new years Word Searches

Dani's 2025 Hyperfixations 2025-12-01

10 Items: Dumb-dumb want gum-gum.The resident mama's boy.Benito Antonio Martínez Ocasio.The SSRI that turned Dani's life around.It's Dani and her KitchenAid stand mixer against the world.An aromatic material that releases fragrant smoke when burnt.Traditional handmade wooden figurines used as incense burners....

Shakespeare Word Search 2025-02-11

10 Items: The author of Brave New WorldThe British author of 1984 and Animal FarmThe English author of The Lord of the RingsThe American author of The Old Man and the SeaThe author of romantic novels like Pride and PrejudiceThe British author best known for the Harry Potter seriesThe American poet known for poems like The Road Not Taken...

Harlem Renaissance Word Search 2025-03-26

10 Items: Langston died in this monthWhere did many African Americans move from?This music was created during the Renaissance.Georgia Douglas Johnson graduated from this universityWhat New York Neighborhood, was essential to this Renaissance.What is the last name of the poet who wrote "I too sing America"...

Storytelling Vocabulary 2025-04-14

10 Items: IMAGINE : To form a picture or idea in your mind.MAGICAL : Related to magic, having special powers.VILLAIN : A character who opposes the hero in a story.EXPLORE : To travel or search for something new or unknown.ADVENTURE : A journey with exciting or dangerous experiences.MYSTERY : Something that is difficult to understand or solve....

Leadership and Teamwork 2025-04-14

10 Items: Delegation : Assigning responsibility or authority to another person.Collaboration : Working together with others to achieve a shared goal.Empathy : The ability to understand and share the feelings of another.Negotiation : A discussion aimed at reaching an agreement or compromise....

If He Had Been With Me Word Search 2023-05-22

10 Items: An outcastThe quality of being naiveThe quality of being eccentricIn a forceful, passionate, or intense mannerA feeling or atmosphere so intense as to seem almost tangibleUpholster with new materials, especially with a different fabricA house divided into two apartments with a separate entrance for each...

Module 4 Week 1 2025-10-15

10 Items: - Continuing to try even when things are hard.- To work together with others to reach a goal.- A large, flat area of grassland with few trees.- The order in which things happen or are arranged.- Clues or details that help prove something is true.- To separate grain from the plant, usually by beating....

Columbianexchange Word Search 2025-01-15

20 Items: Refers to Europe, Africa, and Asia, which were connected before the Columbian Exchange .Refers to the Americas, which were introduced to Europeans after Christopher Columbus's voyage in 1492 .An agreement between Spain and Portugal in 1494 dividing the newly discovered lands in the Americas between the two nations ....

Mishnah Megillah 2024-03-07

18 Items: Purim is on the _ of AdarWe add this month in a leap year__ l'evyonim (gifts to the poor)The Hebrew for "by heart" - al __A leap year in Hebrew: A shana ___mishloach ___ (gifts to our friend)Hebrew word for "put his mind to it"They spoke this language in BabyloniaYou cannot read the Megillah out of __Babylonia is in modern-day country of _...

Vocab Practice - 3/31-4/4 2025-04-01

17 Items: I ____ to do my best every day.There have been 3 _______ presidents.I had to ask my teacher for a ____ to Uni.During the tornado, the walls of the school ______.A math problem of this ______ requires deep thought.Having a test on a Friday is often _____ to students.It's important to never _____ someone who is determined....

Medicine 2024-07-03

6 Items: You put it on your woundsA tube used by a doctor or nurseYou take them to grow well and be healthyYou spread it on your skin, esp arms and legsPeople who can't walk sit on it and move through it...

Nursing Shortage Word Search 2023-12-01

4 Items: Support What is one reason new graduate nurses are leaving the workforce?Delegation What is one way we can help support nurses regards to staffing ratios?Telehealth What is one of the technology advancements that is helping to decrease nursing shortage?...

Richard & Alexa 2025-04-08

20 Items: Who is the best man?Where is the honeymoon?Who is the Maid of Honor?Who said I love you first?What is the brides eye color?What is the grooms eye color?What is the brides middle name?What is the brides mother's name?Where was the bachelorette party?What is the couples favorite food?What is the grooms favorite hobby?...

