new years Word Searches

School Word Search 2025-07-02

100 Items: PenGymLabCutNewFunBookGlueTapeClipCookHallGateReadDrawLineSingTalkHelpPackBellKindRulerPaperChalkNurseCoachGuardTutorClerkStageFenceLearnWriteCountColorShareThinkCleanPasteRaiseSpellMatchClassRulesHappyReadySmartBraveQuietSmilePencilEraserCrayonMarkerFolderFriendArtistDriverOfficeLockerGardenListenSchoolLessonStaplerTeacherStudentJanitorMonitor...

Diwali Word Search 2025-09-06

93 Items: OmJoySitaPujaDiyaPedaCoinGoldPujaYearGlowIndiaAartiTilakToranLotusLadooBarfiBroomHaldimonthPujanbooksLightDiwaliKuberaMantraStotraPrasadKalashCandleAlpanaMithaiJalebiChakliSilverKumkumWealthParvatAnnakutBhaiBijHanumanBhajansRangoliOillampLanternPeacockNamkeenRocketsGiftingVictoryLordRamaHinduismRasgullaCrackersShoppingCleaningSwastikaAmavasya...

words 2025-09-30

100 Items: aIasatbebydogoheifinitmemynoofonorsotoupweallandbutcandayforgetherhimhishowitsmannewnotnowoneouroutsayseeshethetwousewaywhoyoualsocomeevenfindfromgivehavehereintojustknowlikelookmakemanymoreonlysometaketellthanthatthemthentheythistimeverywantwellwhatwhenwillwithyearyouraboutcouldfirstothertheirtherethesethingthinkthosewhichwouldpeoplebecause

Medical Terminology Word Parts - Prefixes - Roots - Suffixes 2024-10-25

41 Items: bi-ot/omy/oneo-per--cytecis/oanti-auto-hypo-hemi-mono--celepara--gramoste/oluek/ointra-rhin/oaden/ocyan/opath/oneur/obrady-tachy-hyper-micro--algia-lysis-rrheanephr/ocardi/ogastr/oenter/opseudo--megaly-ptosis-rrhapypulmon/odermat/olaryng/o

Ahhhh 2024-12-03

100 Items: aIasatbebydogoheifinitmemynoofonorsotoupweallandbutcandayforgetherhimhishowitsmannewnotnowoneouroutsayseeshethetwousewaywhoyoualsocomeevenfindfromgivehavehereintojustknowlikelookmakemanymoreonlysometaketellthanthatthemthentheythistimeverywantwellwhatwhenwillwithyearyouraboutcouldfirstothertheirtherethesethingthinkthosewhichwouldpeoplebecause

april 2025-01-12

100 Items: ARTFUNHOPINKNEWTRYBEAMCALMDESKDRAWFLOWGLOWGROWJUMPKINDLEAPLISTMAKEMOVEMUSENOOKPENSPLAYPLANRESTROOMSINGSKIPSOFTWARMZESTBLOOMBRUSHCOLORCRAFTDANCEDREAMHAPPYLAUGHLEARNLIGHTMERRYPAINTPAPERPAUSEPEACESHARESHINESPACESPARKSUNNYSWEETSWIRLTABLETWIRLBINDERBOUNCEBRIGHTCANVASCORNERCREATEDESIGNENERGYFROLICGATHERGENTLEGIGGLEJOYFULMARKERNOTICEPENCILRECORDSPRING...

A Word Search 2025-02-20

100 Items: aIasatbebydogoheifinitmemynoofonorsotoupweallandbutcandayforgetherhimhishowitsmannewnotnowoneouroutsayseeshethetwousewaywhoyoualsocomeevenfindfromgivehavehereintojustknowlikelookmakemanymoreonlysometaketellthanthatthemthentheythistimeverywantwellwhatwhenwillwithyearyouraboutcouldfirstothertheirtherethesethingthinkthosewhichwouldpeoplebecause

Diwali Word Search 2025-09-06

93 Items: OmJoySitaPujaDiyaPedaCoinGoldPujaYearGlowIndiaAartiTilakToranLotusLadooBarfiBroomHaldimonthPujanbooksLightDiwaliKuberaMantraStotraPrasadKalashCandleAlpanaMithaiJalebiChakliSilverKumkumWealthParvatAnnakutBhaiBijHanumanBhajansRangoliOillampLanternPeacockNamkeenRocketsGiftingVictoryLordRamaHinduismRasgullaCrackersShoppingCleaningSwastikaAmavasya...

