plants Word Searches

Shrub/plants you would find along the trails in PoCo 2024-06-04

41 Items: salallupinebambooladyfernfireweedknotweedswordfernvinemaplehorsetailsnowberrynootkaroseindianplumoceanspraybunchberryenglishivysalmonberryoregongrapescotchbroomthimbleberryskunkcabbagecherrylaurelspurgelaurelmorningglorygianthogweedenglishhollyredelderberrylicoricefernsbleedingheartbutterflybushgarlicmustardredhuckleberryredoiserdogwood...

MODULE 1D: WORD SEARCH 2025-03-15

15 Items: The sense of smell.A germ that causes disease.When plants grow towards light.Nerve cells that control movement.A protein that helps fight infections.When plants move in response to touch.White blood cells that make antibodies.A quick automatic response to a stimulus.White blood cells that help fight infections....

Los Quehaceres 2024-01-31

14 Items: vacuumto cookto cleanmake the bedmop the floorcut the grassclear the tablesweep the floorto set the tablewater the plantstidy up, organizedust the furnitureto clear the tableto take out the trash

DAY 3 2026-02-02

2 Items: LANDPLANTS

may 2025-05-01

5 Items: the season after winter and before summera hobby involving plants, crops, and flowersthe start of new beginnings, the process of changea word representing what you've learned and done, and what its changed for yougreek goddess of nature and growing plants that influenced the month of may was named after

Speak Review Wordsearch 2025-01-09

64 Items: IvyMegIceHanaLipsEvansEmilyTreesSeedsBirdsBloodWatermotherfatherNicoleMrNeckMsKeenPlantsWarmthFamilyMemoryTraumaSordinoHeatherFreemanSiobhanJessicaForestsMirrorsMeltingSilenceRealitySunlightHairwomanMsConnorsLibrarianToddRyderIsolationTheMarthasappearanceFriendshipLonelinessDepressionRachelBruinGretaIngridKyleRodgersMayaAngelouComingOfAge...

Archie Word Search 2025-11-08

66 Items: elfjoylilpiedaveezrafinnlakelovemaiamayamimimosenikotallboonebuddydavidducksfokinfrankhelenjerryludiemandypeacearchiebarleybustercassiechancecheepachiefscooperfamilyhelenaninersoliviaplantsrylandsaintsturkeywalnutbartschfirepitfishinggeorgiaholidaymichaelnesbittnikolaipumpkinwalmartzvarichfootballlozowskicelebratecharlottegratitudehappiness...

Word Search puzzle grade 6 2024-12-06

20 Items: A new idea or creationPowers your home and devicesA story about someone’s lifeA home for animals or plantsA giant reptile from the pastThe study of stars and planetsA mountain that erupts with lavaTurning waste into something newThe force that keeps us on EarthAn exciting journey or experienceA group of people living together...

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

Disasters and Global Issues 2025-12-15

10 Items: The condition of being very poor.Being very overweight and unhealthy.Animals or plants that no longer exist.A long time with very little or no rain.A big fire that burns trees and forests.When oil leaks into the sea and pollutes the water.Animals or plants that may disappear in the future.The natural world around us, like air, land, and water....

MODULE 1D: WORD SEARCH 2025-03-15

15 Items: The sense of smell.A germ that causes disease.When plants grow towards light.A protein that helps fight infections.When plants move in response to touch.A quick automatic response to a stimulus.Neurons Nerve cells that control movement.cells White blood cells that make antibodies.System The body's defense against harmful germs....

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

Beluga science 2025-07-29

65 Items: mapdikemeltfishlandfloodgasessolidearthbirdslakespondsrocksfreezeliquidmapkeymatterpollenplantsforestriversoceansplainshabitatvolcanoanimalsbeachescareerschangescookingfarminginsectsseasonsengineererodionimaptitlenutrientpropertysolutionstrengthweaknessclimatesevidencehabitatsproblemshurricanelandslidewindbreakecologistmountainsearthquakereversible...