Religion Terms 2024-11-13

20 Items: - Jesus’s Birth- believing in god- dedicated to god- to communicate to god- a building to worship god- to show your faith to god- to do good and avoid evil- thanksgiving , saying thanks- a community of Jesus’s followers- a male who commits themself to god- a religious ceremony such as baptism- a female who commits themself to god...

One Team, One Mission Word Search 2025-05-13

15 Items: North ____ HealthcareOne ____, One MissionHigh ______ OrganizationNCH embraces a ______ cultureToday (Thursday)'s dress-up themeBehavior Standard beginning with CAcronym for our new standards of behaviorA week-long opportunity to celebrate our staffAt NCH, we engage in open and ___________ communication...

POSTIES 0311 Big Read 2024-02-26

6 Items: another word for rubbishthe opposite of simple and easy to understanda food that is used with other foods to cook a disha piece of electrical equipment that keeps food cold so it stays freshused to describe items that can be processed and used again to create new products...

Jose Velez Examines President Trump 2025-07-08

24 Items: Jose ______ VelezFirst Vice PresidentMake ___ Great AgainPresident Trump's WifeMake America ___ AgainCatch Phrase: "You're ___"Trump Book: The Art of The ___Second (Current) Vice PresidentSignature Building: The ___ TowerStarred on reality TV Show The ___President Trump does not drink ___Graduated from New York ___ Academy...

Honors 9 Quarter 1 Roots 2025-09-26

35 Items: newtimefootyearselftimesleepwatercolorto turnbrotherto honoraway fromgood or wellall or everyform or shapealone or onlyflow or changesound or voiceto know or learnto hear or listentwo; apart or awayto believe or truststar or outer spaceto send or to let goall, every, or wholeto conquer or overcomestraight, correct, rightwith, together, or jointly...

When I was Puerto Rican 2024-10-01

7 Items: sullen and ill- tempered; gloomy or in a bad mood.to voluntarily cease to keep or claim; to give up or surrenderin its original condition; unspoiled; clean and fresh as if newnot logically connected; unclear or difficult to understand; lacking cohesionnot expressing or revealing commitment to a definite opinion or course of action....

Clean & Connect Word Search 2025-09-17

5 Items: The careful use and protection of natural resources to prevent depletionA community of living things interacting with each other and their environmentAnything that is discarded or no longer useful, often a byproduct of human activityThe process of turning used materials into new products instead of throwing them away...

Matt and Grace's Love Story 2025-02-04

17 Items: Matt's specialty homemade dishThe couple's beloved furry companionMatt's new title for outdoor cookingSchool where Grace is pursuing her MBAWhere their story began on a muddy dayEssential morning ritual for the coupleProfession shared by both Grace and MattWhere Grace and Matt moved to live togetherFavorite game to play with Dakota at the park...

Editing 1 101025 2025-10-13

13 Items: A specific type of ground or land.A very brief, quick look at something.(Of water) cloudy, muddy, or not clear.Not mapped or explored; unknown and new.The difference or contrast between things.An animal's natural mood or way of acting.By mistake or accident; without intending to.VALUE The obvious or apparent meaning or worth....

health and safety 2023-02-27

15 Items: warm cover on a bedvery quickly, without waitingtaking air in and out of your bodysheets,covers.that you put on a bedto cover something with cloth or paperthe possibility of being hurt or killedto leave a place because it is not safepeople who come to help you very quicklydoing something when someone talks to you...

Tennis Grand Slams 2025-03-04

15 Items: The surface for Wimbledon.The surface for Roland Garros.The famous treat at Wimbledon.The only Grand Slam played on clay.The official cocktail of the US Open.The moment a player can win the match.The award given to Grand Slam winners.The official summer drink at Wimbledon.The oldest and most prestigious Grand Slam....

