numbers Word Searches

Text Features 2025-08-04

17 Items: Drawn picturesFirst paragraphLabelled drawingsDrawings of placesReal camera pictureDarker, thicker textNumbers listing itemsTexts in boxes/bordersLine with dates/eventsMain title at the beginningSmall pictures with meaningDots or symbols listing itemsText under pictures or diagramsCharts with bars/lines/pie slicesGroups of sentences about an idea...

Variable Word Search 2025-10-08

16 Items: — The value(s) that make an equation true.— A symbol (like x) that represents an unknown value.— To combine like terms and perform operations to make— To get the variable alone on one side of an equation.— A relation that compares two expressions (>, <, ≥, ≤).— Replacing a variable with a number or another expression....

Math search 2025-10-09

14 Items: the number you multiply by to get 1a value that does not change or vary within a specific context or equationa symbol representing something that can change or has a range of possible valuesa mathematical statement that compares two values or expressions, showing they are not equal...

Proportions 2026-04-23

12 Items: A change downwardA change downwardHaving a constant ratioA proportion of another quantityA standard measurement or exchangeA proportion in relation to a wholeA proportion in relation to a wholeThe quotient of two rational numbersBeing essentially comparable to somethingRelation to compare quantitys or magnitude...

Random stuff 2021-02-17

97 Items: meInRedLOLdayGymBadOutCarPenHatJobBluePinkNameTimeFoodMathGoodNiceYellTalkBallForkBowlCoatFallDoneRaceGoodAdoptGreenDrinkStuffCleanMessyFixedDanceShoutKnifeSpoonSporkPlateStoreGloveScarfBootsShoesWordsStartOrangeYellowPurpleCheeseEasterSocialRandomBrokenGoogleSoccerCerealMeijerTargetCostcoChilisPencilMarkerSummerWinterSpringAutumnSearchGiraffe...

Percentage 2023-07-25

6 Items: entiregoods and services tax.a deduction from the usual cost of something.can refer to the monetary charge for borrowing money.relating to a system of numbers that is smaller than 1.a small or tiny part, amount, or proportion of something

Telugu Days of the Week and Numbers for Lekha to Find 2025-11-08

17 Items: AiduAaruYeduOkatiRenduMooduPadhiNaaluguEnimidiAdivaramThommidiSomavaramGuruvaramBudhavaramShanivaramShukravaramMangalavaram

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Señora York Español Uno (colores y numeros) {colors and numbers} (answer key) 2025-09-30

21 Items: unodosrojorosagrisazultresseisochodeisnegroclaroverdecincosietenueveblancoquatrovioletaamarilloanaranjado

Genesis Word Search 2025-02-23

100 Items: JobEveSinLawRuthEzraJoelAmosMarkLukeJohnActsJudeNoahAdamMaryPaulLoveHopeHolyKingsHoseaJonahMicahNahumMosesTitusJamesPeterJesusDavidSatanCrossGraceFaithPeaceMercyAngelExodusJoshuaJudgesSamuelEstherPsalmsIsaiahDanielHaggaiRomansJosephElijahElishaGideonSamsonHeavenGospelTemplePrayerSpiritGenesisNumbersEzekielAbrahamObadiahMalachiMatthewTimothyHebrews...

T&T Boys #2 2025-12-17

27 Items: Mark10:2Job 36:1Ruth 4:1Luke 1:7Micah 3:4John 13:9Hosea 6:7Nahum 2:8Acts 22:7Daniel 3:9John 18:27Hebrews7:11Peter5:12Psalm 97:8Exodus 37:1Romans 16:11Kings 13:11Samuel 2:21Isaiah 30:31Numbers 7:24Genesis 41:49Galations3:29Leviticus 16:3Revelation 20:82Chronicles2:111Corinthians 9:6Deuteronomy 31:23

American Word Search 2025-04-22

14 Items: Someone from CanadaNumbers and problemsBarbara is from the UKYou can draw and paintCleopatra,gods and warsSomeone who's from the USAGreta is German, she's fromJoao is brazilian, he's formMessi is from Argentina, he'sNaomi is Japanese, she's fromCitlali is Mexican, she's fromSalvattore is Italian, he's fromSomeone who was born in China is......

