new year Word Searches

Spanish one Vocab Man 2- Abbey Schmidt 2025-10-07

41 Items: PendaymaybookyearweekjunejulymonthtodaymarchaprilagustfolderpencilmondayfridaysundaytuesdayjanuaryoctobernotebooktomorrowthursdaysaturdayfeburarynovemberdecemberclassroomwednesdayseptemberTeacher(male)Itś the..of..student (male)sheet of paper(student) desksutent (female)Teacher (Female)Itś the first ofWhat is the date?what day is it today?

Nursing Shortage 2023-12-01

17 Items: nursesafetyhealthsupplydemandshortageworkloadbedisidestaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

Cat Word Search 2023-12-01

17 Items: nursesafetyhealthsupplydemandbedsideshortageworkloadstaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

שמואל אי פרק י 2024-02-15

14 Items: Hebrew for modestyShaul was from this familygreat granddaughter of ShaulYou do this to make someone a kingShmuel told everyone to gather hereShaul was hiding amongst the vessels and the __word that can mean "children" and a young goatsShmuel told Shaul that he will temporarily get thisShaul never told him that he was going to be the king...

The Wardle Wedding 2025-07-15

12 Items: New last nameWedding VenueOur favourite shot?Nicolas high schoolDarren’s high schoolWhere was Darren born?Where was Nicola born?who does Darren support?Town where our first date waswhat month did Darren propose?Cut of Nicola’s engagement ringhow many years have we been together?

Cats Looking For Their New Home 2025-08-04

6 Items: GuavaWorbleLycheePapayaStarfruitSebastian

Spot your spirit for the year ahead! 2025-12-29

8 Items: BoldRoyalFreshSmoothJoyfulLivelyMagicalFabulous

Small Choices, Big Impact 2025-09-16

6 Items: - Taking over someone’s login- Extra layers of login protection- Encrypted tunnel for private browsing- Information intended to be kept secret- Installing new versions to stay secure- Modern password-less authentication method

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Vwo 1: Unit 2 2025-02-21

102 Items: ACTBUYCANDAYEATEGGFITHATTIECOATDISHDRAWHOURLAMBMAINMEALPASTPLAYREADSHOESIDESINGSIZESOCKSUITWEARYEARAPPLEBREADCLOCKDAILYDAIRYDANCEDRAMADRESSFRUITJEANSLUNCHMATCHMONTHMUSICNIGHTORDERPAINTPANTSSCARFSERVESHIRTSKIRTSPORTWRITEBAKINGBLOUSECARROTCHEESECHOOSECINEMACOOKIEGAMINGJACKETJUMPERLISTENMINUTEMOMENTMOVIESOUTFITPOTATOSHORTSTOMATOWEEKLYBISCUITCENTURY...

Doapresentation Word Search 2025-09-28

26 Items: termbreaktime,say sorry,take notes,feel lonelyget on wellfail a test,miss school,pass a test,take a test,school year,get to know,state school,make friends,get a low markwrite an essaykeep a secret,tell the truthwear a uniform,private school,get a good mark,do a presentationcheer someone up,have an argument,revise for a test,have (a lot) in common,

EP2 2025-10-02

41 Items: PendaymaybookyearweekjunejulymonthtodaymarchAprilfolderpencilmondayfridaysundayauguststudentstudenttuesdayJanuaryoctobernotebooktomorrowthursdaysaturdayFebruarynovemberdecemberclassroomwednesdayseptembermale teacherstudent desksheet of paperfemale teacherwhat is the dateIts the... of...what day is todayIts the first of...

Acrobatics Word Search 2026-01-20

100 Items: OxDogJoyPigRatRedCarpCoinDrumGoatGoldJadeKnotLionLuckMoonPlumYearClansFeastHorseMusicPaperPeonyQipaoSnakeStoryTigerUnionYouthDragonFamilyGardenHotpotMarketMonkeyOrangeParadeRabbitRecipeRiddleScrollSeasonShadowShrineSpringStallsSymbolTempleTravelWealthWishesZodiacBanquetBannersBlossomCandlesCultureDancingFortuneHarmonyIncenseLanternNoodlesRenewal...

