new years Word Searches

English Vocabulary Test "Vit/Viv" 2025-05-04

9 Items: To bring back to lifeExtremely clear or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay aliveThe act of cutting open live animals for scienceAttractively animated; lively (related to a person)Friendly, lively, and enjoyable (related to an atmosphere or an event)...

Build-A-Bear Workshop 2025-10-21

5 Items: What kind of clothes can your bear wear?Where do you go to build your new furry friend?What goes inside the bear to make it come alive?What do you stuff inside your bear to make it soft?What do you do to your bear at the end to make it special?

August Wellness Words 2025-08-01

15 Items: The reason you do something.A belief in your own abilities.A strong feeling of enthusiasm.Feeling or showing appreciation.A state of calm and tranquility.Deserving of respect and attention.The process of personal development.The ability to use your imagination.The capacity to endure and overcome.A state of physical and mental health....

Immerse Church 2025-01-28

3 Items: Wave GenerationKim Powell, Pastor Kimberly Wilkerson, Sunday service, Wednesday night Bible study,development, Radical transformation, Encountering the living God, Economic Development, Pastor Bernard, Apostle Lillie Tuggerson , Associate Pastor Snowden, Pastor Jason Powell,

Figures of the Reformation -zoe 2025-04-23

10 Items: became the largest order in the churchthey were a specific group of Puritanswas made up of clergy called inquisitorstranslated the Bible into English and emphasized personal faiththe thirty years war ended in 1648 with the signing of the peace of…the spread of Protestantism went hand in hand with a growing feeling called…...

Behar Bechukotai 5.0 2025-05-18

17 Items: “Yovel”MitzvotMishkanThe “rams horn”.The desire for revenge.a carved statue of worship.The _______ year is to be a yovel.The mountain where HaShem spoke to Moses.We are not to take ________ of each other.How many sabbaths of years are we to count?According to The Holy One we are to _______His sanctuary....

may 2025-05-01

5 Items: the season after winter and before summera hobby involving plants, crops, and flowersthe start of new beginnings, the process of changea word representing what you've learned and done, and what its changed for yougreek goddess of nature and growing plants that influenced the month of may was named after

Disneyland Word Search 2025-05-06

11 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 5 times since 2018The first film I made to be shown in film festivalsLa La _____ The first movie I remember seeing in theaters....

Reeh 2024-08-24

20 Items: Re’ehTorahThe NameThe Placegood works“THE Prophet”The Feast of Booths“Dreamer of dreams”Instruction, for life!faith cometh by _______.The Diana cult. Acts19:28New Jerusalem’s foundationThe 3rd son of Jacob and Leah.The Jewish method of slaughter.the first pilgrimage festival of the year.“Our struggle is not against _____ ____ ______. “...

Loona Songs 2024-10-01

119 Items: d1urnew365pttwowairrosyheatstarposehowlloopttylvividedinyvoiceneedulucidnokiabirthpuzzleseesawegoistonewayfrozenhihighcolorsyumyumaliensletmeineclipsechaoticuncoverstylishsowhat?number1whynot?dioramaunf/airsparklethecarolmysundaymymelodytwilightone&onlysonatinerain51dbloonaticlove4evafavoriteohyesiamuniverseflipthatluminoushulahoopdaybydaynewtopia...

Venitia & Stephan 2024-11-07

23 Items: Groom’s NicknameBride’s HometownCity couple met inGroom’s middle nameCouple’s Dog’s nameBride’s Middle NameMonth Groom proposedBride’s new last nameGroom’s birthday monthGroom’s favorite sportBride’s favorite sportBride’s birthday monthPrairie Groom’s HometownCouple’s Favorite Music GenreWhere did the proposal happen?Couple’s first date restaurant...

Mr & Mrs. Stephan Smith Wedding 2024-11-09

23 Items: Groom’s NicknameBride’s HometownGroom’s HometownCity couple met inGroom’s middle nameCouple’s Dog’s nameBride’s Middle NameMonth Groom proposedBride’s new last nameGroom’s birthday monthGroom’s favorite sportBride’s favorite sportBride’s birthday monthCouple’s Favorite Music GenreWhere did the proposal happen?Couple’s first date restaurant...

