoving very fast in a dangerous waya place where people serve a sentence from the courts

April Fools Word Search Two 2025-03-31

75 Items: isfuneggthehoaxzanybeeswarmfawnpeephuntwildjokehaharusethisfaceamuseAprilfunnysillyprankmonthhumorsunnyhoneybunnybreaktreesgrasslaughkookysmilecheerspoofshockquirkyspringschemeseasonpollenplantsbreezejoyfulgigglechickscloudswonderpuzzlewisestchoicesmileycomicalfoolishmisleadshowersflowerscomedicplayfulanimalsrainbowmisleadjokestergulliblesurprise...

Capibara Ch 5-6 2025-04-09

21 Items: butthenverywantsthe lakecan swimdestroysthey walkcan't swimis not biga lot, muchwater vaporthey producewants to attacka big hamburgerthey walk throughdestroys the treesthey swim very fastdestroys the plantsenters (in) the waterdoesn't have a lot of water

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

G6_V2 2025-10-03

72 Items: fatsachespotsgenesrelaxcluesdeityspeartauntruinssandylongergrainsratheractivesecretplantsbelongoraclespranghurledwreathsceniccasualsupportcompanytridentunfazedstunnedweaponstiniestbattlesworshipstadiumbroughtshieldscanyonsreservesmoothlyprophecyinfinitepregnantoriginaloutlawedvisitorsultimatesuitablesplendorstunningevidencemedievalvillagesnutrients...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

Nature101 2025-10-09

75 Items: AirSunFireFishLakeLandLavaLifePondRainSoilWildAlgaeBirdsCometEarthGrassOceanParksRiverSpaceTrailTreesWaterWeedsWoodsWorldAutumnBeautyCosmosForestGardenHikingHumansJungleNaturePlanetPlantsSpringSummerWinterAnimalsBeachesBiologyEssenceFlowershabitatInsectsLiquidsNurtureScienceSeasonsVolcanoWeatherAventureCreationSurvivalTornadosTropicalUniverse...

Balsam Word Search 2024-07-08

5 Items: Colour of the flowers.Revathi’s favourite raga.The contest Revathi participated.The plants that were not looking normal.The instrument that was played by Revathi.

Trustworthy 2025-10-15

5 Items: thing we growa thing we need in lifea thing we need in lifething we do with brainrotswe associate this thing with brainrots

Connect Word Search 2025-09-09

10 Items: to endno fatTo be withTo not careto over exaggerateHigh blood pressureeats plants and animalswords with different pronunciationto discuss cultural and societal diversityparts which are similar or are all of the same

ROGELIO'S Word Search 2026-02-02

79 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootballCalender...

Evaporation Word Search 2024-01-10

12 Items: saltwaterfrozen waterone the four spheresfast-moving freshwaterstill moving freshwaterliquid turning into gaswater that flows in steamswater falling out of cloudswater with plants evaporateswhen water pools in large bodieswhen water falls from the cloudswater held underground or in soil

Layers of Soil 2024-04-18

10 Items: Each layer of soil with its own distinct characteristics and features.material: The rock in the R horizon that gradually breaks down to form the soil.The top layer of soil that contains fallen leaves and dead plants, known as humus, which helps in plant growth....

Wordly Wise Weel 11 2025-12-16

15 Items: RawTo feedEyesightGet largerGreat, largeTo disappearTo have a changeA long, deep cutHappens every yearNot made by natureTo give up or surrenderTo mix together into oneTo make a round hole by drillingThe leaves of trees and other plantsA color; especially a shade of color

Medicinal Uses of Plants that grow in Ireland 2026-03-05

8 Items: reliefhealthhealingDigestioncognitiveantioxidantdetoxificationanti-inflammation

Los quehaceres 2024-11-25

26 Items: irondustparkmovesweepplantemptyvaccuumfix bikemake the bedfeed the dogfeed the catcut the grassset the tabledry the disheswash the disheshang up clothesclear the tableclear the tablewater the plantswater the flowersclean the bathroomcollect the garbagetake the garbage outclean the living roomclean the living room

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Alternative Word Search 2025-02-06

57 Items: rdfrnadatagenescancergraphsminingplantssparqlsharingstoragediseaseepitopegenomesglycanssyntenyvirusesbacteriacurationcurationanalysismodelinglearninggenomicslearningmetadatacurationproteinscommunitystandardsdatabasesdiscoverydatabasesexpressionontologiesphenotypesstructuresproteomicssequencingannotationscomparativerecognitiondata storestherapeutics...