100 Most Commonly Used English words 2025-10-22

100 Items: AIOfToInItIsOnHeBeAsByAtOrWeAnIfSoNoUpMyMeDoTheAndWasForYouAreNotButHadHisSheAllHasCanWhoHimItsTwoOutDidSeeHowGetWayOurGotAnyMayNewOneNowHerThatWithHaveThisTheyFromBeenWillWhatWhenSaidMoreThemSomeIntoThenTimeLikeOnlyVeryWellThanBackMostDownMadeKnowAlsoOverJustWereyourWhichTheirWouldAboutCouldOtherFirstAfterWhereTheseThereShouldPeople

Valve Games + Half-Life and Portal mods 2025-11-03

32 Items: MModDecayEchoesPortalSynergyPortal 2Half-LifeNew TimesBlue ShiftSven Co-OpBlack MesaAzure SheepHalf-Life 2Garry's ModHL2 Episode 1HL2 Episode 2Entropy: ZeroOpposing ForceCounter-StrikeHL2 DeathmatchHL2 Lost CoastHalf-Life AlyxEntropy: Zero 2Portal ReloadedTeam Fortress 2Half-Life SourceCounter-Strike 2Portal RevolutionPortal Stories: Mel...

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

Baseball 2025-09-14

20 Items: Another term for a baseball fieldLegendary slugger nicknamed “The Bambino”Historic ballpark home to the Boston Red SoxTeam with the most World Series championshipsSeattle team that signed Ichiro Suzuki in 2001St. Louis team with 11 World Series championshipsBroke Babe Ruth’s all-time home run record in 1974...

Synonym Word Search 2023-02-28

50 Items: HotBigOldNewActBuyHardColdGoodRichNeatSaveHelpAbleFindIdeaHaveSlimEvilWalkLiftSmallWrongTotalGreatExtraAwfulQuiteAngryThickOuterPoliteYearlyChooseAlmostDivideExpandLiquidForbidHappenNaughtyStrangeSuggestImplantthirstyForgiveCollectUncommonBeautifulImportant

#2 Puzzle "Synonyms" 2024-09-06

50 Items: BIGSADENDHOTBADOLDNEWCRYBUYCOLDGOODFASTSLOWLOUDEASYHARDUGLYRICHPOORDUMBWEAKKINDMEANHELPHURTHATEGIVESELLWALKSMALLHAPPYSTARTQUIETCLEANDIRTYSMARTBRAVEFUNNYLUCKYBUILDTEACHSTRONGSCAREDHONESTFRIENDANSWERSERIOUSBEAUTIFULDISHONESTUNFORTUNATE

#6 Puzzle "Antonyms" 2024-09-06

50 Items: UPBIGDAYWETNEWWINFATHOTTOPBUYFASTOPENLOUDFULLGIVESOFTHIGHTHINFINDLEFTKINDNEARTALLRICHWIDEDEEPHAPPYFRONTCLEANLAUGHSTARTBLACKLIGHTABOVESWEETHEAVYTIGHTEARLYSMILESUNNYALIVEFIRSTBUILDSTRONGFRIENDINSIDEARRIVECREATEFORWARDREMEMBER

Good Luck 101 2025-02-16

101 Items: catdogpienewcantrygumredlionthatcaketaperingcardfirelifelarptarptechmakewordfullfoodfreewithtearcokeleerbitebluegraygreygoldironrustreadsoupdarezebrahippoaboutstarsprintvitalpantscrestshiftgravenurseeventfirstpepsicodesgreenblackwhitesteelwritejellysaucelightssearchjacketlingerupdateshowerchargesolvedspritechangeorangeyellowsilverpowderarcaneviable...

Type A (2-1-2's) Latin Adjectives 2025-11-09

20 Items: high-mas. gen. pl.our-neut. dat. pl.worst-mas. acc. pl.new-mas. nom. sing.evil-neut. gen. pl.small-fem. abl. pl.narrow-fem. acc. pl.good-mas. abl. sing.much-fem. acc. sing.sick-fem. nom. sing.sacred-mas. abl. pl.free-mas. dat. sing.black-fem. acc. sing.devoted-neut. acc. pl.unhappy-fem. nom. sing.appropriate-fem. nom. pl.beautiful-mas. acc. sing....

Battle of the Somme 2025-10-28

21 Items: – The country where the Somme River flows– The country where the Somme River flows– The year when the Battle of the Somme began– The group of nations fighting against Germany– What the battle helped Canada build as a nationWar – What the Somme came to symbolize in history– The new type of weapon first used in this battle...