Ajar Word Search 2024-04-26

12 Items: a large white birdlimated of somethinggoing down in numbersa foot like treatmentsomething that's stickydecline of a unexpected thingsomething that only open a littlegoing somewhere and not coming backsomething or realed to something elseto exandout out ward were your body canta strong dislike to something or someone...

Unit 5 Text 1 (Summer Festivals) 2026-02-09

15 Items: Not allowedRelated to IslamHelpful or usefulSpecial or rare foodsTo remember and honorImportance or meaningMuslim places of worshipTo make something stand outProviding new understandingPolite or friendly commentsTo be the main focus of newsInformation that may not be trueA public event that attracts attention...

Algebra 2025-02-06

10 Items: A rule written with symbolsA letter that stands for an unknown number e.g. x, yA number in front of a variable (e.g. in 3x, 3 is the coefficient)What we call terms with the same variable and power (e.g. 2x and 5x)What we call terms with different variables or powers (e.g. 3x and 4y)...

Find All NATO Phonetic Alphabet Numbers and Letters for Candy :) - From S.S. 2024-12-11

36 Items: WunTooSixAitAlfaEchoGolfKiloLimaMikePapaXrayZuluTreeFifeBravoDeltaHotelIndiaOscarRomeoTangoFowerSevenNinerZeeroQuebecSierraVictorYankeeCharlieFoxtrotJuliettUniformWhiskeyNovember

Variable: Word Search 2025-10-09

25 Items: of 1TermsEquationEvaluateInequalityan Equationan EquationThe number multiplied by a variablewith the same variable and exponent.A number by itself — it doesn’t change.TermA number that doesn’t change (no variable).all operations and combine like terms to make itequation where the variable’s highest power is 1....

Pythagoras Word Search 2025-10-09

16 Items: all of the numbersthe person who created the the Pythagorean Theorema number which produces a specified quantity when multiplied by itself.a number which produces a specified quantity when multiplied by itself.a symbol, typically a letter, that represents a quantity that can change or is unknown...

Smart Word Search 2025-08-07

100 Items: PenBayEyeDogSynSunLovePinkBackFakeBallBlueViewBakeTurnBookBeerDareRainDareHopeHomeRiseFeelCalmSmartPhoneSmileAppleLaughDreamHappyValidBlackWriteBrainBreadMusicHeartEnterDrinkPaperDailyHungerDesireHumbleSearchCoffeeDragonEnergyFamilyMobileHealthVanillaHonestyFreedomMindfulForgiveMessageNumbersCorrectBelieveBlessedFingersCompanyExamplePaymentRespect...

100 Days of Learning 2026-01-21

100 Items: PEbusArtTagTryMathGlueDeskTimeStarMusicLunchKruerBooksChairpaperTestsnamesMoneySmileSmartProudFocusLearnCountSchoolRecessShapesGraphsPlantsTigersReadingWritingLibraryFriendsTeacherPencilsCrayonsMarkersFoldersQuizzesPhonicsGrammarStoriesWeatherAnimalsHistoryIndianaRespectHonestySharingHelpingclassesfundays100DaysNumbersSciencePrinterJournalLearning...

Easter Bible Character Word Search: Find the name/people in the Scripture 2026-03-25

25 Items: Jude 5Ruth 3:1Amos 9:11Acts 7:35Acts 19:33Hosea 4:17Luke 11:431John 5:18Luke 19:32Joshua 19:11Samuel 9:72 Peter 2:5Psalm 121:7Exodus 18:1Isaiah 20:1Numbers 36:2Habakkuk 1:1Genesis 28:10Genesis 11:30Matthew 27:162Chronicles 4:19Deuteronomy 33:8Philippians 2:25Ecclesiastes 12:11Corninthians 4:17

vocabulary 2025-09-11

13 Items: software that damages a device or steals information.malware that spreads throughout a device and damages it.malware that watches and records information from a device.information that isn't true, often created to trick people.a statement that says what a website does with your information....

quadratic 2025-05-21

30 Items: 1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.Roots Solutions to a quadratic equation that are real numbers.Equation An equation of the form ax² + bx + c = 0, where a, b, c are real numbers and a ≠ 0.The value b² – 4ac which determines whether a quadratic equation ax² + bx + c = 0 has real roots or not....