Top Customer 2025-09-19

7 Items: Who has a list of top customers for the branch?It is our job to ___ ___ ___ for our top customers!When does the bank add new qualifying top customers?What fees are automatically waived for top customers?Where can the top customer identifcation be found in Premier Navigator?When does the bank drop customers who no longer qualify as a top customer?...

SAUL’S CONVERSION 2023-04-04

1 Item: MEANS THAT ANYONE WHO BELONGS TO CHRIST HAS BECOME A NEW PERSON THE OLD LIFE IS GONE A NEW LIFE HAS BEGUN CORINTHIANS

Fourth 2025-04-17

34 Items: cams sportisaiah's lastAhmed nicknameMiguel nickameJett raises...Girble wears...johnny just gotDavid last nameguillermos aliastroy's twin nameJett school clubDavid's team matelogo david hoodieThree letter nameJack black yells..Chews football teamJohnny just got....Mauricio's nicknamexzavier's main sportAbram listens to....New student in class...

Thin Word Search 2025-05-09

149 Items: newpieinnwaydiebaythinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadefirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgiantwoundbuildblamelearnsiegetwistdelaymanagepublicstrollnotionremaintoppleimportminutepleasedangerpacketthroneseriesexceedcattledefinevoyage...

Frederick tiene 25 años! 2023-10-05

60 Items: tioamordudekatiefritotargetmi gymwalmarttu noviatostonestu madretu padretu perrotu hermanapickleballTe amo in Englishtu deporte favoritoun vuelo en españolel nombre de mi perroI love you in Spanishdonde nació tu madre.no son plátanos son...?el parque con la canchael lugar que vende tacoslo que tu estás estudiandoamor verdad de Ricky (hehe)...

Echo Prea Word Search 2025-08-10

20 Items: The year PREA was signed into lawA person confined in a juvenile facilityA person who has experienced sexual abuseA confidential way for inmates to report abuseKeeping reports and victim identities protectedThe act of notifying staff or authorities of abusePREA standard requiring no tolerance for sexual abuse...

Unit 3 2025-10-22

16 Items: the right to votethe people eligible to voteredistribution of congressional districtsthe people whom an elected official representsThe official election committee for president.count of the nation's population every 10 yearsAn election where candidates are not associated with a political party....

Immigration and demographics 2025-03-04

21 Items: Legal membership in a country.Official count of a population.A society with many cultural groups.Population growth through birth rate.Official permission to enter a country.Emigration of educated or skilled workers.A person forced to flee their home country.Moving to a new country to live permanently.Leaving one’s home country to live elsewhere....

Immigration and demographics 2025-03-04

21 Items: Legal membership in a country.Official count of a population.A society with many cultural groups.Population growth through birth rate.Official permission to enter a country.Emigration of educated or skilled workers.A person forced to flee their home country.Moving to a new country to live permanently.Leaving one’s home country to live elsewhere....

4 Years With You 2025-07-19

1 Item: 123

From the Garden to the Cross 2025-04-01

9 Items: JUDAS (The man who betrayed Jesus with a kiss.)LOVE (The reason Jesus willingly bore suffering.)HOPE (A quality that sustains believers in dark times.)WATCH (What the disciples were urged to do while Jesus prayed)SACRIFICE (The ultimate act of sacrifice given by Jesus on the cross.)...

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

unit 7 2024-05-01

14 Items: increase demand for waterused to extract substancesone strategy to deforestationused to remove natural gas and petroleumground sinking down into open spaces belowlow population density areas outside the citycities fall apart as people migrate to the suburbsthreats include soil erosion, soil compaction, etc....

Vocab 11 2024-02-16

12 Items: After running 3 miles water is ____.It would be ____ to question her actions.I would love to stay but i don't want____.The new brand _____ all of its competitors.in Order to ______ form a more perfect Union.To ____ i got this answer right i looked it up.Sally's boyfriend didn't dare cross over Sally's ____....

Week 4 2024-09-09

9 Items: plan of the bookthe message the story is tellingthe place were the story takes placethe conclusion and ending of the conflicta sheltered state or stage of being or growthhe elongated wormlike larva of a butterfly or moththe situation between the Antagonist and Protagonist...