Dishwasher 2025-01-06

10 Items: Thoughts or conceptsAn assistant or helperSanta’s speedy reindeertopmost part of the bodyCleans with water and soapUnwanted plants in a gardenChops or shapes with a bladePossessing knowledge or insightA comment meant for the audiencePlates, bowls, and other table items

give two indications that plants need watering 2025-09-24

6 Items: marksoiltestwiltingbrowningof leaf colour

Term One HASS 2026-03-24

80 Items: ACTMapPastLandLakeSandReefCaveEastWestMungoDiaryToolsRocksUluruCoralOceanCoastStoneEarthWaterBeachRiverNorthSouthStatesFossilSourceLetterPlantsDesertMarineIslandNatureLocateForestTravelRegionCapitalCultureHistoryPresentCountryAncientPrimaryObjectsNaturalStreamsExploreShelterHabitatCompassVictoriaTasmaniaPaintingEvidenceFeaturesApostlesMountain...

Nova Farms Word Search 2023-12-19

20 Items: Ground flowerSolventless edibleSleepy time edibleTHC, CBD, CBN, CBG3g Joint with a wooden tipBlunt infused on the insideJoint infused on the insidepre-packed glass one-hitterTHC oil used with a dropperTopical brand made in houseBlunt infused on the outsideVape with live cannabis derived terpenessolvent extract used in Sticky Fish products...

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

Per 2026-02-19

10 Items: rudeto sweatimportant, relevantlasting for a very long timeto spread throughout somethinga way of interpreting informationplants that live two or more yearsto continue in spite of difficultiesa feeling of annoyance or anxiousnessa quick and careless action without interest

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Biomass Energy 2026-03-31

15 Items: What is the most common traditional form of biomass?Organic matter used as a fuel source is called ______.AN alcohol fuel made from corn or sugar cane is ______.A fuel made from vegetable oils or animal fats is ______.Decomposition in the absence of oxygen is ______ digestion.Biomass gets its initial energy from the sun through ______....

CR-Photosynthesis/Cellular Respiration Challenge 2024-08-02

11 Items: a living thingthe plant organelle where photosynthesis takes placethe organelle where cellular respiration takes placethe process that occurs in producers to make glucose or sugarorganisms that consume or eat their own food, such as animalsmicroscopic marine algae that uses the process of photosynthesis...

nursery 2025-03-07

5 Items: easy to move, less shock to plants, grown in sellable size containerno staking, cooler roots in the summer, well-insulated in winter, easy to moveconstructed of wood, no artificial heat source, covered in plastic during the summerconstructed of wood or steel, solar heated, electric cables steam or heated by natural material...

тропический лес Амазонки 2025-12-23

2 Items: to find:RAIN, FOREST, OXYGEN, ANIMALS, PLANTS

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

Science Y4-Y5 2025-07-04

19 Items: How high or low a sound isHow loud or soft a sound isA plant that makes its own foodWhen light bounces off a surfaceThe natural home of a plant or animalThe largest planet in our solar systemThe ability to do work or cause changeThe path a planet takes around the SunThe force that pulls things down to EarthThe star at the center of our solar system...