Recombinant-Dna-Technology Word Search 2024-12-16

30 Items: ProjectTherapyBt-CropsBio-FuelsTechnologyELISA-TestGolden-RiceGene-CloningGene-TherapyBio-ReactorsCry-ProteinsBio-PesticidesBio-RemediationCloning-VectorsBio-FertilizersEthical-ConcernsTransgenic-PlantsDNA-FingerprintingTransgenic-AnimalsRestriction-EnzymesTherapeutic-ProteinsBioinformatics-ToolsHybridoma-TechnologyMonoclonal-Antibodies...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Word saerch page 11 TYPES OF PLANTS 2015-07-21

8 Items: PINOÁRBOLPALMAHIERBACACTUSBAMBOOARBUSTOHELECHOS

RICE PLANTING WORD SEARCH 2025-06-01

8 Items: Rice farmers work in P_ _ _ _ field.We eat the S_ _ _ _ of the rice plant.Rice plants need a lot of W_ _ _ _ to grow well.It takes a few M_ _ _ _ _ for rice plants to fully grow.When rice is ready to be picked, farmers H_ _ _ _ _ _ it.Farmers need T_ _ _ ,money and effort to grow their crops....

YLC5 - Unit 6 2025-10-30

10 Items: WaterThe SunCan be trustedStarting and StoppingHeat from planet EarthCreate or produce energyWhere electricity is madeMaterial from plants or animalsTo stop something from continuingMaking the Earth dirty or unhealthy

Things We Learn about in Agriculture 2023-09-26

70 Items: ffasaesoillandpigsplowcorncostfeedmilkwoolboerbeefmeatrootscreedacresducksmulchdairysheepgoatstreesbreedcropspestswheatlaborseedslambspigmydairywaterdicotplantscattlenaturecottonsupplydemandchicksgrowthgrowingtiffanyanimalscombineerosionfarmersdroughtgroceryproducemonocotchickensnotchingproductssunlightlivestocknutrientsmachinerymarketingleadership...

Plants and Their Parents 2025-12-05

4 Items: parentinheritseedlingoffspring

my random thoughts 2023-04-24

60 Items: gayredtheyoudaywolfropeeasebluefrogsongdragswagbatshavagooddanioamecadeathhappykoreatrollklekishardschoolsayoritypingplantshyphaepoisonshrimppacmanelgatocomedymissesiphonescabinetmonsterillegalaaaaaaacorycattestingamonguscoloradoautodeskwhiptailevacuatefloortileseamonkeyskulletonomegamartflusteredtwentyfivemicrophonediscordantblacksheepturiipipip...

Archie Word Search 2025-11-16

68 Items: ElfJoyLilPieDaveEzraFinnLakeLoveMaiaMayaMimiMoseNikoTallWalkBooneBuddyDavidDucksFokinFrankHelenJerryLudieMandyPeaceArchieBarleyBusterCassieChanceCheepaChiefsCooperFamilyHelenaNinersOliviaPlantsRylandSaintsTurkeyWalnutBartschFirePitFishingGeorgiaGrandpaHolidayMichaelNesbittNikolaiPumpkinWalmartZvarichFootballLozowskiCelebrateCharlotteGratitude...

Summer Camp 2025-07-21

70 Items: recbowtugwardyebagcampmesshalllakedockfistbumphighfivesnapclapjoinshowplayflagropelovecuteleaftreesalttotecabinrangearrowshakehandsswingloyalwaterbandssummercamperhikingtalentwisdomcleverplantsforestbucketglovesrubberarcheryfirepitcampingcaptureanimalsvinegarplasticcrackercampfireswimmingcanoeingkayakinghandsomestrengthcounselorhappinessbeautiful...

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

Pests of Foliage & Flowering Plants 2025-12-01

5 Items: AphidMealyBugWhiteflySpiderMiteFungusGnat

What Do Plants Need To Grow? 2025-03-24

6 Items: SunAirSoilSpaceWaterNutrition

Things Found in a Library 2026-02-05

67 Items: meCDsToysMazeNookDVDsSinkBooksMangaTablesChairsPlantsNoExitLaptopCoffeeHeavenCouchesWeepingPigeonsHistoryLostKidBeanbagBindersBlu-rayCamerasWormholeStudyingarchivesDatabaseBathroomLibrarianComputersPaintingsBookShelfCorkBoard3DprinteraudiobookmagazinesmicrofilmCassettesDictionaryCrimeSceneSpecticalsManuscriptNewspapersBoardGamesFiveBodies...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

ROGELIO'S Word Search 2026-02-02

76 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightSuperBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenExpandSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootball...