Leon & Beth 2024-05-25

28 Items: Leon's jobTheir dogs nameLeon's best manLeon's first carMonth of proposalBeth's birth monthLeon's middle nameBeth's middle nameLeon's birth monthBeth's favourite beachLeon's favourite colourUniversity Beth went tooBoth of their eye colourLeon's favourite cuisineNumber of Leon's siblingsPlace that they first metCity that they got engaged...

November Word Search 2025-01-03

30 Items: Bride's jobBest man's nameWhere couple metBride's alma materCouple's last nameCouple's fur childBride's maiden nameCouple's first tripBride's side hustleWho is usually lateMonth Groom proposedMaid of honor's nameWho is more outgoingGroom's favorite foodName of wedding venueGroom's favorite bookGroom's birthday monthBride's birthday month...

Bella + Hunter 2025-03-02

23 Items: Groom’s motherBride’s motherBride’s fatherGroom’s fatherGroom’s eye colorBride’s hair colorThey’re tying the ____Bride’s favorite flowerBride will toss the ____Bride’s favorite book genreGroom’s preferred house choreMonth the bride and groom metBride drives this brand of carGroom drives this kind of truckNumber of years law school takes...

World History 2023-07-17

20 Items: 29 CE _____ _____ crucified.1299 CE Osman I established the _____ Empire.1799 CE _____ Bonaparte takes control of France.1215 CE John of England sealed the “_____ _____”.570 CE Prophet Mohammed (the founder of _____) born.1492 CE Christopher _____ discovered a route going to the New World....

The Role of Nurse Residency Programs in Supporting New Graduate Nurses 2025-11-21

4 Items: What key workforce outcomes do nurse residency programs try to improve by helping new nurses stay in their jobs longer?What emotional risks do nurse residency programs help reduce by offering support, mentorship, and a positive practice environment?...

Stave 1-3 of A Christmas Carol Word Search 2022-11-29

15 Items: the name of Scrooge's clerkScrooge's ex-business partnerthe name of Scrooge's ex-fiancépredicted to die in the third staveMarley was carrying and wrapped in ___the name of Scrooge's nephew; Fan's sonMarley died ___ years ago on Christmas EveScrooge's old boss that was kind and lovingthe second spirit was described as a ___ giant...

Present perfect 2025-05-16

15 Items: Have you __________ seen a ghost?I have __________ been to PortugalHe __________ just told me the news!I have ____________ done my homework.Have you ever __________ mango juice?Have you ___________ any news from Bartek?Zmęczykot has never ____________ fried octopus.I haven't _____________ my essay for Polish yet....

Word Search 2025-08-21

22 Items: _____ actual cause of loss____ uncertainty of a loss______ voluntarily giving up a known right_____ person that represents the Principal_________ there is a possibility of gain or loss______ condition that increases the chance of severity___________ the person listed on the declarations page...

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

Loan Details 2024-12-17

16 Items: Remaining loan balance AKA __.The Govt __ __ will show if a loan is FHA.__ __ will show you required coverage amounts.__ address means the same as 'Collateral Address'.Always go by the __ Zone listed in IIM, not on a policy.The __ __ tab shows all documentation attached to the loan.You can find what __ position the client is listed as in IIM....

Firm 2024-10-29

4 Items: How do we call hostile takeover?How do we call a company with 3 employees?The major disadvanted of a small company isTwo companies agreeing on forming a new entity is called

Danielle & Joe 2024-05-19

22 Items: Groom’s hometownBride’s hometownBride’s last nameThe bride’s collegeWhere the couple metHoneymoon destinationGroom’s dream dog breedThe bride’s birth monthThe chore the groom doesThe couple’s favorite showWhere the couple got engagedThe month the groom proposedThe couple’s favorite cocktailThe couple’s favorite type of food...

Jessica and Jordan OO 2024-08-02

30 Items: Proposal monthProposal locationJordans middle nameJessica birth monthLength of engagementJordan’s birth monthName of Williams dogJessica’s old nephewHoneymoon destinationJessica’s middle nameMonth of the honeymoonJordans favorite candyJordans favorite storeJessica favorite storeName of Jordan’s sisterJessica’s favorite foodCity Jordan was born in...

Madagascar 2025-07-08

2 Items: marty gloria Melman penguins lemurszookeepers king Julian rainforest Africa New York madagascar

The 30th Anniversary Word Search 2025-11-11

30 Items: The orchard we called home.His morning ritual for her energy.Where my latest gift shall reside.Home, literally coded in our names.Our go-to escape among coffee estates.Where family life officially took off.Where you both finally gained a daughterWhen the year winds down but love resets.Where “settled” stopped being just a word....