March 2025-02-26

124 Items: AWEJOYNEWNOWTRYWAYGROWBODYCALMCAREDRAWFEEDGLOWGOALGROWHEREHOPEKINDLEADMAKEMINDMOVENOTEPATHPLANROOTSEEDSLOWSOFTTENDTESTTIMEWARMWORKBEGINBLOOMBUILDCRAFTDAILYDREAMFAITHFOCUSFRESHGREENGUIDEHABITLEARNLIGHTMAGICPEACEPLANTREACHRENEWSHARESHINESKILLSTARTTEACHTRACKTRUSTWATERWHOLEWRITEBRANCHBRIGHTCENTERCHANGECREATEEFFORTEVOLVEEXPANDEXTENDFOLLOWGARDENGENTLE...

Green Word Search 2025-03-06

24 Items: Month they metName of their catJason's mom's nameBecca's middle nameState they first metColor of Jason's tieMonth Jason proposedColor of Becca's eyesJason's birthday monthJason's favorite colorName of their officiantCity where Jason grew upCity where Jason proposedBecca's high school mascotFavorite free time activityLocation of their first kiss...

test4 2025-03-13

125 Items: FUNNEWOLDTRYCALMCOZYDESKEASYEDITFLOWHOMELISTMAKENOTEOPENPLANPLAYPREPSORTTIDYBEGINCLEANCLEARENJOYFOCUSFRESHLIGHTORDERPEACEQUIETREADYRELAXRESETSHIFTSPACESTARTTRACKTWEAKADJUSTBRIGHTCENTERCHOOSECORNERCREATEDOODLEREDUCERHYTHMSELECTSIMPLESPRINGSTEADYUNWINDUPDATEWINDOWARRANGEBALANCEBREATHECLARITYCOLLECTCOMFORTEXPLOREHARMONYIMPROVEINSPIREJOURNALMINDFUL...

History So Far 2025-11-14

26 Items: non-violentpilgrims uberdoes not agreecoffee tobaccowoods in latinno work no foodlost his familysaved Jamestownmother and childeveryone is equalVirginia namesakefound Pennsylvaniacows, horses oh myowned New Amsterdamhelped the Pilgrimsholy experiment in patobacco and Pocahontasdon't build a town herenot at first Thanksgiving...

The Honeymooners 2025-05-29

12 Items: The loud but lovable main character.Ralph’s sharp-witted and patient wife.The heart of most of the show’s scenes.The modest home where the Kramdens live.Ralph’s job that he often complains about.The New York borough where the show is set.Central theme, despite the constant bickering.Ralph’s last name; also refers to the household....

Find 2025-10-04

12 Items: To improve, no longer ill.Popular chocolate biscuit.Opposite of right, is not wrong.Person that scores a goal or point.Used for eating, not hands or fork.Take blue away from green to get this.Small figurine, a child’s lifelike toy.Period of day before noon and after night.Dangerous animal looks like wood in water....

Ella 2025-04-26

125 Items: aIbedogotoofinonatbyupasitheasoranmywaydaymaneyesaygetseeuseasktrynewownoldbigfewbadforouttheandnotyoubuthishersheonealltimeyearlifehandpartworkweekcasefacthavemakeknowtakecomelookwantgivefindtellworkseemfeelcallgoodlastlonghighnextonlysameablewithfromintooverlikethatthistheywillthingworldchildwomanplacepointgroupthinkleavefirstgreatotherrightsmall...

Tigris Word Search 2024-01-24

17 Items: The first Emperor of Rome.The Romans built these to carry water.Huge Chinese wall built for protection.A series of rulers from the same family.The large mountain range where the Inca lived.Ancient sporting event held in Olympia, Greece.The Inca were famous for these connecting paths.A step-like type of temple found in Mesopotamia....