Hair 2025-10-21

9 Items: hair only found on new born babiesthe pigment found in hair and skin.the first stage of the hair growth cyclethe final stage of the hair growth cyclethe middle phase of the hair growth cyclescale like cells found on the outer layer of the hairthe base of the hair follicle and produces germ cells for the hair....

Moses Word Search 2024-10-13

13 Items: Who was Moses' sister?What was Moses' job when he worked for Jethro?Where did God Give Moses the Ten Commandments?What burning object did God use to speak to Moses?Who did God use to lead the Israelites out of Egypt?Moses used his staff to get water out of what object?How many years did Moses lead the Israelites around the desert?...

Mother’s Day Word Search 2023-05-13

26 Items: what’s your favorite color?Who did you go to prom with?what’s your favorite desert?what cold sport do you love?who’s your ride or die friend?what’s one luxury car you want?what’s your least favorite thing?what’s your favorite music genre?what’s your favorite thing to do?what’s your favorite song by SZA?what’s your favorite type of food?...

Kehan & Milleni 2024-09-04

25 Items: The bride's favourite fruitThe bride's dog's full nameThe groom's favourite sportThe month the groom proposedA fruit that the groom hatesThe groom's favourite cocktailThe hospital the groom was born atThe suburb the couple just moved toThe host of the bride's favourite showA chore that only the groom will ever do...

Loversky Word Search 2025-05-01

9 Items: Favorite Movie: "I am Iron-Man"Favorite Song: "Sing Along! ___ ___, Take Me home"Favorite Color: like from the cookie monster to the skyFavorite Subject: reading and writing to understand our worldFavorite Book: A book where a wardrobe leads you to a new worldFavorite Drink: A refreshing and essential drink most people love...

Congress Word Search 2025-10-06

19 Items: meaning two chambersOne of your US Senatorsthe lawmaking branch of governmentthe vote taken to end a filibusterthe number of members in the Senatethe process of redrawing district linesthe type of representation in the Housethe type of representation in the SenateYour US House Representative for District 5...

New start 2022-11-11

1 Item: exercitiufizic apa soare temperanta aer recreere incredereindumnezeu

Natural Selection Word Search 2025-07-18

10 Items: The ability of all owls to see at night is an ____.Only organisms that ____ pass on their genes to another generation.An animals ____ determines which adaptations are helpful and which are harmful.An example of ____ is that both zebras and antelopes eat the same grasses and plants....

Medieval Europe & The Middle Ages 2024-04-03

21 Items: plaguepitsPeasant: A farmer or poor labourer.Century: A period of one hundred years.Sanitation: Availability of clean water.Medieval: Another name for the Middle AgesSymptom: Evidence a person has an illness.Nobles: Wealthy class in the feudal system.Agrarian: Of farming or cultivation of land.Servitude: To be a slave or subject to someone....

Pathways Word Search 2025-09-12

20 Items: Skills needed to obtain and maintain employment.Organizing your schedule to complete tasks on time.Working effectively with others toward a common goal.A trained professional who provides therapy for clients.A worker who provides care and supervision for children.A professional who advises people about money decisions....

Vocabulary 8 2025-01-23

12 Items: Mrs. Jaggers is very _______.The driven young man _______ to greatness.The girl had the _________ after her cat died.The old lady began to _______ due to dementia.Snail mail ads are sometimes addressed to ________.The class came to a _______ about the theme of the prom.The man was a _______; he ate the entire pie on his own!...

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

welcome to post student life 2025-09-04

16 Items: Liquid motivation for 8 a.m. classesOne person works, everyone gets credit.When sleep and sanity file for divorce.When 12 months just isn’t enough stress.That one-page drama of your entire life.The only social media you update monthly.The mysterious force deciding your future.Where “Can you hear me?” is the new hello....

Blatant Word Search 2024-10-20

10 Items: ( the way someone see something)(creating news using photographs)(done openly and don't care about it)( a claim to make a different point than a earlier claim)(a story written or told on someones account about an event)( assert that something is what is true without using evidence)( using someones name or something they mode with out authorized...