Vocabulary Word Search #3 2023-04-14

12 Items: shakingstrangeannoyingreliablevery pleasinga quiet crying sounda musical instrumentused logical thinkingability to make plants growdoing things in a particular ordermoving very fast in a dangerous waya place where people serve a sentence from the courts

April Fools Word Search Two 2025-03-31

75 Items: isfuneggthehoaxzanybeeswarmfawnpeephuntwildjokehaharusethisfaceamuseAprilfunnysillyprankmonthhumorsunnyhoneybunnybreaktreesgrasslaughkookysmilecheerspoofshockquirkyspringschemeseasonpollenplantsbreezejoyfulgigglechickscloudswonderpuzzlewisestchoicesmileycomicalfoolishmisleadshowersflowerscomedicplayfulanimalsrainbowmisleadjokestergulliblesurprise...

Capibara Ch 5-6 2025-04-09

21 Items: butthenverywantsthe lakecan swimdestroysthey walkcan't swimis not biga lot, muchwater vaporthey producewants to attacka big hamburgerthey walk throughdestroys the treesthey swim very fastdestroys the plantsenters (in) the waterdoesn't have a lot of water

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

Planty Word Search 2024-08-28

67 Items: IVYPOTMIXHOYAFERNLEAFSOILMOSSGREGLEAFBARKCOIRFICUSPILEALIGHTWATERSEEDSPLANTPESTSROOTSPILEAHERBSPOTHOSCACTUSGARDENPLANTSGROWTHAROIDSPOWDERFLUVALGARDENBEGONIAPERLITEFOILAGEORGANICMARANTAMONSTERADRACAENAALOCASIACALATHEAAERATIONDRAINAGEALOCASIASUNLIGHTHUMIDITYTROPICALANTHURIUMAGLAONEMAKALANCHOEPEPEROMIASUCCULENTSYNGONIUMBOTANICALSUBSTRATEZAMIIFOLIA...

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

G6_V2 2025-10-03

72 Items: fatsachespotsgenesrelaxcluesdeityspeartauntruinssandylongergrainsratheractivesecretplantsbelongoraclespranghurledwreathsceniccasualsupportcompanytridentunfazedstunnedweaponstiniestbattlesworshipstadiumbroughtshieldscanyonsreservesmoothlyprophecyinfinitepregnantoriginaloutlawedvisitorsultimatesuitablesplendorstunningevidencemedievalvillagesnutrients...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Trustworthy 2025-10-15

5 Items: thing we growa thing we need in lifea thing we need in lifething we do with brainrotswe associate this thing with brainrots

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

Nature101 2025-10-09

75 Items: AirSunFireFishLakeLandLavaLifePondRainSoilWildAlgaeBirdsCometEarthGrassOceanParksRiverSpaceTrailTreesWaterWeedsWoodsWorldAutumnBeautyCosmosForestGardenHikingHumansJungleNaturePlanetPlantsSpringSummerWinterAnimalsBeachesBiologyEssenceFlowershabitatInsectsLiquidsNurtureScienceSeasonsVolcanoWeatherAventureCreationSurvivalTornadosTropicalUniverse...

Balsam Word Search 2024-07-08

5 Items: Colour of the flowers.Revathi’s favourite raga.The contest Revathi participated.The plants that were not looking normal.The instrument that was played by Revathi.

Connect Word Search 2025-09-09

10 Items: to endno fatTo be withTo not careto over exaggerateHigh blood pressureeats plants and animalswords with different pronunciationto discuss cultural and societal diversityparts which are similar or are all of the same

ROGELIO'S Word Search 2026-02-02

79 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootballCalender...

Evaporation Word Search 2024-01-10

12 Items: saltwaterfrozen waterone the four spheresfast-moving freshwaterstill moving freshwaterliquid turning into gaswater that flows in steamswater falling out of cloudswater with plants evaporateswhen water pools in large bodieswhen water falls from the cloudswater held underground or in soil

Layers of Soil 2024-04-18

10 Items: Each layer of soil with its own distinct characteristics and features.material: The rock in the R horizon that gradually breaks down to form the soil.The top layer of soil that contains fallen leaves and dead plants, known as humus, which helps in plant growth....