Maths Units 1-6 Wordsearch 2023-11-20

14 Items: Per hundredTaking awayBottom of a fractionA four-sided 2D shapeA collection of elementsThe index, order or ......A fraction of the same valuePositive or negative numbersA number multiplied by itselfCan divide by only itself and 1A whole number times another whole numberInterest accumulated on consecutive years...

Error Detection Vocab 2026-04-22

15 Items: A reduction in the usual price.Extra money given for good service.A repeated design or recurring sequence in data.Something that is accepted as true without proof.A conclusion reached based on evidence and reasoning.Drawing a specific conclusion from general information.An extra amount added to the cost of goods or services....

Math Vocabulary - Grade 8 2026-03-25

22 Items: equal(0, 0)to moveto turnflipped imagerise over runstarting pointvaries directlyhas an equal signarea of four wallsenlarged or reducedspace inside a shapeevery x has only one yrelation in a line formoutside the data pointssame shape different sizehow much a shape can holdadding the outside numbersnot passing through the origin...

Do it Now (DIN) Find the numbers in Spanish 2024-12-20

10 Items: ElevenTwelveTwentyFifteenSixteenThirteenFourteenEighteenNineteenSeventeen

MATH VOCAB 2025-10-08

9 Items: algebraic terms that have the exact same variable(s)figures have the same shape but not necessarily the same sizean equation that is true for all values of the variables involveda way to express a fraction or ratio of a part compared to a whole or out of one hundred...

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Summer Vibes 2025-07-29

107 Items: SunAirNowMoonFireSoulAuraPastFlowAntiStopChartWaterEarthFixedThetaGuideKarmaLucidBeginRisingCosmicTranceAnchorMemoryHealerMysticSeekerMediumOracleSpiritEnergyDharmaAkashaFutureAstralSacredMirrorChangeAcceptCreateDeepenWisdomWeaverTransitMutableJourneyRelaxedDestinyPurposeDreamerTeacherChannelHealingRebirthAlignedCallingAlteredCounterNumbersCardinal...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Geometry Word Search 2025-04-01

32 Items: gleathgeoancedistanglequingleigletiondistacelesmetryaouteodtusactusecongrucalenethe study of shapesa figure with 3 sidesthe science of numberssame size and same shapea figure formed by 2 raysthe space between two pointstriangle with 2 congruent sidestriangle with 3 congruent sidestriangle with no congruent sidestriangle with 3 congruent angles...

Vocabulary Words 2025-09-13

8 Items: cheapexisting in large numberssomeone who is a beekeeperchemicals that kill certain plantsland that has indigenous wild grasses growing on itthe process of raising aquatic animals and plants for fooda type of farm that raises animals on large tracts of landdown the soft, warm under feathers of a goose-used to stuff bedding and jackets or vests

Sources of finance. 2023-09-02

10 Items: repossesstradepayablesretainedprofitexternalfinanceresources used or owned by a business.Long-term finance secured with propertyfinance provided by the owner of a business.generated by the business from its own means.one or a series of regular payments made until all the money owed has been paid off....

er 5 2026-02-13

10 Items: free from germsextremely angryfeeling hopeless and gloomyan unpleasant mix of loud soundsa temporary substitute for somethingin a way that shows devotion to religiona building used to house large numbers of peoplethe return of an illness after a time of recuperationboxes or crates used for hauling fruits and vegetables...

Listen Word Search 2023-12-13

12 Items: You make food to eat.You do this with music.You say the numbers out.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words on a book.You do this in a swimming pool.Birds do this with their wings.You use a finger to show an object.You make pictures with pencils and color pencils.

Eukaryotic Word Search 2025-10-20

6 Items: it is divided by that number.the two numbers are added togethera part of an atom with no electrical charge.the force or weight of air in the atmosphere.something is to watch it closely and note how it changes.it has complex cells with nucleid and may beeither unicellular or multicellular.