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Washer Word Search 2025-01-17

87 Items: PanPotBedMugBoxFanOvenForkSoapLampPensCoatSinkCupsBowlVentPoolDoorHatsListDryerStoveSpoonKnifeTableChairCouchPaperPlateClockPurseSprayBrushBootsShoesSocksPantsBooksPhoneWasherToiletShowerClosetPantryCoffeeMirrorOutletOfficeStairsPlantsBottleShortsShirtsJacketGarageLightsSwitchFaucetCarpetTabletOttomanSpatulaBedroomClothesOttomanPrinterPencils...

Garden 2024-05-03

85 Items: dighoesowbeesclayforkhoselawnpotsrakesoilstembladedaisyfencegrafthedgeherbsmulchpestsseedsshadespadevinesweedswormsaphidsgardenglovesleavesplantspollenshearsshoveltrowelannualscabbagecompostfoilageharvestinsectspepperspruningtrellisweedingcucumberdrainagegardenerlettucesmoistureplanterssunlighttomatoeswateringcultivarsflowerbedfrostdatenutrients...

routine 2026-01-15

23 Items: cookget upwatch TVgo joggingmake my bedwalk the doggo to schoolse the tabletidy my roomride a horsedo the dishesfeed the fishset the tablehave a showerhave breakfastdo my homeworkdo the shoppinglisten to musicwater the plantsplay in the gardentake out the rubbishcome home from schoolvisit my grandparents

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

Vegetation and wildlife 2022-11-09

8 Items: uses of plants(1)life supporting systemreason animals are poached(1)Act to protect endangered speciesfactor that affects natural habitatstep to conserve our natural habitat(1)region with short stunted trees and grassnarrow zone of contact between lithosphere hydrosphere and atmosphere

animal 2024-07-19

10 Items: An animal that primarily eats meat.An animal that primarily eats plants.An animal that eats both plants and meat.A warm-blooded vertebrate animal with feathers, wings, and a beak.An animal lacking a backbone, such as insects, spiders, and mollusks.A group of mammals that includes humans, apes, monkeys, and prosimians....

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Patterns of Interactions Challenge Word Search 2025-01-11

17 Items: consumer that eats meat onlyconsumer that eats only plantstype of feeding done by herbivoresspecies rely on each other for survivalconsumer that eats both plants and animalsnon-native species that disrupts an ecosystemorganism that consumes its food to obtain energysymbiotic relationship in which both species benefit...

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

Communism Word Search 2025-09-16

92 Items: gpsseaskysunasiamapslandmoonfishfallcrustarticplacelightstarsbirdsminingmantalindianeuropeafricaglobesregionplantshumansfarmingfishingerosionpacificequatoranimalstreatiesforestrygoresmapatlanticlatitudelocationmovementcreationcommunismsocialismdiplomacyoligarchytheocracyautocracyoutercoreinnercorebiospherereligionsmentalmapaustralialongitude...

Air and Water 2025-01-06

4 Items: plants grown in farma small natural pool of watera very large body of water salta large body of water flowing towards the sea

Find the 20 plants and flowers that grow in Pauline’s garden! (Horizontally, Diagonally & Down) 2025-12-16

20 Items: CROCUSDAHLIAANEMONEBEGONIAFUCHSIACLEMATISCYCLAMENGERANIUMHIBISCUSDIGITALISECHINACEAGLADIOLUSHELLEBOREHYACINTHSALCHEMILLADELPHINIUMANTIRRHINUMFRITILLARIAHELIANTHMUMCHRYSANTHEMUM

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto make the bedto cut the grasshacerlosquehaceresto take out the trashnobody/not anybody/no one

May 2026 Wordsearch 1 2026-02-18

20 Items: a young planta jumping insecta plant containerrelating to flowersthe study of plantsa glass plant housea small social insecta hard-shelled insectprepared planting soila garden watering toola small spotted beetlea container for flowersplant nutrient materiala water spraying devicean immature insect stagea circular flower display...

unit10-grade9 2026-03-30

20 Items: animal wastevery importantfood for plantsan animal's homevery interestingbalance in natureto damage or hurtspace beyond Earthto value somethingto watch carefullya shape of the landsomething dangerousextremely importantto go around a planetto influence somethinga protected natural arealand with a lot of grasschanges in weather over time...