Wordly Wise Weel 11 2025-12-16

15 Items: RawTo feedEyesightGet largerGreat, largeTo disappearTo have a changeA long, deep cutHappens every yearNot made by natureTo give up or surrenderTo mix together into oneTo make a round hole by drillingThe leaves of trees and other plantsA color; especially a shade of color

Los quehaceres 2024-11-25

26 Items: irondustparkmovesweepplantemptyvaccuumfix bikemake the bedfeed the dogfeed the catcut the grassset the tabledry the disheswash the disheshang up clothesclear the tableclear the tablewater the plantswater the flowersclean the bathroomcollect the garbagetake the garbage outclean the living roomclean the living room

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Dishwasher 2025-01-06

10 Items: Thoughts or conceptsAn assistant or helperSanta’s speedy reindeertopmost part of the bodyCleans with water and soapUnwanted plants in a gardenChops or shapes with a bladePossessing knowledge or insightA comment meant for the audiencePlates, bowls, and other table items

give two indications that plants need watering 2025-09-24

6 Items: marksoiltestwiltingbrowningof leaf colour

Alternative Word Search 2025-02-06

57 Items: rdfrnadatagenescancergraphsminingplantssparqlsharingstoragediseaseepitopegenomesglycanssyntenyvirusesbacteriacurationcurationanalysismodelinglearninggenomicslearningmetadatacurationproteinscommunitystandardsdatabasesdiscoverydatabasesexpressionontologiesphenotypesstructuresproteomicssequencingannotationscomparativerecognitiondata storestherapeutics...

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

Nova Farms Word Search 2023-12-19

20 Items: Ground flowerSolventless edibleSleepy time edibleTHC, CBD, CBN, CBG3g Joint with a wooden tipBlunt infused on the insideJoint infused on the insidepre-packed glass one-hitterTHC oil used with a dropperTopical brand made in houseBlunt infused on the outsideVape with live cannabis derived terpenessolvent extract used in Sticky Fish products...

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

nursery 2025-03-07

5 Items: easy to move, less shock to plants, grown in sellable size containerno staking, cooler roots in the summer, well-insulated in winter, easy to moveconstructed of wood, no artificial heat source, covered in plastic during the summerconstructed of wood or steel, solar heated, electric cables steam or heated by natural material...

тропический лес Амазонки 2025-12-23

2 Items: to find:RAIN, FOREST, OXYGEN, ANIMALS, PLANTS

CR-Photosynthesis/Cellular Respiration Challenge 2024-08-02

11 Items: a living thingthe plant organelle where photosynthesis takes placethe organelle where cellular respiration takes placethe process that occurs in producers to make glucose or sugarorganisms that consume or eat their own food, such as animalsmicroscopic marine algae that uses the process of photosynthesis...

Science Y4-Y5 2025-07-04

19 Items: How high or low a sound isHow loud or soft a sound isA plant that makes its own foodWhen light bounces off a surfaceThe natural home of a plant or animalThe largest planet in our solar systemThe ability to do work or cause changeThe path a planet takes around the SunThe force that pulls things down to EarthThe star at the center of our solar system...

Garden 2024-05-03

85 Items: dighoesowbeesclayforkhoselawnpotsrakesoilstembladedaisyfencegrafthedgeherbsmulchpestsseedsshadespadevinesweedswormsaphidsgardenglovesleavesplantspollenshearsshoveltrowelannualscabbagecompostfoilageharvestinsectspepperspruningtrellisweedingcucumberdrainagegardenerlettucesmoistureplanterssunlighttomatoeswateringcultivarsflowerbedfrostdatenutrients...

routine 2026-01-15

23 Items: cookget upwatch TVgo joggingmake my bedwalk the doggo to schoolse the tabletidy my roomride a horsedo the dishesfeed the fishset the tablehave a showerhave breakfastdo my homeworkdo the shoppinglisten to musicwater the plantsplay in the gardentake out the rubbishcome home from schoolvisit my grandparents

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Washer Word Search 2025-01-17

87 Items: PanPotBedMugBoxFanOvenForkSoapLampPensCoatSinkCupsBowlVentPoolDoorHatsListDryerStoveSpoonKnifeTableChairCouchPaperPlateClockPurseSprayBrushBootsShoesSocksPantsBooksPhoneWasherToiletShowerClosetPantryCoffeeMirrorOutletOfficeStairsPlantsBottleShortsShirtsJacketGarageLightsSwitchFaucetCarpetTabletOttomanSpatulaBedroomClothesOttomanPrinterPencils...