Daily Routine 2025-10-10

4 Items: Meal in the middle of the dayI eat this meal in the morningI travel to this place to do the jobI do this when I want to learn sth new

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Piratas y triangulo ch 1 vocab 2025-09-04

55 Items: bigourbutboatsongI amlikelongalsoI goyearsplanetrustsinceI saysmallweeksstillnearbywe aresisterlegendI callsailorwe areI haveI liveweddingkitchenbedroomexcitedwe callwe sailto sailparentsbecausefifteento havewe goesbathroomchampiontomorrowregattasto leaves/he hass/he saysdangerouss/he goesthey goesthey lives/he callsa thousands/he livesthere is/are...

Mike & Michelle 2025-10-20

20 Items: Groom's eye colorHoneymoon destinationThe bride's birth monthThe groom's birth monthThe couple's favorite showWhat is the bride's careerThe month the groom proposedWhat city did they first meetWhat is the groom's middle nameWhat city did the groom proposeWhat is the bride's favorite colorThe month the couple started dating...

Tis the Season to be Married 2025-11-17

20 Items: What pets do we share?Who made the first move?One of Liz's biggest fearsWho said "I love you" first?What month was our first date?Where did the proposal happen?What is Patrick's middle name?What is Elizabeth's middle name?What is Patricks favorite colour?What is Patrick's favorite sport?What is the theme of the wedding?...

High Holy Days 5785! 2024-09-20

15 Items: 'All Vows'Days of ___Day of AtonementGreat with applesHoly, Holy, Holy!Ten Days of ______.Literally 'Good day'Last month of the year'Return' or 'Repentance'Yiddish Holiday GreetingFirst month of the New YearHorn used during High Holy DaysFruit, said to have as many seeds as there are mitzvot.Blessing recited when doing something for the first time...

Disneyland Word Search 2025-05-06

9 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 6 times since 2018The first film I made to be shown in film festivalsThe selective school that I spent half of my elementary school years in...

Snowflake BUILD Word Search 2023-11-29

6 Items: Used for app development._____ Container Services and ____ ML.At BUILD, connect and build with _____.Complete the LLM _____ and earn a skill badge.A new type of table that can simplify application development.We got a sneak peek of this capability at the Global Company All Hands.

Negara Asia dan Ibukotanya 2025-10-02

15 Items: Negara dengan ibu kota TokyoNegara dengan ibu kota SeoulNegara dengan ibu kota HanoiNegara dengan ibu kota DhakaNegara dengan ibu kota RiyadhNegara dengan ibu kota ManilaNegara dengan ibu kota JakartaNegara dengan ibu kota TeheranNegara dengan ibu kota BangkokNegara dengan ibu kota New DelhiNegara dengan ibu kota Islamabad...

Wedding Word Search 2024-04-18

10 Items: Symbols of never ending lovePerson of the Bride's bridal partyThe annual celebration of marriagePerson of the Groom's wedding partyFlowers arranged for the Bride to holdPromises made between the Bride and GroomTraditional dessert of wedding receptionsVacation the married couple take post weddingThe celebration of love between the Bride and Groom...

Ch. 6 - The Zhou Dynasty and New Ideas, Section 2 - vocabulary 2020-09-24

10 Items: lordLaoziethicsDaoismpeasantLegalismConfuciusZhouDynastyConfucianismMandateOfHeaven

Changes in Matter 2024-01-04

15 Items: Chemical _______ is another term for chemical change.A chemical _______ is used to describe chemical changes._____________ properties can be observed using your senses.A ______ change causes a substance to change its state of matter.Washing your hands with ______ is an example of a chemical change....

Keen Word Search 2023-12-09

10 Items: To leave out or excludeHaving a sharp edge or pointCalm, peaceful, and untroubledTo express sorrow or grief audiblyHaving or showing tact; diplomatic.Lacking interest or excitement; dullTo think deeply or consider carefullyAttractively unusual or old-fashionedTo move back or away from a point or limitA beginner or someone new to a field or activity

Services and stuff wordsearch init 2024-01-07

10 Items: grantenergyinsulationWhat the O stands for in ECODebt Fee's, DCA, Credit score impacted.Scheme associated with a product called StairSteadyYour great protector as you embark on this new journeyAn appliance that helps control the temperature in your homeConversation you have to assess a customer's financial circumstance...

New year's day 2024-02-16

2 Items: tenmonkey

Genetics Part 1 2024-10-16

18 Items: Genes that code for proteins.The genetic makeup of an organism.Genes that control gene expression.A sequence of DNA responsible for coding a protein.Extra copies of DNA found in bacteria and some fungiAll the genetic material (DNA) present in an organism.The process by which DNA is copied before cell division....