SHORTCUT KEYS 2023-07-16

12 Items: _____ is used to undo content.There are ________ shortcut keys.Using shortcut keys increases this.______ is used to redo any undo text._______ is used to create new document.________ is used to copy selected data.______ is used to paste the copied data._____ is used to save a document or file._______ is used to cut the selected content....

Lovingkindness 2025-06-21

10 Items: We are not _____. (Lam. 3:22)Great is Your _____. (Lam. 3:23)Abounding in _____. (Psalm 103:8)His _____ never cease. (Lam. 3:22)They are new every _____. (Lam. 3:23)The Lord is also _____ . (Psalm 103:8)The Lord is slow to _____ . (Psalm 103:8)His _____ is over all that He has made. (Psalm 145:9)...

Profession Word Search 2025-06-16

10 Items: Very unusual; one of a kindCreate new ideas and methodsPerson who has earned a degreePeriod of time that has not yet comeChoices based on the analysis of factsHave a characteristic that makes something differentSomething done to prepare for an event in the futureHaving to do with living things and their environment...

Ex Post Factor Short Story 2025-11-12

10 Items: The person who gave Tyler a ticket.Latin phrase meaning “after the fact.”Tyler loved doing this sport at the park.The person who listened carefully at the hearing.The U.S. document that protects citizens’ rights.Tyler’s parents went here to challenge the ticket.The document Tyler received for breaking the new law....

Of Mice and Men vocab 2024-02-23

25 Items: deep respectanxiety or fearmocking laughterappease or softenlook at thoughtfullyflattering to pleasedisappointed and sadrepetitious and dulldeserving condemnationsullen and ill-temperedquick to argue or fightdisrespectful, demeaninggreat sorrow or distressunexpected words or actionsindication of a future eventunfriendly, cool, or distant...

Disneyland Word Search 2025-05-06

11 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 5 times since 2018The first film I made to be shown in film festivalsLa La _____ The first movie I remember seeing in theaters....

YLC6 2023-03-12

14 Items: the largest planetsomeone who works in spacesomeone who studies animalssomeone who studies the eartha creature from another planetsomething that people buy and sella man-made object floating in spacea system of stars (e.g. the "Milky way")our sun and the eight planets - ______ systemthe force that pulls objects towards the ground...

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

CPPI Team Building June 2023 2023-06-15

16 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(Social Determinants of Health)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Lens used throughout all of IPHI's work)(Communciation tool mostly used externally)(Communciation tool mostly used internally)...

Global Diversity 2024-09-25

10 Items: Volunteer and ____.Global Diversity ____ Month.Marken ____, like EAP and Virgin Pulse.Promoting ____ is a key aspect of Global Diversity.This month is a time for ____, learning, and growth.Supporting ____ businesses is a great way to get involved.Participating in Global Diversity Month involves both learning and ____....

Green Word Search 2025-03-06

24 Items: Month they metName of their catJason's mom's nameBecca's middle nameState they first metColor of Jason's tieMonth Jason proposedColor of Becca's eyesJason's birthday monthJason's favorite colorName of their officiantCity where Jason grew upCity where Jason proposedBecca's high school mascotFavorite free time activityLocation of their first kiss...

TV Theme Songs – Memorable intros from sitcoms and dramas 2025-05-16

20 Items: Love and marriage...Now this is a story...I don't want to wait...Step by step, day by...Sunday, Monday, happy...When I wake up in the...So no one told you life...Show me that smile again...Well we're movin' on up to...You take the good, you take...Making your way in the world...Here's the story of a lovely...Thank you for being a friend......

Hidden War Word Search 2025-05-22

20 Items: Confederate GeneralPresident of the UnionThe state of the nationFirst battle of the warThe capital of the UnionFrederick _ _ _ _ _ _ _ _Battle closest to RichmondCapital of the ConfederacyConfederate's trade centerPresident of the ConfederacyThe starting point of the warSlave states loyal to the UnionAbout 4 million people are in this...

The Clever Hans Effect 2024-03-21

9 Items: introducing new ideas or methodshard to notice or see, not obviousto understand (something) in a specified wayvery good at doing something that is not easyvery unusual; very different from what is normalnot done or made consciously, not done by choicewilling to listen to or accept ideas, suggestions, etc....