Benefits Word Search 2025-05-01

10 Items: Who is our Vision providerWho is our 401K/403B provider?Where can I find a list of my benefits? (abbreviation)How many days does a New Hire have to enroll in Benefits?Who is our Dental provider? ____ Cross Blue Shield of TexasWho is our USRC/SHC Employee Assistance Program (EAP) with.Who would receive my life insurance benefit once I pass away?...

JACOB SEEKS A WIFE 2025-10-11

1 Item: JACOB, YOUNGER, LABAN, LEAH, WORK, LOVE, DECEIVED, RACHEL, SEVEN, OLDER, BEAUTIFUL, DAUGHTER, YEARS, HARAN, SHEPHERDS, WILL, MARRIAGE, STONE, SHEEP, TRICK

0816 Here we go ! 2022-08-16

20 Items: The gas helps the dough ____.These CDs are round and _______.This bread ____ looks very soft.Be careful around the hot ______.These chips are really _________.You can _____ butter on your bread.Water is ________ in the red kettle.Artists ________ beautiful paintings.He sat down in the ______ of the room.You can _____ one and two to make three....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

just about every word 2023-10-01

158 Items: ashiifinnoonupandantbigbutbedbancatcanendelffryfanfatforgetgodhowlowmommannapnewpanpadvetwetyesyumbendbandboatboltcastcasecopydowndumbdoneeasyfirefoodgamegoodhelphandhoophosehowliowajumpjunejulylionlesslumpmoonmissmalemallnoonoverohioridereadstepslamsongsendtimetestundowordwhatwildxrayyarnyoyozoneaprilblamecrapecloneflamefloorfryergummygoosehello...

No Place Like Home 2025-04-29

22 Items: purple Texas wildflowerThe beach we frequentedMy ______ is back in TexasRicky's favorite University- Music festival abbreviationCity where all the yuppies live- Town where Ricky's dad residesFunny name for the collie at A&MExtravagant decor for prom girlsTexas team with pointy head-thingsThe best grocery store in the world...

Echo Word Search 2025-08-09

25 Items: "Sicko Mode" rapper?Kanye West’s new name?"Peaches" singer (2021)?SpongeBob’s best friend?Who is Batman's alter ego?Tony Stark’s superhero name?Who sings “Blinding Lights”?Meme frog known for being sad?Most-used app for viral dances?Who runs fast in the DC universe?GOAT soccer player, Messi or ___?Green Jedi Master from Star Wars?...

Switcheroo Word Search 2024-04-13

24 Items: Bertle _____Aussie cowboy hatOne main characterWhite trunked treesJool's mum's recipeAn inhospitable regionThe station competitionHayley's New York hobbyThe other main characterOne of the station ownersThe nickname given to HayleyChantelle got fired from hereSlugger's favourite lunch foodHis girlfriend nicknamed him this...

fans 2024-09-10

160 Items: gohimybinbeebusbuncupcandendindigeareyeendfunfanfogfadgodhueheyiceinkivyjimjamjoykitmapnodnewnotnapnagnetowloiloptawedballboonbabybackcoolcoldcampDeepdirtdeskdatedoordivedockfacefrogfeedgamegirlgoalgoldgluegoathoophookhandheadheelheapideainchiranjailjustjacklogomeltmilknamenestnicenotenailnetsbloomblissbirdsbelowchaireagereagleeruptexertglovegoose...

July Wordsearch 2025-05-03

20 Items: A cooking device used outdoors.gear Equipment for outdoor adventures.A popular cold drink served at picnics.Activity involving visiting new places.Eyewear to protect eyes from sun glare.Footwear commonly worn during hot days.Moist air, often high during the summer.A central theme of national celebrations.Handheld fireworks used during celebrations....