Technology vocabulary 2024-07-11

7 Items: Very popular on the internetYour online opinion about somethingA picture of yourself with your smartphoneA piece of equipment to make your voice louderInformation about about yourself on a social media siteTo transfer data or files from a computer to the internetInput gadget to enter letters, numbers, and other symbols into a computer

Numbers 90 and 100 2020-06-22

3 Items: oneninetyhundred

Word Search 2025-09-23

5 Items: A number that represents part of a whole.A comparison of two numbers using divisionAn equation that shows two ratios are equalHaving the same value, even if they look differentMultiply A method to solve proportions by multiplying diagonally across the equal sign.

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

April vocab #3 2026-04-27

10 Items: To multiply by 2an exact half of a sphereThe distance around a circleOpposite in effect. The reverse ofFinding an answer by using mathematicsTo cross over (have some common point)Any of the numbers that are added together....

Contact-Information Word Search 2025-09-11

12 Items: negative feedbackdetail like phone numbersinformation that isnt truerude action on the internetsoftware that damages a deviceinformation that could be dangerousmalaware that spreads around deviceholding files until victim pays moneypeople saying tey have a good experiencemalaware that watches from another device...

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Math vocab 2023-06-09

10 Items: The most frequent numbera value that acts outsideSubtracting larger from smallestOrder the numbers to least to greatestDivide and add many items in the data setrange the difference between two math termsof central tendency the values that result fromdata points The values that represent statistics...

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

Elements & Compounds 2026-02-20

22 Items: charges.The number of protons in an atom.Describes a pattern that repeats.The smallest particle of a compound.Horizontal rows on the periodic table.Anything that has mass and takes up spaceElements that look dull and break instead of bend.The total number of protons and neutrons in an atom.A particle with no charge found in the nucleus of an atom....

Cycle 1 Vocabulary Week 1 2024-08-27

5 Items: consists of variables, numbers and operationsmaking a statement or situation less confusedthe number of protons in the nucleus of an atoma person not in the armed services or the police forcethe refusal to comply with certain laws as a peaceful form of political protest

maths words 2025-04-28

32 Items: cubeDataOrdernumbernumbernumberspherecurvedAlgebraBracketsGeometryAnalysisAverage.OperationsProbabilityMiddle value.Most frequent value.The space within a shape.Term, factor, coefficient.The distance around a shape.Solve, evaluate, unknown, variable.Coordinate, axis, linear, quadratic.Total, equivalent, balances, the same as....

KAIJUxEIGHT 2nd MISSIOoooOn! 2025-10-06

20 Items: CODE: SV-023ashes to lightMidsized Kaijukapten divisi 1illusory - KB-09fineshyt. BE. G’NMhe weaves his talejulukan kaiju no. 1the most cheerful starthe beauteous black catsenjata keahlian hoshinapengguna Numbers Weapon 6nomor humaoid kafka hibinobringing good vibes and big energyfirst Kaiju to appear in the series...

Vocabulary Word Search 2026-03-10

8 Items: A quadratic written as x^2+bx+c.The number in front of a variable.An expression with exactly two terms.An equation with x^2 as the highest power.The U-shaped graph of a quadratic function.The value of x that makes the equation true.The highest power of the variable in an equation.Numbers or expressions multiplied together to make a product.

NCSAM 2025 Word Search 2025-10-08

10 Items: Social _____ attackBusiness ____ and Disaster RecoveryThis week's theme, "Your ____ Identity"4 letters; exposure to danger, harm, or lossintelligence that is not real, like sweetenervirus that encrypts your files & demands paymentAttempt to get info from a victim, or jam band from Vermont...

TA2.2 Day 5 Adjectives 2023-08-18

12 Items: When you feel sure, you are ___When you draw pictures, you are ___When you talk to everybody, you are ___When you study or work a lot, you are___When you do different things, you are ___When you think clear thoughts, you are ___When you want a sucessful future you are___When you are good with numbers, you are ___...