food and appliances 2026-03-22

96 Items: egghamfoodcakemilkovenmayopearricesaltstewmeatlavasteakbreadtoastwheatflourwaterfruitapplejuicemangoicingbagelroastplantsflowercheesebananaorangecitrusshrimpbamboograpesprunessmorespeppergarlicburritoburgerscupcaketoastermustardketchupraisinssasaugenuggiesbrocollieggplantsandwichchowmeinmilkywayhersheysicecreamchocolatemicrowaveplaydoughlemonzest...

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

Fruit Word Search 2025-12-11

2 Items: hot, tall, different, placeplants, rainy, type, trees, growth

trs 5b w17 pt1 2022-06-06

10 Items: adj.dark placen.what people knowv.put things in a bagv.put something on a hookn.a person who is not freen.for example rice,wheat,oatsn.food made from cooking oats in waterv.get away from something dangerous, get outn.trees, plants, oceans, wild animals, mountainsn.a kind of small vegetable, e.g. red, black, yellow, green

Plate Tectonics 2025-12-05

8 Items: plate landplate Oceanspot San Andreas FaultWegener who Thought that the Continents fitspreading New rock forms, mid sea ridgeboundary Location where two plates move apartboundary Location where two plates hit each otherimprints of ancient plants or animals preserved in rock.

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto do choresto make the bedto cut the grassto take out the trashnobody/not anybody/no one

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

Unit 1 Weeks 1 & 2 Wonders Vocabulary 2024-09-17

8 Items: to show a signan unexpected meetingsteep, like the face of a cliffvery impressive; exciting to seethe scattered remains of somethingspecial force used when saying a particular wordfamily in the same era who have a common ancestora person studies things in nature (plants & animals)

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

May 2026 Word Search 3 2026-02-18

19 Items: degree of heatto turn over soilpredicted weathersoil water removallimited direct sunrelating to springrelating to a seasoncomplete sun exposurea small garden sectionto allow air into soilamount of sun receiveddistance between plantsa line of planted seedsa prepared planting areato prepare and grow soilsmall local climate zone...

Water Cycle 2026-01-15

11 Items: energy from the sunrain snow sleet hailliquid changes to gaswater moving downhillwater evaporating from plantslayer of gas surrounding a planetan underground reservoir of watergas loses energy to become a liquidpowers the water cycle toward the earthpowers the water cycle toward the atmospherea collection of condensed water in the atmosphere

5th Grade Vocab Unit 3 Week 2 2025-12-05

5 Items: moved by twistingallow, accept, put up withliving spaces; a place to stayfelt excitement; felt a prickling sensationhaving a certain mixture of clay, sand, and organic material; having a texture good for growing plants

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

Sunshine Word Search 2025-04-28

9 Items: A holiday in early JulyBright light from the SunWhat people drive in waterWhat you do with a sailboatWhat people use to cool downThere are 4 _______ in a yearWhat season has Aug, June, and JulyWhere food, flowers, and plants growWhat people have when they eat outside with friends

100 Days of Learning 2026-01-21

100 Items: PEbusArtTagTryMathGlueDeskTimeStarMusicLunchKruerBooksChairpaperTestsnamesMoneySmileSmartProudFocusLearnCountSchoolRecessShapesGraphsPlantsTigersReadingWritingLibraryFriendsTeacherPencilsCrayonsMarkersFoldersQuizzesPhonicsGrammarStoriesWeatherAnimalsHistoryIndianaRespectHonestySharingHelpingclassesfundays100DaysNumbersSciencePrinterJournalLearning...

Memorialday Word Search 2023-04-07

100 Items: sunskyhathoesoilrainkitelawnirislilyhoserakecartmulchseedsgrasssteakshadepatioedgertreesfruitpansydaisypeonyroseslilacspadeplantspaversedgingcloudstableschairsbreezedryrubhotdoggazebogardenorchidazaleafescueshovelglovestrowelshearstraegerpelletsnurseryflowersvioletspetuniatrimmermulcherannualsbarbequemarinadeswimmingbackyardlavendercamelliadaffodil...