Patho Word Search 2025-09-04

20 Items: Present at, and usually before, birthEstimate of likely outcomes of a diseaseEffects an illness has on a person’s lifeThe development or change in evolution of a diseasePertains to the cause of death in a given populationThe study of patterns of disease involving populationsStudy of the physical form and structure of an organism...

trs225b bt4wk15pt1 2022-07-07

10 Items: n.A gentle wind.adv.How a crab walks.n. e.g. Taiwan, UK, USA, France, Japan.n.A part of a plant that is underground.n.The tall, thin, central part of a plant.n.A colourful part of a plant that attracts bees.n.Something inside fruit that can grow into a new plant.n.The ground. Plants take water and nutrients from this....

Sip & Search 2025-09-18

23 Items: Groom’s middle name?Bride’s Maiden Name?Who is the flower girl?Who is the maid of honor?Who said I love you first?What does the Bride collect?Who made the bridal flowers?Who is the mother of the groom?Who played cupid for the couple?Where did they both work together?What month did they get engaged in?What is the name of their fur baby?...

Unit 7: Other Land Use Part 1 2024-04-25

14 Items: areas where the public shares resourcesfire that only burns underbrush and is beneficialfire that smolders underground and is hard to put outgrowth strategies that develop sustainable communitiesgrowth forest resulting from natural secondary successionland degradation severe enough that land becomes a desert...

Chapter 2: Types of ECE Programs 2025-09-16

16 Items: Children who lack a regular, fi xed, or nighttime residence.Operated for charitable purposes, often sponsored by an agency.Established standards to assess and acknowledge program quality.Standards set to ensure that uniform and safe practices are followed.Privately owned businesses in local communities that rely on parent fees to operate....

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

Adjectives for My favourite sportsperson 2024-07-07

19 Items: Showing controlled behavior.Free from errors or mistakes.Having a strong desire to win.Full of energy and enthusiasm.Relating to detailed planning.Certain about one's abilities.Concentrated on a task or goal.Having great strength or force.Able to move quickly and easily.Skilled in planning and tactics.Able to adjust to new conditions....

Adlerian Therapy 2024-09-17

17 Items: DreamsLifestyleRecollectionsConfrontationSpitting in the client's ______First name of founder of Adlerian TherapyKey concept of feeling connected to othersAdler emphasized this type of therapy approachThe therapeutic movement that Alfred Adler is associated withThis term refers to feelings of inferiority in Adlerian thought...

HR 1526: Medicare Audit Improvement Act of 2015 2025-09-24

5 Items: can be given through Medicare to regulate all DMEPOS suppliers_____ numbers are given to receive payment for DME< orthotics, and prostheticsis a federal health insurance program in the United States for people 65 years or older...

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Democracy & Mexico's Government 2023-10-17

12 Items: Mexico is considered a ____________ Republic.type of democracy where all people make the lawcentral, state, and local are government _______.it is composed of a president, congress, and courtits role is to debate, make laws, and renew old onesit is elected by the people and can only last six years...

Western Expansion 2025-11-02

8 Items: This was the guide for Lewis and Clark on their expedition?Who was the explorer who help to create the idea of Manifest destiny and explored what is today Kentucky.This city was founded by the French and tripled in size from the time of the Revolution to the year 1800....

Meet The Fuegos, a Wedding Story 2023-08-01

30 Items: Who are we?What is Juan?Favorite shot?What is Marilyn?Worth the squeeze?Who is the cutest?Juan's middle name?What is Juan's sign?Who is a first born?Where does Juan live?Where is the wedding?Marilyn's middle name?Where did they grow up?Where did Marilyn live?What is Marilyn's sign?First international trip?Marilyn will love Juan......

December Word Search 2025-09-08

24 Items: Cyrus’s last nameThe Old Line StateThe Lone Star StateThe Volunteer StateThe state for loversCyrus’s go-to cocktailFamous bay in MarylandAbby’s favorite cocktailCity we currently live inThe month we both were bornPrimary language spoken in IranCity where Abby currently worksSusan’s maiden name (Abby’s mom)Farah’s maiden name (Cyrus’s mom)...