Vegetation and wildlife 2022-11-09

8 Items: uses of plants(1)life supporting systemreason animals are poached(1)Act to protect endangered speciesfactor that affects natural habitatstep to conserve our natural habitat(1)region with short stunted trees and grassnarrow zone of contact between lithosphere hydrosphere and atmosphere

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

animal 2024-07-19

10 Items: An animal that primarily eats meat.An animal that primarily eats plants.An animal that eats both plants and meat.A warm-blooded vertebrate animal with feathers, wings, and a beak.An animal lacking a backbone, such as insects, spiders, and mollusks.A group of mammals that includes humans, apes, monkeys, and prosimians....

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Patterns of Interactions Challenge Word Search 2025-01-11

17 Items: consumer that eats meat onlyconsumer that eats only plantstype of feeding done by herbivoresspecies rely on each other for survivalconsumer that eats both plants and animalsnon-native species that disrupts an ecosystemorganism that consumes its food to obtain energysymbiotic relationship in which both species benefit...

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

Find the 20 plants and flowers that grow in Pauline’s garden! (Horizontally, Diagonally & Down) 2025-12-16

20 Items: CROCUSDAHLIAANEMONEBEGONIAFUCHSIACLEMATISCYCLAMENGERANIUMHIBISCUSDIGITALISECHINACEAGLADIOLUSHELLEBOREHYACINTHSALCHEMILLADELPHINIUMANTIRRHINUMFRITILLARIAHELIANTHMUMCHRYSANTHEMUM

Air and Water 2025-01-06

4 Items: plants grown in farma small natural pool of watera very large body of water salta large body of water flowing towards the sea

Communism Word Search 2025-09-16

92 Items: gpsseaskysunasiamapslandmoonfishfallcrustarticplacelightstarsbirdsminingmantalindianeuropeafricaglobesregionplantshumansfarmingfishingerosionpacificequatoranimalstreatiesforestrygoresmapatlanticlatitudelocationmovementcreationcommunismsocialismdiplomacyoligarchytheocracyautocracyoutercoreinnercorebiospherereligionsmentalmapaustralialongitude...

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto make the bedto cut the grasshacerlosquehaceresto take out the trashnobody/not anybody/no one

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

Fruit Word Search 2025-12-11

2 Items: hot, tall, different, placeplants, rainy, type, trees, growth

trs 5b w17 pt1 2022-06-06

10 Items: adj.dark placen.what people knowv.put things in a bagv.put something on a hookn.a person who is not freen.for example rice,wheat,oatsn.food made from cooking oats in waterv.get away from something dangerous, get outn.trees, plants, oceans, wild animals, mountainsn.a kind of small vegetable, e.g. red, black, yellow, green

Plate Tectonics 2025-12-05

8 Items: plate landplate Oceanspot San Andreas FaultWegener who Thought that the Continents fitspreading New rock forms, mid sea ridgeboundary Location where two plates move apartboundary Location where two plates hit each otherimprints of ancient plants or animals preserved in rock.

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto do choresto make the bedto cut the grassto take out the trashnobody/not anybody/no one

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

Unit 1 Weeks 1 & 2 Wonders Vocabulary 2024-09-17

8 Items: to show a signan unexpected meetingsteep, like the face of a cliffvery impressive; exciting to seethe scattered remains of somethingspecial force used when saying a particular wordfamily in the same era who have a common ancestora person studies things in nature (plants & animals)

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

Water Cycle 2026-01-15

11 Items: energy from the sunrain snow sleet hailliquid changes to gaswater moving downhillwater evaporating from plantslayer of gas surrounding a planetan underground reservoir of watergas loses energy to become a liquidpowers the water cycle toward the earthpowers the water cycle toward the atmospherea collection of condensed water in the atmosphere

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

5th Grade Vocab Unit 3 Week 2 2025-12-05

5 Items: moved by twistingallow, accept, put up withliving spaces; a place to stayfelt excitement; felt a prickling sensationhaving a certain mixture of clay, sand, and organic material; having a texture good for growing plants

Sunshine Word Search 2025-04-28

9 Items: A holiday in early JulyBright light from the SunWhat people drive in waterWhat you do with a sailboatWhat people use to cool downThere are 4 _______ in a yearWhat season has Aug, June, and JulyWhere food, flowers, and plants growWhat people have when they eat outside with friends

Abiotic Word Search 2024-07-31

100 Items: dnagpsboabdatadensfirefoodpupsalgaeclamscoralcrabsdingodunesfangsfungijoeyskoalanestsoceanriversharktoxictrapstreeswateralpinebioticdesertdronesdugongforestmagpiemarinenumbatplantspossumpythonspiderspinestaipanwattlewhaleswombatabioticanimalsbanksiaburrowsestuaryflowershabitatoctopuspugglessensorsshelterviruseswallabychemistseucalyptkangaroo...