A New Government 2015-02-26

2 Items: JohnAdamsWilliamJohnson

A New Government 2015-02-26

2 Items: JohnAdamsWilliamJohnson

Open Enrollment 2022-10-03

11 Items: dental plan providerRetirement departmentvision plan provider abbreviationHealth Savings Account Abbreviationoptional benefits like pet insuranceThe new medical plan provider for 2023Flexible Spending Account AbbreviationDiscount provider for wellness discountsWhere you log in to review/change your benefits...

Matt and Caroline 2025-07-16

18 Items: Our first dateOur first kissOur first babyMy bagel choiceOur first concertYour bagel choiceMy favourite drinkWe have completed 3/4Your favourite cocktailYour new favourite hobbyOur first abroad holidayThe month we became officialHow long we will be togetherThe three words we say the mostOur super sick holiday next year...

New year's day 2024-02-16

2 Items: tenmonkey

New Project Title 2025-09-24

2 Items: sacredoctober

IYTC January Games 2025-01-26

5 Items: Type of event NorCal will be hostingWhere will Arizona's fundraiser be held?What country has IYTC traveled to in the past?The new platform to view IYTC's latest social media updatesWhat food will be available to purchase at Maryland's fundraiser?

Johann Sebastian Bach 2025-09-04

12 Items: Bach wrote much of his music for the ____.Bach played the pipe ____ in many churches.Bach lived during the ____ period of music.Bach was a great ____ of the Baroque period.He wrote over 200 church songs called a ____.Johann Sebastian ____ was a famous Baroque composer.The ____ Concertos are one of his most famous works....

Antropology 2025-12-04

18 Items: – to come together (usually in community)– the study of past peoples and past civilizations.– the study of a person’s individual or familial past– changes that occur as a result of changes in the environment.– beliefs or rituals passed down from one generation to the next– a large population of people organized into a collective society...

Vámonos de Viaje 2024-02-20

54 Items: the travel mode by aira pass to a location and backtraveler who visits new placesthe place the trip is going tothe place airplanes are landedthe item needed to board a flightthe list of activities for a tripthe vehicle needed to travel by airto accidentally not get on a flightto get to one's desired destinationthe time when tourism is busy or not...

Unit 18 Tweens 16 Voabulary 2023-06-07

4 Items: I don't like when people _____ about someone.My sister is always ______ me when I talk to herMy friends always _____ the new student for being ChineseMy father ______a joke to me yesterday. Everbody laughed.

Rare-earth metals academic language 2023-02-09

10 Items: The m__ world is high-techMost a__ tech products use these metalsScientists __ (looked closely at) the areaThere is a large enough s__ to last 75 yearsThere is a high __ (need or want) for these metalsThis discovery has the __ (possibility) to benefit societyThe need for these rare-earth metals is ___ (all around the world)...

Banking Services Terminology 2024-09-10

23 Items: Compounded every dayCompounded every yearAnnual percentage rateCertificate of depositCompounded every monthCompounded twice per yearCompounded twice each monthCompounded every other weekCompounded every infinitelyDeposited on a set scheduleCompounded every three monthsMoney withdrawn from an accountMoney deposited into an account...

Icons of Fear 2025-11-15

50 Items: JASONDEATHMUMMYFREDDYCHUCKYSAMARASADAKOCARRIEJIGSAWKAYAKOPINHEADCREEPERTALLMANDRACULAWOLFMANTHEBLOBGRABOIDCANDYMANTHETHINGBABADOOKGHOSTFACEPENNYWISENOSFERATUBOOGEYMANLEPRECHAUNSLENDERMANRICTUSEVILLEATHERFACENORMANBATESPUMPKINHEADANNIEWILKESARTTHECLOWNMICHAELMYERSREGANMACNEILJACKTORRANCEFRANKENSTEININVISIBLEMANVICTORCROWLEYHANNIBALLECTER...

Dancing Word Search 2025-10-19

18 Items: Casper is a ______Here, kitty kitty kittyWerewolves are also ___________Festive word from Daphne's recapMammals associated with vampiresNature's crime scene in AntarcticaThe word for being scared of fearsA multi-limbed fictitious sea monsterBreak this, get seven years of bad luckThe mess a spider leaves in the corners...

Enginnering A-Z 2023-01-17

7 Items: improve the manufacturing processresponsible for building new exhibitshelp find oil and gas for the country's energy needs.Implement utility network monitoring and alarming systeminstall, repair, and perform routine maintenance on x-rayAnalyzes, troubleshoots and repairs diagnostic or ultrasound imaging equipment...