101 Words of Us 2025-07-05

101 Items: TeaADHDBeanBusyCatsDiceDogsKindLoveMattRepoSoftSoupWifeWineYarnBeardBreadChaosChessFunnyGonksGoofyHairyLoyalMangaRingsRobynScifiShipsSillyTanksActionBakingCheeseClumsyComedyFamilyGamingGollumHorrorLovingNaturePlantsSpookyWeirdoXFilesBexhillBristolCookingCrochetDevotedDwarvesFantasyFlowersFriendsGenshinGremlinHistoryHusbandMarriedOctoberPatient...

MARCH 2026 2026-02-09

99 Items: BUDDEWSUNJIGMUDPOTREDAIRYBEERBLUEDAWNDUSKFOURGOLDGROWHARPHOPEJADEKISSLAMBLEAFLIMEMINTPALMRAINSAGESNOWTHAWTIMEWARMBIRDSBLOOMSUNNYCHEVYCOLORDAIRYGREENIRISHLUCKYMAGICMARCHMONTHOLIVERESETROBINSHAKETHIRDWINDYBREEZECHEERSCLOCKSCLOVERDRINKSSUNDAYGARDENGROWTHINDIGOSPROUTORANGEPARADEPASTELPLANTSSPRINGRETURNVIOLETYELLOWBAGPIPEBLOSSOMCABBAGEEMERALDEQUINOX...

Abiotic Word Search 2024-07-31

100 Items: dnagpsboabdatadensfirefoodpupsalgaeclamscoralcrabsdingodunesfangsfungijoeyskoalanestsoceanriversharktoxictrapstreeswateralpinebioticdesertdronesdugongforestmagpiemarinenumbatplantspossumpythonspiderspinestaipanwattlewhaleswombatabioticanimalsbanksiaburrowsestuaryflowershabitatoctopuspugglessensorsshelterviruseswallabychemistseucalyptkangaroo...

Sum Word Search 2024-03-13

16 Items: dew on grassrain,snow,hail,sleettotal amount or wholehow you quantify dataan object's mass on earthwhen energy causes changedata obtained by observationevaporation of water by plantswater changing into water vaporneeded to cause motion or changeno matter added or lost (system)precipitation not absorbed in soilphysical "feel" of matter (property)...

Morphology Week 3 2025-02-02

7 Items: near or close to.under + to stretcha community of plants and animals.not + free from + care + quality of beinglife + apart/different + turn + quality of beingan atom or group of atoms with an electrical charge.a statement about what the possible result of an experiment might be.

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Plate Tectonics 2025-12-05

10 Items: Ring of Fireplate landplate OceanSan Andreas fault earthquakeLocation where two plates move apartarea where magma is close to the crustLocation where two plates hit each otherimprints of ancient plants or animals in rocksWegener who thought that the continents fitspreading when a new rock forms, mid ocean ridge

Origination Places of Plants that are Commonly Found in Ireland 2026-03-05

8 Items: RomeAsiaFranceGreeceEuropeGermanyMoroccoUnited-States

Classification Word Search 2026-01-09

8 Items: Organisms w/o a nucleus.The name of “our” domain.Science of naming or classification.The “Father” of the science of naming.Kingdom known as containing decomposers.Another way to refer to a scientific name.Kingdom where cells have walls made of cellulose.Scientist who first separated organisms into 2 groups (plants & animals).

Test Word Search 2022-11-22

100 Items: jambaginklipicetoepettestcarsroadlacelinefowlbonelookarmyantsyokesoupplothoseweekraincartwallsailwashdustwordfactviewsensemetalplantsparkcabledrinkrangebadgeduckswastecoastriverrouteslaveskirtclasswatchbirthwavesfrogschalkfieldsheepgroundregretmotionhammertheoryflowerislandflightcreditchangecannonriddleplantsminutecactusharborcheesebucketcherry...