Math Vocabulary 2025-02-11

41 Items: Take awayAny number being addedWhere lines cross overlines that never touchHaving the same amount.the top part of a fractionan ordered list of numberscan be shown as fair shares.angle with exactly 90 degreesThe bottom part of a fraction.the answer to a division problemTo separate into basic elements.split into equal parts or groups...

Unit 6 Statistics Vocabulary 2025-03-04

24 Items: A guess or estimate based on patterns or data trends.A method of collecting data by asking people questions.The entire group being studied in a survey or experiment.– The number(s) that appear most frequently in a data set.A ratio that compares one part of a group to the entire group....

Hundred Word Search 2025-01-29

10 Items: Adding numbers to reach 100!The person who helps us learn!What we have on the 100th day!What we do in school every day!The people we learn and play with!The number we are celebrating today!To have fun and enjoy a special day!The place where we learn and have fun!After 100 days, we have learned so much!...

Ancient Israel Vocab 2025-04-28

13 Items: Wise sayingA belief in one godAn agreement with GodA Jewish house of worshipWeekly day of worship and restA sacred song or poem used in worshipTeachings that Moses received from GodPrepared according to Jewish dietary lawA forced absence from one's home or countryA rule that God wanted the Israelites to follow...

Unit 3 Vocabulary 2025-10-31

13 Items: The flip of a fractionReduce or make simplerComparion of a part to partA comparison of two quantitiesRatios with equal cross productsMeasurement system used in the USComparison of the section to totalComparison of the total to a sectionA rate that compares a quantity to oneMeasurement system based on multiples of 10...

Math Vocabulary Word Search 2024-04-26

100 Items: rise over runa fixed numbera ratio out of 100a six sided figureeight-sided polygona five sided figureone output (y value)a three sided figurethe answer to a problemequal in value or amountthe perimeter of a circlea polygon with four sidesof, relating to statisticsthe slope of a vertical linethe top number of a fractiondistance a number is from zero...

MAth project 2025-10-09

9 Items: ax+bax+b=0a2 + b2 = c2.A number raised to the power of 2.A number that cannot be written as a fraction.A number that can be written as a fraction or a decimal.A neat and quick way of writing very high or low numbers.A number that is product of an integer multiplied by itself....

Building the Frozen Ark 2023-11-17

15 Items: necessary (par. 8)causes harm(par. 5)a replacement (par. 4)related to ecology (par.6)poisonous substances (par.6)state of being aware (par. 8)calculate approximately (par.2)a particular kind of material (par. 3)act of preserving or keeping safe (par.7)having the appropriate qualifications (par.7)relating to or consisting of molecules (par.5)...

Unit 1 Vocab Word Search 2026-03-15

12 Items: the top of a fractiona number less than zerothe bottom of a fractiona number greater than zeroa number that is divisible by 2a number that is not divisible by 2an acronym for the order of operationsa number with factors besides itself and 1a number whose only factors are itself and 1the positive and negative whole numbers and zero...

Coefficients 2025-10-08

12 Items: A term that contains a variable.All whole numbers and their negative counterpartsThe numerical factor multiplied by a variable in a term.Number Any number that can be expressed as a fraction as a decimalRules that allow you to manipulate equations or inequalities while maintaining their truth....

Digital Citizenship 2025-11-13

10 Items: A picture of your faceYour month and day of birthA secret word you use to log inA long word meaning “kept to yourself”What adults use to send electronic mailYour special name that tells who you areA number that belongs only to your phoneThe numbers and street that tell where you liveWhat you should always ask a grown-up before sharing online...

Letters and Numbers search:- Find the letter and number combinations hidden in the grid below 2025-01-23

20 Items: Z0G5S4UYBC740G9ND7Q3DAH9DY1P5SB64IBRE7LDG5ZAUJPTQB8F0OO18ZO2H96GX9JA42UF2B0GPM10

die of death + forsaken word search (no 1x, guest 666 or guest 1337 because numbers) 2025-12-18

20 Items: nolinoobtaphtauntartfulharkenchanceelliotbadwarepursuerslasherjohndoetwotimecoolkiddloveshotdussekarkilldroidveeronicabuildermanshedletsky

Math 8th Grade Word Search (By Abdul Wassay) 2025-10-07

15 Items: the higher and bigger numberthe smallest and lowest numberdescribes the steepness and direction of a line on graphdescribes the steepness and direction of a line on a grapha comparison between two values or expressions that are not equala value that, when multiplied by itself, produces the original number...