Holiday 2023-12-12

100 Items: firhampiepietreecoldholyYearnoelPolepinesledstartoysyulebellscandycanescardscedarcometsaucecupiddollselvesboxesgiftshappyhollyjollylistsmerrypartypunchsalessaucestandtripsvixenpaperadventangelscrowdsdancerdasherdonnereggnogfrostylightsribbonsacredseasonspirits.nickpotatotinselturkeywinterwreathblitzencandleschimneycookiesreunionholidayicicles...

Christmas 2024-12-01

100 Items: FirHamPiepietreeColdHolyYearNoelPolePineSledStarToysYuleBellsCandycanesCardsCedarCometCupidDollsElvesGiftsHappyHollyJollyListsMerryPartyPunchSalesSauceStandTripsVixenpaperAdventAngelsCrowdsDancerDasherDonnerEggnogFrostyLightsRibbonSacredSeasonSpiritpotatoTinselTurkeyWinterWreathBlitzenCandlesChimneycookiesreunionHolidayIciclesMiraclePageantParades...

Countries 2025-05-18

98 Items: FasoChadRicaFijiIranIraqLaosMaliOmanBeninChileChinaCongoEgyptGabonGhanaHaitiIndiaItalyJapanKenyaLibyaMaltaNepalNigerAngolaBelizeBrazilCanadaCyprusFranceGambiaGreeceGuineaIsraelJordanKuwaitLatviaMalawiMexicoNorwayAlbaniaAlgeriaAustriaBahamasBelarusBelgiumBoliviaComorosCzechiaDenmarkEcuadorEstoniaFinlandGeorgiaGermanyHungaryIcelandIrelandJamaica...

London Word Search 2025-10-27

99 Items: RicaCubaIranIraqLaosMaliOmanPeruChileChinaEgyptGhanaHaitiIndiaItalyJapanKenyaMaltaNepalKoreaQatarKoreaSpainLankaSyriaBrazilCanadaCyprusFranceGreeceIsraelJordanKuwaitLatviaMexicoMonacoNorwayPanamaPolandRussiaArabiaSerbiaAfricaSwedenTurkeyAustriaBelgiumBoliviaCroatiaDenmarkEcuadorEnglandEstoniaFinlandGermanyHungaryIcelandIrelandJamaicaLebanonMoldova...

50 most common Ukrainian adjectives. 2025-01-19

50 Items: bignewoldbadlowsaddrywetgooddarklongtallwidedeepfullweaksamerichpoorsourloudwarmcoldsmallreadyyounglightshortemptybravescaryhappysaltycleandirtyquietnarrowsimplehungryjoyfulstrongbittercomplexcorrectbeautifulnecessaryimportantdifferentincorrectfull (satisfied in terms of hunger)

Bo 5.0 2025-01-26

17 Items: מִצְווֹתPlague #8Plague #9“come”, Hebrew“good” in Hebrew“Mitzvah” Hebrew“Hello” in HebrewThe king of Egypt.“Let My people ____”The Holy One’s calendar.Nothing new here…. Ecc.1:9The letter ‘mem’ pictures??The ‘sign’ on the doorposts.“We’ll done, good and faithful _______”These had light during the plague of darkness....

Advent Word Search1 2024-12-01

100 Items: FirHamPiepietreeColdHolyYearNoelPolePineSledNickStarToysYuleBellsCandycanesCardsCedarCometsauceCupidDollsElvesboxesGiftsHappyHollyJollyListsMerryPartyPunchSalesSauceStandTripsVixenAdventAngelsCrowdsDancerDasherDonnerEggnogFrostyLightsRibbonSacredSeasonSpiritpotatoTinselTurkeyWinterWreathBlitzenCandlesChimneycookiesreunionHolidayIciclesMiracle...

HOLIDAYS at MICDS 2025-11-29

100 Items: FirHamPiepietreeColdHolyYearNoelPolePineSledNickStarToysYuleBellsCandycanesCardsCedarCometsauceCupidDollsElvesboxesGiftsHappyHollyJollyListsMerryPartyPunchSalesSauceStandTripsVixenpaperAdventAngelsCrowdsDancerDasherDonnerEggnogFrostyLightsRibbonSacredSeasonSpiritpotatoTinselTurkeyWinterWreathBlitzenCandlesChimneycookiesreunionHolidayIciclesMiracle...