New ICD-10-CM Non-Pressure Ulcer Sites With Levels 2025-10-02

14 Items: NeckFaceHandLeftChestGroinRightMuscleAbdomenForearmUpperArmNecrosisSkinBreakdownFatLayerExposed

Sunshine Word Search 2025-04-28

9 Items: A holiday in early JulyBright light from the SunWhat people drive in waterWhat you do with a sailboatWhat people use to cool downThere are 4 _______ in a yearWhat season has Aug, June, and JulyWhere food, flowers, and plants growWhat people have when they eat outside with friends

Secret Santa!! 2025-12-25

4 Items: Beautiful foals are born hereThis breed arrived in August of this yearYou are the leader of this breed’s chat club!These cute pets boost your horse’s performance in competitions

Get To Know the Couple 2023-08-08

10 Items: Thando's birthtownThando's middle nameThando's new surnameThando's favorite drinkMonth that Bobo was bornBride and groom's hometownTown where Bobo studied UniversityTown that Thando currently works inMonth that Bobo and Thando reconnectedWhat comes second to Thando in Bobo's life

C&S Wedding Day 2025-03-02

10 Items: come on you...precedes hair dayStephen's favourite foodone of Charlotte's many hensthe only rules Charlotte followswhere Stephen proposed, Streatham...Colchester boys that like coffee and tvthey jetted here just after they got engagedthe name of Stephen's fish that passed away last year (RIP)...

One word for a phrase 2025-08-13

10 Items: Easily brokenHappens every yearA place with gamblingThe study of living thingsPerson from another countryA professional rider in horse racesPerson related by blood or marriageAnimals that live both in water and on landA person who looks on the bright side of thingsA person who pretends to be something they are not

Word Search 2025-03-11

100 Items: taxzooskyseadaypetbeelegssinkshipwrensocktankroomsignpearauntantsbabyplothairmealyearsailsodateamideadesktripbaittalkknotswimyardwinecaveprosesheetburstscaleskatebooksfleshnightforcewatchwatersteelscarfknifeactorskirtgeeseframesongschessgrainsnakequiltslopejewelcoughscenemusclesneezeattackpowderchancezephyrwealthcloverlocketbucketrecordmarbledegree...

Adorable Word Search 2026-05-05

104 Items: EmujoyTapBootCarsDustFoldGainHardJerkKingLampMeltPeedXrayYearZestBleedChalkEmptyFoamyFaintIdiotLumpyNeverQuietQuailQueenQuietResetRifleSkateWearyWholeWorryXenonXaxisDesignExpandFinishGreedyInsectJesterKnightMonkeynormalOrangePrisonPurpleRattleSticksSystemTrucksThingsUnusedYellowZipperZombiezodiacAshamedAbidingBeseechCuriousConnectDestroyJumping...

Ancient Rome Vocab #1 2024-04-29

16 Items: A person who is highly educated.A public office in the Roman Republic.A war between citizens of the same country.To break away from or rise against authority, a rebellion.A powerful body of 300 members that advised Roman leaders.The governing and advisory council in the Roman constitution....

Year 3 spellings 2024-10-18

3 Items: wrote wrigglegnome sign design wrong wrapknit knee knife knight gnash

Year 5 2025 2025-01-17

3 Items: AriaAustynCooper

Spellings Year 6 2025-09-25

3 Items: tolerantexpectant hesitancyobservance observant

Using Latin I, Unit IV, all words 2023-09-18

37 Items: godwarskyhairlampyeargiftwordcrownspearmoneyfieldswordseizepalacefrienddangerchangegoddessillnessvillageweaponscouncilkingdomto fightto avoidbeginningto refuseriver banklaurel treeray of lightpeople, nationhearth, fireplacewisdom, good senseshade, shadow, ghostbe awake, be on guard, watchto wound, injure, harm, damage

Osiris Word Search 2025-05-13

12 Items: Our PharaohOur Region NameEndorse the NewFloats in the SkiesTheme of this EditionGoodnight with a PhaseThe Light in One's EyesThing Our Authors Wroteof the Resentine KingdomThe Title of Our NewspaperInstead of Zombies We HaveFilled with Fish and Maybe Kraken

Welcome To Middle School! 2026-04-30

21 Items: Our Middle School PrincipalWhere you check your gradesWhere you eat lunch each dayWhat recess is called in middle schoolSomething you study and grow in ScienceWhat we do at the end of every Math unitSomething that increases a bit in 6th gradeA test you take multiple times during the yearThe book current 6th graders are reading in LA...

very fun year 8 word search 2026-02-12

7 Items: campaigncontextualguidelinessupportivecontextualcyberbullyingsustainability

Days, Months, Celebrations 2025-05-22

11 Items: First day of the week.The day you were born.Last month of the year.The beginning of spring.The start of the weekend.The last month of summer.People go to church on the day.The day of love with chocolate.A holy celebration with presents and Santa.Resurrection of Jesus, egg hunt and bunnies.Spooky, monsters, ´trick or treat´, costumes.