Ian & Valeria 2024-10-13

31 Items: Who is older?Groom's first jobBride's first nameMaid of Honor's nameWho is the best man?Groom's favorite bandGroom's favorite foodBride's favorite foodInstrument Groom playsBride's favorite sportInstrument Bride playsBride's favorite seasonWho said I love you firstBride's favorite video gameGroom's favorite board gameWhere did the groom propose?...

Gabrielle & Andrew 2025-05-16

30 Items: Best man's nameGroom's hometownBride's last nameBride's alma materGroom's professionWhere the couple metMaid of honor's nameBride's favorite cityGroom's favorite foodGroom's favorite sportThe couple's college mascotCity where the couple livesThe month the groom proposedBride's favorite movie genreName of the couple's male dog...

Dress Word Search 2025-09-11

16 Items: The bride to beThe groom to beWalk down the ___The trip after the weddingPhrase said at the altar I ___Ring usually worn by the groomA bride traditionally wears thisDecorative arrangement of flowersThe official who performs the ceremonyA wedding cake often has many of theseA promise exchanged during the ceremony...

Pomona Word Search 2023-03-08

21 Items: slept for 57 yearskeeper of the beesgood and wise centaurgoat with the horn of plentywas poisoned by a jealous Circedolphins carried him back to landthe trident was made in her honorthe six stars that brought the rainmother of the twins Artemis and Apollohis lock of hair protected his kingdomhusband and sons killed in a rebellion...

Jenna & Anthony 2024-10-17

23 Items: The bride’s favorite cocktailThe industry the bride works inThe couple’s favorite dog breedThe industry the groom works inThe groom’s favorite meal to cookThe Couple’s favorite comedy movieThe destination for their honeymoonThe groom’s favorite movie franchiseThe song they’ll exit the ceremony toThe color of the bridesmaids' dresses...

wordsearch ***SUDDENDEATH*** 2025-09-30

111 Items: varjmeslogslugdragsakachiprallyalleylewisserveonanahaydnravellisztverdianusahyssopnutmegneymarmbappemullerthiagoskeptachopinmahlerrameaurubatobrahmswagnerdvorakjubileemordentmanmarkmclarengerrardlampardvandijkstarboyacademystormzydebussypuccinivivaldibehemothseraphimcovenantforehandmidblocktractionraphinhasibeliusleviathanaleatoricelshaddai...

Executive Branch Word Search 2025-03-14

12 Items: Name of the vice presidentwhen someone is removed from officeWho is the leader of the Executive Branch?this is the building of the Executive Branchthis is the amount of times a person can be presidentThis group is made to help the president with other tasksThis is the type of power that is said in the Constitution...

Variation 2023-05-18

20 Items: A random change in DNAThe variable you changeThe variable you measureThe organelle that contains DNAThe variables you keep the sameA different form of the same geneThe technique used to photograph DNAA result that does not fit the patternCharacteristics we get when we are bornThe change in species over millions of years...

Grace & Emmanuel 2024-06-10

28 Items: Groom's middle nameBride's birthday monthGroom's birthday monthThe bride's middle nameMonth the groom proposedLocation of their honeymoonBride & groom's go-to drinkLocation the groom proposedLocation of their first dateGroom's favorite kind of foodThe couple's favorite TV showBride's favorite wedding movieChildhood nickname of the bride...

Kelly and Jason 2025-11-26

25 Items: The father of the brideThe father of the groomThe mother of the groomThe mother of the brideThe grooms favorite beerThe sport the groom playsThe couples favorite foodThe profession of the brideThe first cat the couple gotThe birth month of the groomThe birth month of the brideThe middle name of the brideThe middle name of the groom...

Pasatiempos 2025-10-03

13 Items: Airpods help you do whatPicasso loved to do what?Cheesecake Factory, Outback,Students are here to do what?fútbol, baloncesto, beisbol etc.Entertainment on a screen at homeA chef can be trusted to do what?An author is a professional at whatA weekend is a good time to do what?Talented people love to do this on tiktok...