100 Days of Learning 2026-01-21

100 Items: PEbusArtTagTryMathGlueDeskTimeStarMusicLunchKruerBooksChairpaperTestsnamesMoneySmileSmartProudFocusLearnCountSchoolRecessShapesGraphsPlantsTigersReadingWritingLibraryFriendsTeacherPencilsCrayonsMarkersFoldersQuizzesPhonicsGrammarStoriesWeatherAnimalsHistoryIndianaRespectHonestySharingHelpingclassesfundays100DaysNumbersSciencePrinterJournalLearning...

Memorialday Word Search 2023-04-07

100 Items: sunskyhathoesoilrainkitelawnirislilyhoserakecartmulchseedsgrasssteakshadepatioedgertreesfruitpansydaisypeonyroseslilacspadeplantspaversedgingcloudstableschairsbreezedryrubhotdoggazebogardenorchidazaleafescueshovelglovestrowelshearstraegerpelletsnurseryflowersvioletspetuniatrimmermulcherannualsbarbequemarinadeswimmingbackyardlavendercamelliadaffodil...

101 Words of Us 2025-07-05

101 Items: TeaADHDBeanBusyCatsDiceDogsKindLoveMattRepoSoftSoupWifeWineYarnBeardBreadChaosChessFunnyGonksGoofyHairyLoyalMangaRingsRobynScifiShipsSillyTanksActionBakingCheeseClumsyComedyFamilyGamingGollumHorrorLovingNaturePlantsSpookyWeirdoXFilesBexhillBristolCookingCrochetDevotedDwarvesFantasyFlowersFriendsGenshinGremlinHistoryHusbandMarriedOctoberPatient...

MARCH 2026 2026-02-09

99 Items: BUDDEWSUNJIGMUDPOTREDAIRYBEERBLUEDAWNDUSKFOURGOLDGROWHARPHOPEJADEKISSLAMBLEAFLIMEMINTPALMRAINSAGESNOWTHAWTIMEWARMBIRDSBLOOMSUNNYCHEVYCOLORDAIRYGREENIRISHLUCKYMAGICMARCHMONTHOLIVERESETROBINSHAKETHIRDWINDYBREEZECHEERSCLOCKSCLOVERDRINKSSUNDAYGARDENGROWTHINDIGOSPROUTORANGEPARADEPASTELPLANTSSPRINGRETURNVIOLETYELLOWBAGPIPEBLOSSOMCABBAGEEMERALDEQUINOX...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Sum Word Search 2024-03-13

16 Items: dew on grassrain,snow,hail,sleettotal amount or wholehow you quantify dataan object's mass on earthwhen energy causes changedata obtained by observationevaporation of water by plantswater changing into water vaporneeded to cause motion or changeno matter added or lost (system)precipitation not absorbed in soilphysical "feel" of matter (property)...

Plate Tectonics 2025-12-05

10 Items: Ring of Fireplate landplate OceanSan Andreas fault earthquakeLocation where two plates move apartarea where magma is close to the crustLocation where two plates hit each otherimprints of ancient plants or animals in rocksWegener who thought that the continents fitspreading when a new rock forms, mid ocean ridge

Morphology Week 3 2025-02-02

7 Items: near or close to.under + to stretcha community of plants and animals.not + free from + care + quality of beinglife + apart/different + turn + quality of beingan atom or group of atoms with an electrical charge.a statement about what the possible result of an experiment might be.

Classification Word Search 2026-01-09

8 Items: Organisms w/o a nucleus.The name of “our” domain.Science of naming or classification.The “Father” of the science of naming.Kingdom known as containing decomposers.Another way to refer to a scientific name.Kingdom where cells have walls made of cellulose.Scientist who first separated organisms into 2 groups (plants & animals).

Test Word Search 2022-11-22

100 Items: jambaginklipicetoepettestcarsroadlacelinefowlbonelookarmyantsyokesoupplothoseweekraincartwallsailwashdustwordfactviewsensemetalplantsparkcabledrinkrangebadgeduckswastecoastriverrouteslaveskirtclasswatchbirthwavesfrogschalkfieldsheepgroundregretmotionhammertheoryflowerislandflightcreditchangecannonriddleplantsminutecactusharborcheesebucketcherry...