ET 5 VOCABULARY 2025-02-03

100 Items: ofeathittaskplanbusyviewsavesafeverywalkrudetripeasyfarmshowliveparkcitynursecoachtraintrashshoutcheatqueuetruthupsetallowbringwritetradewatchvisitsincemusictowerdriverlistenontimeadvicehonestbehavefarmermarketplantsmosquetemplechurchmuseumstatueteacherbereadyprepareprotecthappilyrubbishchewgumcuriousrespectproblemsuggestconfuseopinionfactory...

Ethans Word Search 2025-10-09

100 Items: sunseaecoiceairlifetreebirdwildlandpondrainfishfirelavaparksoilfoodkindfloraoceanrivercloudgreengrasswoodsbeachhumanfrostcometworldalgaespacelemurwaterparksgardenplantsspringflowerplanetnatureanimalcosmosfungusbeautyfloraljungletrailsearthyliquiduniquewinterspirithikingfaunasmammalstreamnaturalanimalsnurtureglacierweathertornadoseasonshabitat...

April 2026 Word Search 2 2026-02-18

21 Items: a sweet smellbecoming greenpleasantly warma pleasant smellsoft pale colorsproducing bloomsa ray of sunlighta distinctive odorrichness of colorsrepeated rainfallsoutside in open airbeginning to developa paved outdoor areaa seasonal celebrationnatural light during dayincreased daylight hoursa sudden heavy spring raingentle or moderate weather...

Term One HASS 2026-03-24

100 Items: ACTMapPastLandLakeSandReefCaveEastWestMungoYearsDiaryToolsRocksUluruCoralOceanCoastStoneWavesEarthWaterLearnStudyBeachRiverNorthSouthStatesFossilSourceLetterPlantsSacredDesertMarineLegendCliffsIslandNatureLocateForestTravelRegionIslandCapitalCultureHistoryPresentCountryRespectAncientPrimaryObjectsNaturalStreamsErosionExploreShelterHabitatCompass...

Heart Word Search 2024-05-21

15 Items: the "blue blood"the gas we exhalehow you feel thingsblood the red bloodthe lightest elementthe gas we breath withmain organ in your bodythe thing you breath withcarry blood to your hearthow you see with your eyesthe things that produce airthe largest organ in your bodythe smallest organ in your bodyThe main liquid that you have to drink...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Dipthongs "ou" and "oi" sound 2023-12-07

10 Items: You go _____ the slide.Soil is the color _____ .I don't know _____ the book.It is rude to _____ at others.My mom _____ my missing homework.Ms. Stapleton plants flowers in the _____ .Ms. Firman has such a pretty singing _____ !I have two eyes, a nose and a _____ on my face.I hope the students do not _____ the classroom....

Vocabulary Activity 2025-08-24

10 Items: Full of grassIn the same way, fairlyWent in different directionsA person who goes on a journeyWas not sure or felt uncertainShows the way or takes to a placeSmall plants and bushes under treesThe way two things are not the sameNot straight; moved the body or head forwardA long breath showing feeling (tired, sad, or relieved)

South America Vocabulary 2022-11-13

15 Items: synonym soaklow-lying areascomplete controlsynonym for plantssynonym for modifycarefully uncoveringWorlds largest waterfallDriest desert in South Americapeople who move from place to placeobjects left behind by past culturesthe variety of species in an ecosystemwide open areas used for grazing and cropssmall rivers that drain into a larger river...

Water Vocabulary (Part 1) 2026-03-23

15 Items: water > iceice > watersteam > waterwater > steamfar from the seawater without saltclose to the ocean/seaa wall that blocks a riverplants that we grow to eatpower/energy made from waterbig pieces of ice on a mountaina place that keeps/stores watera type of water that we find in the seathe process of putting water onto fields...