WORD SEARCH MATH 2025-10-07

17 Items: oppositeunite/mergekeyword for addopposite operationfigure out a problemkeyword for subtractionhas 2 legs and hypotenusekeyword for multipilicationa number multiplied by itselfterms that have the same variablelongest side of the right tringalea symbol in math that has a certain valuea math problem with words instead of numbers...

Motion Word Search 2026-02-17

30 Items: liquid to gasliquid to solidsolid to liquidWater at 100 degrees C.The name of our galaxy.Measures kinetic energy.Distance divided by time.Atoms move independently.The ability to perform work.A change in position over time.Described the force of gravity.How much matter an object possess.The force you use to move your body....

Unit 3/4 Vocab Word Search 2026-03-15

9 Items: to make a value largerto make a value smallera ratio that compares a number to 100a type of rate where the denominator is 1a visual model used to solve percent problemsa type of relationship with a constant unit ratea measurement of the "steepness" of a line on a grapha comparison between two numbers, can be written as a fraction...

The Number System 2026-03-15

12 Items: the top of a fractiona number less than zerothe bottom of a fractiona number greater than zeroa number that is divisible by 2a number that is not divisible by 2an acronym for the order of operationsa number with factors besides itself and 1a number whose only factors are itself and 1the positive and negative whole numbers and zero...

English for Engineering Review 2025-12-09

28 Items: not easily bentSI unit for massmoney that is lenta five-sided polygonthe bottom of a wavethe shape of a columna unit for measuring anglesthe simple machine that is a rampa tool for turning screws by handto decrease the speed of somethingdetailed list of all the items in stockrelating to numbers; expressed in numbers...

Hundred Word Search 2025-11-03

10 Items: – What students do every day at school.– To have fun and enjoy the special day.– To say numbers in order, like 1 to 100.– A simple way to count by marks or lines.– A big paper that shows 100 items or drawings.– A group of 100 things students bring to show.– What students become after 100 days of learning....

Unit 1 Vocab Review 2025-08-21

14 Items: Trade over oceans or seasThe study of stars or spaceA writing system for numbersFrench followers of John CalvinTo disagree with official opinionThe belief in the good of humanityCharging extremely high interest ratesA movement to change the Catholic ChurchA period of cultural rebirth started in ItalyPeople should be able to make their own choices....

Verbs 2023-12-16

16 Items: You make food to eat.You do this with music.You say the numbers out.You do this to your hair.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words in a book.You do this with a toothbrush.You do this in a swimming pool.Birds do this with their wings....

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

DO IT NOW- DIN - Review greetings, numbers, day of the week (1) 2024-12-20

11 Items: tenhelloeightMondaySundayelevengoodbyethank youGood morningGood eveningGood afternoon

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Celebrate Word Search 2025-11-06

10 Items: – A promise you make for the new year.– Something you remember from the past year.– A fun gathering with friends, food, and music.– What we say when we leave the old year behind.– To enjoy a special time with happiness and fun.– A feeling that good things will happen next year.– Counting numbers backward to welcome the New Year....

SOF final project 2024-06-05

15 Items: Putting values where the letters area polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic sectiona quantity that may be changed according to the mathematical problem...

WORD SEARCH UNITS 1 & 2 2026-02-10

24 Items: happyworriedin good shapenot decoratedwilling to helpbroken or harmedtelling the truthnew completely newnot ordinary or usualhelping you do thingsrelaxed and not worriedexisting in large numberscaring only about yourselfold and not useful anymorequiet and doesn't laugh a lotable to be trusted or believednot helpful; doesn't work well...