Ancient Word Search 2025-11-23

28 Items: old and important in historya person who designs buildingsunder the surface of the eartha particular part of a city or townsomeone who likes something very muchfrom the period between 1000 and 1500 ADsomething valuable because it is very oldconnected with or believing in a religiona public building where people can see art...

Agape Family Health 2022-07-06

100 Items: newwccuhcpcpdobiudhivobersheakingpainadhdTestlabskingdunnnameraceShotbcbsevanstolerVisitcovidagapeErroradultaetnacignapearlphonevisitemailpillshipaachartnursesnyderkocherfamilyhealthannualvisioncancelHealthhumanaathenacriollowittmanpatientdiseasefloridanewbornexpiredmerrillselfpayaddressflushotexistingpapsmearphysicalvaccinesfollowupschedule...

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

cari kata 2023-11-04

25 Items: bineroktalgenerikdesimalkata.......format gambarmenangkap layardokumen tambahanformat powerpointfitur untuk menutupalat komunikasi 2 arahperangkat keluaran suarafitur untuk menyalin datamenempelkan hasil salinanfitur untuk membuka dokumenfitur untuk mencetak dokumenfitur untuk menyimpan dokumenxlsx adalah format microsoft.......

Christmas 2024-12-01

100 Items: FirHamPiepietreeColdHolyYearNoelPolePineSledStarToysYuleBellsCandycanesCardsCedarCometCupidDollsElvesGiftsHappyHollyJollyListsMerryPartyPunchSalesSauceStandTripsVixenpaperAdventAngelsCrowdsDancerDasherDonnerEggnogFrostyLightsRibbonSacredSeasonSpiritpotatoTinselTurkeyWinterWreathBlitzenCandlesChimneycookiesreunionHolidayIciclesMiraclePageantParades...

American Football 2025-09-14

20 Items: Dallas team nicknamed “America’s Team”Chicago Bears running back nicknamed “Sweetness”Pittsburgh team with six Super Bowl championshipsGreen Bay team that won the first Super Bowl in 1967New York team that beat the Patriots in two Super BowlsFamous stadium in New Orleans hosting multiple Super Bowls...

Unit 3.1 2025-11-23

28 Items: old and important in historya person who designs buildingsunder the surface of the eartha particular part of a city or townsomeone who likes something very muchfrom the period between 1000 and 1500 ADsomething valuable because it is very oldconnected with or believing in a religiona public building where people can see art...

Chapter 5, 7, 9 2023-02-14

22 Items: means nearer the headsuffix meaning diseaseword root meaning heartpressure induced traumacrew resource managementsuffix meaning inflammationmeans further from the trunkwhat occurs after the word rootdecreasing the angle of a jointfilter blood within the kidneyswhat occurs before the word root1-3 years old, pulse rate 90-150...

Cards 26-50 2025-02-03

13 Items: Who vetoes bills?Who is the Governor of Virginia?What is the capital of Virginia?In what month do we elect the president?How many years do we elect a president for?How many justices are on the Supreme Court?What is the highest court in the United States?What political party does the President represent?...

Conversacion 2025-05-13

36 Items: pleaseI'm sad.And you?Good-bye.thank youHello./Hi.I'm happy.I'm tired.I'm sorry.Excuse me.I'm from...No problem.How are you?I live in...Good morning.My name is...See you later.Good afternoon.I'm frustrated.You're welcome.I'm okay./So,so.How old are you?What's your name?See you tomorrow.Where do you live?I'm ten years old.I'm not doing well....

3rd Grade Sight Word - Word Search 2023-08-24

108 Items: bynotoarebuyi'mitsnewoffoneourtootwowaswhowonalsocityhaveholeintoit'sknewknowsaidthentheyyourverywantwearwentwhenwithaboutagaincan'tcoulddon'tfirstlet'srighttheirtherethrewuntilwe'rewherewholewon'twritealmostalwaysanyonebeforedidn'tenoughexcepthiddenmyselfpeopleprettyreallyschoolthat'swinneryou'reanotherbecausedoesn'tgettinggeneraljournallaughed...

Eight Months 2025-06-26

26 Items: catreaddrinkdiscordboardgameice creamcurrent dayyou make me?overachieverour call timefast hedgehogyou live in..the one i loveHappy birthdayi see that townwhere you going?explosive expertyou do that oftenyou say that oftenhope you get it todayfrom that friend bookin my restless dreamsyour favorite activitythey give us items to do...

Cookie Quest - Use the clues below to find the words hidden in the word search below 2025-01-28

10 Items: Jejune (6 letters)rapid new growth (7 letters)fallen or cut off (5 letters)inner lining of the chest (8 letters)to steal like a thief (7 letters)a large crowd of people (8 letters)small wooden wheel or caster (7 letters)the study of voting patterns (10 letters)Modern latin word meaning ‘everywhere’ (10 letters)...