Vocab Man 2 2024-09-16

40 Items: PenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustTuesdayJanuaryFebuaryOctoberNotebookIt's theTomorrowThursdaySaturdayNovemberClassroomWednesdaySeptemberStudent deskIt's the..ofStudent(male)Teacher(male)Sheet of paperStudent(female)Teacher(female)What is the date?What day is today?

100 English Words 2025-03-10

100 Items: CatDogIceSunJoyZooFastJumpKindPlayRainTreeBabyEasyKingLionNestDoorGoldKiteLampOpenStarXrayYawnIdeaSnowYearEchoAppleGreenHappyLaughNightQuietVoiceWaterZebraChairDanceFunnyHouseOceanQueenRiverSmileTableUnderBreadClockHeartJellyQuickCloudLemonMusicQuiltTigerWagonXenonMonkeyOrangeYellowAlwaysGardenIslandPencilWindowYogurtEnergyFlowerInsectPillowRabbit...

Time Word Search 2025-04-28

100 Items: waydaymanloteyejobendlawcarkidartwarguyairtimeyearlifehandpartcaseweekworkhomeroomareafactbookwordsidekindheadhourgamelinecitynameteamideabodybackfacedoorgirlthingwomanchildworldstategroupplacenightpointwatermoneystorymonthrightstudyissuehousepowerlevelpartyforcepeopleschoolfamilysystemnumbermotherfriendfathermemberminuteparentothersofficehealth...

Laura Reformation 2026-04-17

12 Items: Started the Jesuits.From Italy. Persuaded Pope Gregory XI to return the papacy from Avignon to Rome.The spread of Protestantism went hand and hand with a growing feeling called __________.By the start of the 1600s, there were already many different Christian churches in Europe....

02.14.2026 2026-02-02

16 Items: where we metour first datethe year we metlab hannah work atour favorite animalethnicity of hannahewan's football teamewan's favorite colorbest thing in van nuyshannah's favorite colorhannah's favorite holidayhannah's favorite sandwich placehannah's favorite protein sourcepunk band we saw the first time we went together...

World Malaria day 2025-04-10

5 Items: Diagnostic test for MalariaParasite that causes MalariaVector that transmits malariaspecies name for new strain of malariacommon drug used for treatment of acute plasmodium falciparum

Dave's Faves ( A 90-year-old knows what he likes.) 2025-06-19

14 Items: What does Dave drive?Who is Dave's trophy wife?What is Dave's fave entree?What is Dave's best feature?What does Dave play music on?What is Dav's favorite treat?What does Dave play every day?What is Dave's fave casserole?What is Dave's drink of choice?Who does Dave root for in spring?Who is Dave's favorite furry girl?...

😂Year 3🦍💨💨 2025-11-23

6 Items: PainBakingSoldersGodbreadHaircrazyConffesion

The 1000 year old word search 2026-03-09

6 Items: RoxyBangBiffaAfileAidenTrinidad

Building our vocabulary (look these up if they are new to you!) 2025-09-12

25 Items: adaptexcelwavertauntsereneassureordealsummonacquireimmensemournfulreassuresabotageignorantstrategyelaborateintricateestablishdeterminedhypothesisoptimisticsufficientcomprehendexaggerateconsecutive

Sip and Search! 2025-03-03

18 Items: Our venueOur new nameWhere we metOur fur-babyThe MinimoonWhere we liveThe HoneymoonYears togetherEllie is the ___We exchanged ___The month we metDaniel is the ___Why we're all hereThe month Daniel proposedEllie's favourite TV showDaniel's childhood nicknameWhen we celebrate our anniversaryType of food we had on our first date

Job Search 2026-03-02

18 Items: networkbe hiredget a jobset a goalwrite a resumetalk to friendsapply for a jobstart a new jobcontact referencesgo on an interviewset up an interviewwrite a cover lettersubmit an applicationcomplete an applicationresearch local companiescheck employment websitesgo to an employment agencylook for help wanted signs