ACP Final 2025-05-28

20 Items: - An algebraic expression of three terms.- The number in front of the variable or term.- An expression of two or more algebraic terms.- The set of all possible inputs for a function.- A function that serves to “undo” another function.- A equation that can be rearranged in standard form.- Any mathematical expression which uses a root symbol....

Vocabulary #9 2025-11-07

9 Items: gets larger in sizethe sum or whole amountalso known as partioninga method used to find an answeran answer based on good number sensegets smaller in size, number, or quantitytwo intersecting lines that have four right angles formed at the intersection pointsform of a fraction in which the numerator and denominator have no factor in common except 1...

Lost 2025-11-13

129 Items: jinsunekovanconrumconjackwaltkaterosealexjohnyemifatetarpraftswanhugogolfboargunsbookfilmjeepwinesayidjameslockeboonerogerpennyjacobaaronlibbycagessharkhorsehatchflamepearlstaffhydrapurgeknifekeamymilesnaomibonesfaithplanecabinwaterheartjulietsawyerclaireeloisehurleyharperpylonsbuttonstatuetempleorchidcoffinhoraceotherspriestmichaelvincentgoodwin...

WHI.2 Vocabulary Practice 2025-01-15

12 Items: Old Stone Age ____________________New Stone Age ____________________more than necessary; excess ________________skilled craftspeople; specialized labor ______________second of the three principle ages (Stone, ______________, Iron)transition from nomadic life to settled farming _____________________...

Science and Homeostasis 2024-10-01

14 Items: Internal balanceWhat you compare results toVariable that is on the Y axisVariable that is on the X axisThe body system that releases hormonesWhat the skin does when you get too hotTerm for the body getting rid of wastesA type of loop that counters the stimulusBlood vessels do this when you get too hotA measure of how fast your heart is beating...

Palabras al Azar 2023-03-07

20 Items: a sneaky animalan extoic fruitMan's best friendthe color of an applemoisture for the skina device you play withword describing an injurya color on the Honduras flagwhat people drive on an dailytrips people take to get awayword describing having to waittype of support to help you seeword describing a tiring feelinga subject dealing with chemistry...

anything 2023-10-17

130 Items: foxelfbobgrut5grumlegarmsunsindayredpitcatdogabsicealexlinkwolfferbryanolafelsaannasmg4smg3smg2smg1smg0taribookbootkidscakerakezurgxmasreadgearkingnosejakenerdricelambfaceveryvasepinkbluejokelakelakeirisbearmariopeachstevewariozeldaganoncappysamussnakemidassloneluigikirbykevensantaplutogoofypeteymeggyjonesdumboblazeninjatablesnackapplewoodymelon...

Vocabulary 7 2026-03-31

20 Items: FarewellDangerousVery importantFalse, counterfeitThe highest point; tipThoughtful; melancholyAn idle wanderer, trampNoisy; unruly, disorderlyAngry and bad-tempered; rudeUnreasonably high; excessiveTo speak evil of; slander, evilLively, full of life; spicy, flavorfulAn arrival; a coming into place or viewA large city; the chief city in an area...

Provider Data Management 2024-12-18

15 Items: Line of BusinessNational Provider IdentifierGroups that do not need an NPIDepartment that signs up new groupsSystem used for Roster management toolMissing and/or incorrect required fieldsThird party vendor for dental/vision benefits10 digit code that includes numbers and lettersThird party vendor used to house data/pay claims...

ancient math 2025-10-10

1 Item: geometry numbers greece

Listening Word Search 2025-03-05

10 Items: This quality makes sure you don't give up.This skill means you are good with numbers.This skill means that you can direct others.This skill allows you to keep thing in order.This skill means you have good written skills.This Skill makes sure you get the right answer.this might be a word used for a problem solver....

Melanie Martimez 2024-04-09

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesheartediscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunction...

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

New Testament Books in Order (minus the ones with numbers and Revelation). 2020-06-26

10 Items: MarkLukeJohnActsJudeTitusJamesRomansMatthewPhilemon

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Spalling Word Search 2025-07-18

2 Items: Customers residing in older flats regularly face this issue: ________ concrete(Abbreviation) Use this to generate queue numbers for customers who come to the branch