Back to School 2025-08-03

20 Items: The adult who teaches the class.Schoolwork you take home to finish.The room where you learn at school.A tool used for writing or drawing.A book with blank pages for writing.A table where students sit and work.A child or person who goes to school.The solution or response to a question.Looking at words and understanding them....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Project Management 2024-10-03

15 Items: Moving from the old to the new."a push in the right direction".8-Step Project Management Theory.Going against the flow of change.Run according to law or regulations.Carrying out change within a business.Kotter and Nudge are 2 examples of this.The process or activity of running a business.Competition to your business is referred to as......

Board Games 2023-12-21

10 Items: the game that can be played in braille: unothe game invented in New York in 1938: scrabblethe game invented by the Kohner Brothers: troublethe game invented in 1957 by a French filmmaker: riskthe game that can be played on a chess board: checkersthe game with 400 possible moves after each move: chess...

Good Laboratory Practice 2024-05-20

20 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs proposedYear GLPs finalizedThe first A in ALCOAThe second A in ALCOAYear GLPs written into lawSingle point of control for a studyDescribes how a task is done on a studyCurrent Summary of training and experienceFormed because safety of animals used was at risk...

MARVEL CINEMATIC UNIVERSE FILMS WORD SEARCH 2024-05-22

37 Items: THORBLADEANT-MANIRON MANETERNALSBLACK WIDOWTHE MARVELSTHE AVENGERSTHUNDERBOLTSBLACK PANTHERDOCTOR STRANGETHOR: RAGNAROKCAPTAIN MARVELAVENGERS: ENDGAMETHE FANTASTIC FOURTHE INCREDIBLE HULKTHOR: THE DARK WORLDANT-MAN AND THE WASPAVERGERS: SECRET WARSSPIDER-MAN: HOMECOMINGAVENGERS: INFINITY WARTHOR: LOVE AND THUNDERDEADPOOL AND WOLVERINE...

DNA Replication & Protein Synthesis 2024-10-06

22 Items: start codonReplicate AAGBackbone of DNA & RNAWhat does GCU code for?What does UAA code for?The process of making mRNACytosine binds with _______The process of making proteinsProteins are a made of _______Transcribe the DNA code: GATGCACTAThe process in which DNA is replicatedUnlike DNA, mRNA can _____ the nucleus...

Funny Ham Radio 2024-11-19

25 Items: "More power!""Beep boop beep.""How strong am I?""Is this thing on?"Wart (power supply)"Ham radio in space!""Hopefully it's low!""I need more spectrum!"Load (not the operator!)"Chasing those rare ones.""Who can talk the fastest?""Gotta keep the noise down.""My other antenna is a dish.""Just chatting with friends.""Sounds like a blender in here."...

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

IIM And LD Module 2023-09-29

26 Items: Where we put notes in the module.The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We typically search for claims using the ____.We send the procedure packet on the _________ tab....

ORIGINAL 2023-02-21

1 Item: genuine, true, innovative, unique, creative, unconventional, fresh, new, inventive

Películas clásicas icónicas de los años 70, 80, y 90 2024-09-13

15 Items: friendly alien wants to phone homeGiant shark terrorizes Amity IslandHenry Hill’s rise and fall in the mafiaDinosaurs run wild in a modern theme parkMafia family drama led by Don Vito CorleoneUnderdog boxer rises to fame in PhiladelphiaA priest battles evil to save a possessed girlA time-traveling cyborg is sent to kill Sarah Connor...

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

F6 Module 3,3a 2023-11-20

44 Items: (n) uba(n) õlg(n) mask(n) rütm(n) pähkel(n) kostüümellu ärkamavaimustuses(adi) kuldne(adj) tüdinud(adj)pettunud(adj) ovaalnetänavarongkäik(n) toit, roog(v) valmistamahiilgav, särav;(n) ahv, pärdik(adj) üllatunudtraditsioonilineparaad, rongkäikmuistne; antiikne(adj)kurb; õnnetu(n) orkester, bändpidulik tähistaminegigantne, hiiglaslik...