Constitution and First Five Presidents 2025-04-10

11 Items: 1st President of the U.S.2nd President of the U.S.3rd President of the U.S.4th President of the U.S.5th President of the U.S.Novel by Harriet Beecher StoweThe government's powers are restrictedThe turning point of the American revolutionPolitical group that wanted a new constitutionis a 3-letter abbreviation of our first constitution...

Rapunzel pgs. 2-7 2023-06-07

11 Items: Where is the tower?Whose garden was it?What was in the garden?Who stole the lettuces?What color is the girl's hair?What is the little girl's name?What does the witch come to take?What place is the girl's new home?What did the husband do up the wall?What does the husband promise to give?What kind of baby did the man and his wife have?

American Football 2025-09-14

20 Items: Dallas team nicknamed “America’s Team”Chicago Bears running back nicknamed “Sweetness”Pittsburgh team with six Super Bowl championshipsGreen Bay team that won the first Super Bowl in 1967New York team that beat the Patriots in two Super BowlsFamous stadium in New Orleans hosting multiple Super Bowls...

Jenny & Peter 2024-06-09

30 Items: Name of best manBride’s home townGroom’s home townHappily Ever ……….?City where now liveBride’s zodiac signGroom’s zodiac signMonth got engaged inCountry got engaged inLast stop on honeymoonColour of Groom’s suitFirst stop on honeymoonColour of Bride’s dressName of father of brideName of mother of groomNumber of years together...

Republic Word Search 2024-10-23

16 Items: new townHannibalRoman general27 BCE to 180 CEmember of roman plebsmilitary orginizationtransport fresh waterwar between 264 and 146founder of roman empirea leader and protector of the peoplegroup of three people who share powerA group of wealthy land owning familiesupward movement of prices for goods and services...

Find the Missing Word – Past Tenses & Superlatives 2025-10-16

10 Items: While she ____ , her phone rang.That was the ____ day of my life.He ____ a new bike last Saturday.I ____ a long email this morning.While I ____ , it started to rain.They ____ dinner at 8 PM last night.She is the ____ student in the class.This is the ____ story I’ve ever heard!They ____ a movie when the lights went out....

2K6-UNIT1 2023-09-27

9 Items: knowing somethingto keep something safeto accept or use something newnot harmful to the environmentto make something smaller in size or amountgo to an event such as a meeting or a classa device or machine that is used in the houserubbish that people have left in a public placefootpint The amount of carbon produced by human activities

CPDO Services 2022-08-05

7 Items: Focus2 assessment is one example of thiscover letter, resume and mock interview appointments with CPDO staffheld twice per year to help students find jobs, internships and co-opsLearn steps to do all four years for job placement success at graduationgreat resource for all of your career and professional development needs...

Jonathan & Sabrina 2025-07-05

23 Items: The grooms collegeThe brides collegeWhere the couple metThe couple's hometownThe brides middle nameThe grooms middle nameEye color of the groomThe brides favorite colorThe grooms favorute TV showThe groom is _____ certifiedCouples honeymoon destinationHigh school the bride went toHigh school the groom went toThe brides favorite music genre...

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

January Word Search 2025-04-22

19 Items: Spring startsSpooky seasonDay of the workerMiddle of the weekLast day of weekendWinter's break monthBest day of the weekFirst day of weekendWorst day of the weekThe month of carnivalsChristmas and New yearSecond day of the weekThe first month of the yearThe third month of the yearAutumn starts on this monthThe sixth month of the year...

91.The first transcontinental commercial flight took place in 1953, from Los Angeles to New York. 2023-03-07

30 Items: jetfoodfarespeedtravelsafetyairlinenewyorkcockpitcomfortluggageaviationdistancebeveragescheduleindustrypassengerboeing707cabincrewlosangelestechnologyinnovationnavigationflightcrewairtrafficentertainmentcommercialflighttranscontinentaltranscontinentalin-flightservice

The GTN Gazette Word Search 2025-05-30

5 Items: Who is May's Employee of the Month?Where is the Top Accelerators trip going?Where is the team fun day being held? Jetton ____ HallWhat is the new weekly GTN blog newsletter title? The ___What should you bring to the strategy meeting? Your ___ number results.

New Testament Books in Order (minus the ones with numbers and Revelation). 2020-06-26

10 Items: MarkLukeJohnActsJudeTitusJamesRomansMatthewPhilemon