Months of the Year, Seasons, Sun, Moon, Stars, (Find in Spanish) #3 2025-09-27

25 Items: MaySunDayJuneJulyWeekFallMoonStarMarchAprilMonthNightAugustSeasonSpringSummerWinterPlanetJanuaryOctoberFebruaryNovemberDecemberSeptember

Bigfoot Word Search 2024-10-17

39 Items: 5GETsYeti9/11UFOsAhoolLaharaDogmanYowiesQ AnonBigfootMothmanOgopogoRoswellAmomongoMK UltraMegalodonJackalopeChupacabraSiren HeadChemtrailsFreemasonsIlluminatiDeep StateFlat EarthJohn RogersThunderbirdLycanthropesMoon LandingDead InternetFalse Flag OpsClimate ChangePaul McCartneyDenver AirportTupac Is AliveNew World OrderLoch Ness Monster...

Wilfred Word Search 2025-01-17

68 Items: DOTEATEAPHOCANAYORKUTAHVOWSCAKEKAREKISSRAMENTEXASSTICKPOINTUNITYVEGASGUMBOTOASTUNIONDANCECREAMSUSHILONDONCOSTCOCOFFEEHOTPOTHIKINGWALKERCHEERSFAMILYMOVIESWILFREDHOTDOGSFOREVERMOJITOSTABLETSGEORGIABUFFETSFASHIONKIDNEYSVIETNAMENDLESSMARRIAGESTERLINGGAITBELTTHAILANDLIFETIMEEXERCISEPOLAROIDBAKERIESAIRPLANESHAPPINESSVACATIONSCHANTILLYHYDRATIONCHILI BOWL...

What Else But Music? 2026-01-13

30 Items: CaféGo OnreggaeversusSublimea-sidesb-sidesacousticThreewayYou Swan,Buck MeekTake OffsMazzy StarRilo KileyEverythingTeam AliceMount EerieJulie DoironLittle WingsAnd LandingsScarves OverCocteau TwinsFour-CalendarSongs IslandsThe MicrophonesSeven New SongsAdrianne LenkerSteven J. WalkerThe Painted OnesShe Hangs Brightly

Wedding Wordsearch 2025-06-24

10 Items: Our new last name.Our first holiday.Where did we meet?The name of our dog.Where did we get engaged?What month is our anniversary?Where did James go to university?Our favourite holiday destination.Our favourite weekend destination.How many years have we been together?

Ghost 2025-11-01

10 Items: Ghost's coachGhost's bullythe main characterruns long distanceruns as fast as Ghostnotices Ghost's "new" shoesthe only newbie who is a girlthe main character's real namewhat does Ghost steal from the storethe name of the track team Ghost is on

W cosmetics is coming to New Zealand 2025-11-20

7 Items: FweeTirtirRomandTocoboMerythodHeartPercentMuzigaeMansion

Sub work 1-9 2023-01-09

20 Items: business leaderAllotment of Landsspiritual movementJohn D. RockefellerUnion founded in 1869William Jennings Bryanpeaceful labor rally gone wrongdistinguishes Americans from Europeansprohibiting all immigration mainly from ChinaJournalist and social reformer in New York Cityprocessing station off the coast of New York City...

Pauvre Anne 1 2025-01-23

30 Items: dadmombuscarhousemoneystoreshoesfamilysisterschoolbrotherblousesclothesto helpto findmechanicto watchto laughlong hairsecretaryto pick upnew clothesa young girlbrown-hairedshopping mallto search forto save (money)bleus – blue eyesto leave (something)

What Else But Music? 2026-01-13

30 Items: CaféGo OnreggaeversusSublimea-sidesb-sidesacousticThreewayYou Swan,Buck MeekTake OffsMazzy StarRilo KileyEverythingTeam AliceMount EerieJulie DoironLittle WingsAnd LandingsScarves OverCocteau TwinsFour-CalendarSongs IslandsThe MicrophonesSeven New SongsAdrianne LenkerSteven J. WalkerThe Painted OnesShe Hangs Brightly