2023: Some Naughty; Mostly Nice 2023-12-04

13 Items: Mary's new sport craze 🏓Came to stay over Easter 🐣Eamon's morning beverage 🫖Made Ted's face puffy--twice 🦷Makes Eamon mad when too short💈Raised twice for no good reason 💸Animals that are ruining the lawn 🐩What Eamon will become before 2024 🤔Took lessons in Virginia with cousins 🌊Had a blast playing with old classmates 🏀...

Vocab - R Words 2025-02-26

13 Items: To make friendly againTo do away with by lawTo make up for; recoverNot willing to do somethingTo regain health or strengthTo remember the good old timesTo restore or make like new againHaving a likeness or similarity toA motion or exercise that is done over againRenewed attention to or interest in something...

Generalist Word Search 2024-10-05

15 Items: the ability to produce offspringa drop in population after an overshootamount of time to double the populationprovide no care for their many offspringa species that require a specific habitatprovide parental care for their few offspringsurvivorship curve: large % of pop. dies earlya species that live in a variety of environments...

Jamestown Word Search 2024-12-13

15 Items: founded in 1607Colony for English Catholicscolony for pilgrims and puritansClimate of the New England coloniessocial contract signed by the PilgrimsLarge southern farms that grew Cash Crops1st Anti-Slavery Group in the 13 ColoniesNorthern slaves worked in these occupationsBritish controlled trade, angered colonists...

unit 8 2024-05-01

13 Items: uses microbes to absorb or digest toxinschemicals are magnified through the food webincrease in death rate occurs over a large areaincrease in death rate occurs over a local areaflow of all wastes produced by the average persontype of waste that is from chemicals and constructionturning organic wastes into a sustainable fuel source...

Marketing Mix 2023-11-23

7 Items: The 4P's of MarketingHow it will be advertised or sold 'P'?What will be charged for a product 'P'?This is where you will buy the product 'P'?What you are selling and it's features 'P'?The people who are most likely to buy or use a new product or service are called this...

AP Computer Programming 2025-11-21

13 Items: what a function takesattribute of an objectwhat a function gives backstarting index for an arrayint, double, boolean, StringA unique instance of a classorder of indices in a 2D arraycreates a new instance of a classa named location in memory that stores a valueblueprint or template from which objects are created...

Far Word Search 2025-08-13

1 Item: first number light went same years farm sentence long then than got draw

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

21 2025-08-17

15 Items: Main public roadRoad Highway freedom.66 Historic U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vest...

21 2025-08-17

15 Items: Highway freedom.Main public roadHistoric U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vestEvent where new members receive their club patch...

franciscos wordsearch 2025-05-14

9 Items: v. - to bring back to lifeadj. - extremely clear or brightv.-to endure, exist, or stay aliveadj.- necessary, or essential to lifen. - a food substance that aids healthn. - act of cutting open live animals for scienceadj. - attractively animated; lively (related to a person)...

eldn rings word search 2025-05-16

9 Items: teh mad man who manipulated Vykethe tarnished who could be the lordThe new power to burn down the erdtreethe flame used by the giants of the snowfieldsGodlike beings that commune with the greater willGodlike beings that commune with the frenzied flamea maiden assigned to a tarnished by the roundtable hold...

Describing experiences 2025-07-21

9 Items: F.Work you do to earn moneyH.A positive result or accomplishmentG.A series of steps taken to achieve somethingI.A situation that makes it possible to do somethingC.A new or different situation or way of doing somethingD.Something you have done successfully after working hardE.A difficult situation that tests your ability or strength...

Basic Level Shaatibiyyah Intro and Bios Wordsearch 2 2025-03-02

7 Items: Al Shaatibi was a greatImaam Al Shaatibi was also known asWhich sahabah compiled the Quran in one harf?When you recite the Qur'an you are respected andThe Qur’aan helps those who read it. It gives blessings andHow many different styles of ahruf (dialects) are there for the Qur’aan?...