Earth Structure Word Search 2024-04-24

20 Items: study of rock layersmolten rock above Earthmolten rock below Earthmovement of rock overtimesmaller particles of rockbreakdown of rock overtimehottest part of Earth's layersettlement of rock in a new locationpart of Earth's layer that we step onrock formed by the cooling of lava/magmarock formed from compaction of sediments...

the scourge made in psd 2025-05-20

35 Items: chainsdiseaseconfessstarvingto scarecurse worda hospitalto put downdellas fatherlong windy pathfeel bitternessbusy and crowdedno pity or mercyto commit or helpani's best friendhard piece of skinto heavily destroyhanging in the airable to catch firea guard of a prisonto try and break freevisible or vulnerablebetter than or greater...

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

Jennie's 2023 Wrapped in 23 Words 2023-12-23

23 Items: Klaus - My favorite holiday movie. Find it on Netflix!Raccoons - A family of five of them lives in our backyard.Barbenheimer - My favorite 2023 holiday. Cinema's back, baby.Apple Tree - We planted one this year, and it grew three apples.Trader Joe's - My favorite grocery store of 2023. Try the kimbap!...

All about the Lab Word Search 2025-04-08

15 Items: AlarmingThe name of our labThe platform we analyze raw data onThe last master mix that is made is_Name of the folder .txt files go into_ process has Molecular Inversion ProbesAn equipment that fluctuates temperaturesCompare these on the tubes and worksheetsThe machine needed to spin down a plate is a _SOP version of the document we use for Analysis...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

V5 1-16 2025-10-30

17 Items: – not afraid; brave.– easy to reach, enter, or use.– taken away by force; kidnapped.– not able to bend or change easily.– told or taught how to do something.– taking away an amount; subtraction.– a person who gathers and shares news.– rude or unkind behavior toward someone.– not being accepted or being turned down....

The Word Search 2025-04-19

6 Items: the introduction of harmful substances or products into the environment.the presence of harmful substances in the environment, making it unsafe or unclean.the protection and careful management of natural resources to prevent their depletion.the process of converting waste materials into new materials and objects to reduce waste....

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Online Activities 2025-10-30

8 Items: email To open your email and read or send messages.music To listen to music online without downloading it.games To use your phone, computer, or console for fun games.online To buy things on websites or apps instead of in a store.videos To see short or long clips online, like on YouTube or TikTok....

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

POSTIES 0127 BIG READ 2024-12-27

6 Items: Oyster shells are mostly made of _____.to make new objects out of waste materialused to describe someone who is slow to act because they feel uncertainBefore the oysters can be sent to Green Island Cement, the hotel staff must _____ and store them.a grey powder used in building which is mixed with water and sand or stones to make a hard substance...

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Unit 2.3 - Recruitment, selection and training of employees 2024-11-14

19 Items: employess will usually work 35 hours or more a week.to the point where applications arrive to the business.Occurs by watching a more experienced worker doing the jobis the process from identifying that the business needs to employemployments is often considerd to be between 1 and 30-35 hours a week...

John Cabot 2023-02-15

16 Items: John's last nameThe name of his first shipCabot's first name at birthThe name of John Cabot's sonThe country John Cabot was born inCabot was an expert sailor and _____The country he had actually landed onHe was given the name the great _____Sebastian sailed down the ________ to CanadaThe country John Cabot moved to when he was 40...

Science 10B T3.1 SPACE 2025-09-04

16 Items: A push or pull (5)A negatively charged particle (8)A positively charged particle (6)Two or more atoms joined together (8)A rocky object that orbits the Sun (8)The smallest particle of an element (4)A large body that moves around a star (6)How fast a chemical reaction happens (12)The ability to do work or cause change (6)...

Entrepreneurship 2025-08-19

14 Items: A bad workerA company carBusiness loanAuntie AnniesNike paying their taxesWalmart and Target make a dealMcdonalds selling burgers to a customerA bakery has a budget of $5,000 to run a businessStarbucks advertises a buy one, get one free couponA clothing store tracks monthly sales growth to track success...

REFUGEE MENTAL HEALTH 2024-10-08

6 Items: The global organization focused on protecting refugeesSupport that focuses on emotional, psychological, and social well-beingA term for people forced to flee their country due to conflict or persecutionA psychological coping mechanism where someone avoids thinking about traumatic events...