7A Vocab Man 2026-03-05

32 Items: capnewcoatsuitboththisthatbootssocksshirtskirtjeanspantsdressshoesmaybethesethoseblousejacketshortsT-shirtsweaterto wearto wantswimsuitexcuse me¡lets go!to prefersweatshirtto be correctto think, to plan

Learning spanish 2025-07-02

33 Items: donewworktypeWhatthatwheresmallwhicha bitothersplacesmovieslistentraveldancingcampingcharmeddrivingparkingmajorityminoritylanguageto watchlearninghow muchcountriesvacationswould likeclassmatesa tiny little bittell us a bit about yourselftell me a bit about yourself

CFA Review 2025-12-14

17 Items: Earth’s ____________ causes seasonsstored energy is _______________ energyenergy of motion is _____________ energy______________ energy stored in food, fuel, or batteriesa ________________ wave where particles move up and downa _____________ wave where particles move back and fortha _______________ element is a poor conductor and often dull...

Word Search About Us 2022-12-23

10 Items: My Middle name.Your last name.Our Secret word.Where I go to camp.Your favorite drink.Your favorite artist.One of my favorite colors.Colada My favorite drink.Jersey The State We live in.The area of our first date.. and where we go all the time.

Columbus Word Search 2024-08-07

20 Items: Capital of the Aztec Empire.Spanish conquerors of the Americas.Native American empire conquered by Cortés.Spanish colonial territory in the Americas.Aztec god whom Moctezuma mistook Cortés for.People of mixed Indian and European heritage.Spanish conquistador who conquered the Incas.Native American people in the Rio Grande valley....

a 2026-02-03

165 Items: TogoPeruOmanMaliIranIraqFijiCubaRicaChadFasoYemenTongaSudanLankaSpainSamoaLuciaQatarPalauSyriaNigerNepalNauruMaltaLibyaKenyaJapanItalyIndiaHaitiGhanaGabonEgyptCongoChinaChileVerdeBeninTuvaluZambiaTurkeySwedenSerbiaArabiaMarinoRwandaPolandPanamaNorwayUgandaAfricaMonacoMexicoMalawiJordanGuyanaLatviaKuwaitIsraelGuineaGreeceGambiaFranceGuineaCyprus...

Intro to New AF Cont. Word Search 2024-10-11

7 Items: Which team needs to approve your tax category before you can send any sort of bulletin?The color of fields that have LMDA migrate over after 15 minutes from SAP data submissionSystem that is responsible for transferring applicable data from the AHEAD systems to CBIS...

Holiday Party Sip and Search 2024-10-25

48 Items: Silver and...Joy to the ...Santa's HelpersHot apple drinkWhere Santa LivesMan with a red hatThick, soft dessertWho said Bah-HumbugName of famous snowmanReindeer with red noseLast month of the yearWe wish you a Merry ...Santa's favourite snackSanta checks this twiceColour of Rudolph's nowSomething you kiss underReindeers favourite food...

Space and Technology Word Puzzle 2023-01-03

25 Items: The endless voidA new thing to createA thought or a feelingAnother word for modelSomething used to divedThe continue or to makeThe subject with numbersSomething used to times itA bright source or a movementTo get more of an understandingThe element on the periodic tableUse it to make something organizedA branch of physics and technology...

Great Depression 2026-03-01

20 Items: exposure to danger or harmborrowing money to buy a stockhands off style of governmmentpeople are buying lots of stuffStruck down many New Deal programsprogram that helped senior citizensplace you can buy pieces of companieslowest pay for a job permitted by lawa major symptom of the great depressionprices are rising and stocks are going up...

Ki Tetze 5.0 2025-08-30

25 Items: According to the Torah, the punishment for adultery.According to the Torah, he receives a double portion.According to the Torah, whose memory must be blotted out?According to the Haftarah, Who is the Holy One of Israel?According to the Haftarah, what shall not depart from you?According to the Torah, what must not be taken as a pledge?...

Vocab 3 2023-09-21

10 Items: Sally spent her money __.I needed a new ___ for my glassesI ____ to get this crossword done.The new statue in the museum is very______.I had to ___ myself from blurting out the answer.The drama that sally started was so because it wasn't important.Joey was so mad that anybody in his path was ____ over with all his might....