Onboarding Word Search 2024-11-13

3 Items: The process of integrating new hires into an organization and its culture.The total monetary and non-monetary rewards given to employees for their work.Non-wage perks provided to employees, like health insurance, retirement plans, and leave.

Color Wheel 2025-10-09

9 Items: The color between red and yellowThe opposite of "dull" when describing colorThis color is at the top of most color wheelsA bunch of different colors that form a diagramThe group that consists of red, blue, and yellowThere are this many main colors on the color wheelWhen colors mix evenly, they make a _________ color...

Word search 2025-11-23

10 Items: Type of conflict rizal wrote aboutBonifacio Hero who led the katipunanLUNA Artist who painted “The Blood Compact”BONIFACIO Hero who wrote “Aling pag-ibig pa?”game rizal played to conquer loneliness in dapitanCountry where a new Jose rizal monument was unveiled?rizal He wrote the el filibusterismo and noli mi tangeri....

The Great Depression 2024-10-14

15 Items: known as the CCCknown as the SSAsevere dust stormswhen you are not employedA horrific time in historywhere investors buy and sale stocksknown as the Wall Street Crash of 1929chats created by Franklin D. Roosevelta time of low rainfall and dry weatherthe president who created the New Dealknown as the Mississippi River Flood of 1927...

World Capitals 2024-03-14

30 Items: Capital of Japan.Capital of China.Capital of Italy.Capital of Egypt.Capital of Spain.Capital of Kenya.Capital of France.Capital of Russia.Capital of Brazil.Capital of Canada.Capital of Turkey.Capital of Sweden.Capital of Greece.Capital of Norway.Capital of Germany.Capital of Austria.Capital of Ireland.Capital of Thailand.Capital of Portugal....

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

THEY DID IT! 2025-05-29

101 Items: BOBBOOJEBOMADEADANNANERDFOODMISSOF OPROMSOULPREZHAUSSWIFTDUCKSJAMESMAZDAFLUTEMUSICHUMORCOVIDTWINSRALPHHALSEYDEMONSGARCIAGUITARMOVIESSNOOPYCOFFEEEUGENECAMERADIVINGSHIRTSSLOTHSSISTERFAMILYDEPAULDREAMSMARVELWALTERANDREWCRUMBLTATTOOFRIENDSCOLLEGECHICAGODANCINGRECORDSPOSTERSBROTHERCORNISHDIPLOMAIS HARDMERCURYOF MINEOF MINERECORDSCONCERTSLAUGHTERUNICORNS...

Science Study 2025-12-02

20 Items: Alfred ___.A push or pull.Mid _____ Ridge.Super Continent.Wind, Water, Ice.Plate ____ Theory.When two plates move together.Part or traces of an organism.Creation of new oceanic crust.Made from cooled magma or lava.Example of mechanical weatheringThe movement of heat through space.Liquid metal. Surrounds inner core....

Bible Affirmations 2025-04-28

25 Items: – "I am healed."– "I am set free."– "I seek wisdom."– "I am empowered."– "I am delivered."– "I walk in grace."– "I am loved by God."– "I am an overcomer."– "I am a new creation."– "I trust in God’s plan."– "I am walking in faith."– "I follow Christ’s path."I am more than a conqueror.– "I am complete in Christ."– "I am rebuilding my life."...

October Word Search 2025-05-25

20 Items: Emma's new surnameOur go-to takeawayWho is the tidiest?Month Louis proposedThe month that we metThe town Emma is fromThe city Louis is fromWho is the better cook?Our minimoon destinationThe name of city we met inThe name of our cat friendOur first sports game togetherThe football team Louis supportsThe name of the village we live in...

Bourgeoisie Word Search 2024-01-17

21 Items: Travels to sell goodsMaking an area more urbanMeans of supporting oneselfPublic land for community useState of being stable, steadyGroup sharing common interestsAt edge or margin; not centralAllow animals to graze on landCustom passed down generationsConditions on which land is heldAverage period a person may liveRoom for manual or industrial work...

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

10.The 1950s were a time of rapid technological advancement, with many new inventions and innovations transforming everyday life. 2023-03-04

20 Items: stereosrocketsjukeboxeslprecordsairplanestelevisiontelephoneshifisystemsautomobilesvinylrecords45rpmrecordstaperecordersrefrigeratorsmicrowaveovenscolortelevisionpolaroidcameraselectricguitarswashingmachinesairconditioningtransistorradios

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

Baptism 2023-11-13

8 Items: a new convertimpossible to eraseWashing away all the dirty stuff - sins.getting dunked under water to remove original sinrite has to take place in order for the sacrament to counta consecrated ointment consisting of a mixture of oil and balsam....

Family diversity wordsearch 2024-06-19

8 Items: Who coins the neo-conventional family?Which new family type does Stacey identify?Who identifies five types of family diversity.What is the dominant family type under modernism?What is the dominant family type under postmodernism?Which research method did Stacey use in her study of postmodern families?...

Unit 9 2024-04-25

8 Items: most widely used energy source globallysmall bubbles of nitrogen gas trapped in iceThe process of breaking the bonds in an atomprotect us from uncontrolled fission or radiation leakscolorless, odorless gas and is cleanest burning fossil fuelterm used to determine when oil supplies will start to dwindle...

The Space Race & Technological Advancements 2025-05-08

8 Items: Animal sent to space by the Soviet UnionSpeech given by Eisenhower to the United NationsTechnological Advancement following the Cold WarSpace administration created by the United StatesCountry that the United States was in competition withCartoon used in the 1950’s to teach kids to duck and cover...

Reading plus word Search 2025-01-15

117 Items: upgumwadoutlegscoaldyedgrinloadtaletipswoolcargoderbyforcegillshandsknobsledgelodgelungslightroughsteeltoughwreckattendbostonchurchexceptfamousfigurefiestaglidedheaterislandlandedlensesmessedmuseumperiodrescuesignalslopesslopesstaredstormysturdytangleunloadupwardbalancebreathecontrolfreedomhistoryimmensejournalmessageenglandpackageploppedsailors...

Project Financing 2022-08-22

11 Items: Hello,DirectorSincerely,AyrapetyanInternational E.C.Box 10236 Shop No. 3053 Manama Centre, Bahraintigran.ayrapetyan@devcorpinternationalec.comsubmit your business plan, pitch deck or executive summary for us to review and to understand much better about your business and to further discuss a possible partnership....

The Little Mermaid Pgs. 17-21 2023-08-10

12 Items: I will love it ________.What do the flowers on land have?What can the fish in the trees do?How old is the little mermaid now?Where did the oldest sister lay on?Who is going to be fifteen next year?What did the second sister see people doing?When can the little mermaid go to see the land?But the little mermaid wanted to see _________....

Elements 2024-01-07

12 Items: The lightest element.Strong bones like this element.The element that fills balloons.The element that makes diamonds hard.King Midas turned everything he touched into this.Most creatures on Earth need this element to breathe.An element with a radioactive isotope found in bananas.Enables computer technology and has a valley named after it....

Germany Recap 2025-08-31

12 Items: Failed Nazi coup attempt of 1923Treaty signed in 1919 that Germany hatedGerman leader forced to abdicate in 1918Early name of the Nazi Party before 1920Hitler’s autobiography written in prisonNew currency introduced by Stresemann in 1923March 1933 law giving Hitler dictatorial powersNazi paramilitary group nicknamed the Brownshirts...

DNA & Cell Cycle 2025-10-23

12 Items: Unzips DNA helixDNA is in the shape of aGuanine always pairs withIn DNA, Adenine always pairs withCondensed DNA, humans have 46 of themAdds nucleotides to the new DNA strandThe process of cells growing and dividingA section of DNA, controls cell differentiationSugar found in DNA, makes up the sides of the ladder....

Quarter 3 Vocab Review Part 2 2025-03-13

10 Items: extremely tiring and demandingto move or act slowly; to delayconfused and slightly worried; puzzleda large or excessive amount of somethingto match or surpass; typically by imitationto gather information or material bit by bitto give new energy to or restore back to a former conditionto move toward the same point and come closer together or meet...