NEW Week 6 - ou making the short /u/ sound, as in young 2025-02-23

22 Items: touchyoungroughtoughdoublecousincoupleenoughcountrytroublecousinscouragenourishjourneyflourishsouthernyoungestencouragemoustacheBountifultroublesomemountainous

escape 2025-04-11

6 Items: the Cain's new home (7)Cam's favourite hobby (3)Jordana's future title (2)the sweetest boy in the world (1)something Jordana is amazing at (1)the hole Cam always swings twice (10)

Industrial Revolution 2024-12-10

14 Items: a popular votethe act of setting freea movement to end slaverymoney available for investmentGerman for ‘Caesar’ or emperorthe reliance on military strengthmale suffrage- the right of all to vote in electionsempire- an empire in which people of many nationalities livecrop- a crop that is grown for sale rather than for personal use...

Happy Birthday Mom!! 2025-11-30

9 Items: 1 2 1 2 3New side questWe are _______ ____I am _____ wash my bellyGotta go get _____ __ _____Word for normal and regularShayna uses a ______ in dreamsMom uses the same piece of ____I hurt my wrists from doing ___ so much

Beta Clan Word Search 2026-01-01

14 Items: Clan PowerClan MaterialTown in New BetaBetas King PetpetMost Common BiomeCity of SurvivorsBeta is the ___ clan___ covered landscapeCommon Beta SterotypeBeta’s Political SystemBetas Battle and Art FormWhat it Took to Change BetaOnce Former and Current LeaderDigs Holes Large Enough for Kids to Fall In

LATIN DAY 2023 WORD SEARCH 2023-04-29

80 Items: viaboywarsitseedognoxdaysunnewshiptreecasaroadgirlpuerbabybirdaviswalkhearwordmoonlunadiesstarpatermatermilesnavisnautaarborhousesedeoaudioteachdoceovideohorseequuscarryportocanisnightsolusearthterracoeloworldsmallgreatnovusfathermothersailorpuellainfansbellumchurchfarmerambulogaudeofamilyverbumstellaheavenmundusparvusmagnusgardenhortussoldier...

Sip & Search (Mr. & Mrs. Nzeh) 2024-10-07

26 Items: FoodKissDanceIsraelFlowersBurgundyRoseGoldGroomsmanBridesmaidVenue locationBride’s eye colorProposal locationHow did they meetGroom throws thisBride throws thisGroom’s birthplaceBride’s birthplaceWho takes pictures?Bride's maiden nameBride and groom standMarried man is calledBride's New last nameGroom’s favorite sportTrip taken after wedding...

Vocab Man 2026-03-18

27 Items: NuevoBuscarEntrarLlevarComprarLa BlusaLa FaldaLa GorraEl TrajeLa TiendaEl AbrigoLas BotasLa CamisaLos JeansEl SuéterEl VestidoLa CamisetaLa ChaquetaLa SudaderaLos ZapatosEl DependienteLos CalcetinesLos PantalonesEl Traje De BañoLa Tienda De RopaLos Pantalones Cortos¿En Qué Puedo Servirle?

uso correcto del uso ing con ciertos verbos 2025-01-23

16 Items: stop livinggoing to bedbeing somewherediggesting foodleaving the bedstarting somethingobserving somethingnot saying the trueaccepting somethingdiscovering new thingsceacing doing somethingmoving your feet super fastproducing words with your mouthmoving from one place to anotherproducing melodies with your voice...

kassidys word search 2023-12-18

18 Items: big bareSmall bareshoting starare universespace reserchersgive off or glowa sistem of starscontalashon beliefwe are on ---- earthIcy body that releases gasespeace of rock still in spacesomeone that "lives" in spacelight bounceing off something12 hours of day 12 hours of nightthe moon is stuk in the earths ...longest or shortest day of the year...

Halloween Trivia Word Search 2025-10-17

11 Items: used to locate returned or rejected ACH itemsBeneficiaries can only be added to an account byNever speak to a ________ on a rep payee accountWhat transaction code is used when issuing a cashier checkWhere on Symitar can you locate if a member has a pin on their cardaccounts are prohibited from completing phone transfers to alternate memberships...

blackpink/seventeen/txt/stray kids/itzy/ateez/nmixx/le sserafim/oneus/the boyz 2023-05-16

80 Items: qdkinjuntxthanliasanbaenewlisarosethe8dinoitzyyejiyunalilyxionericjisoohoshiwoozifelixateezyunhominginmixxjiwoooneusseoholeedokevinjacobjenniejoshuawonwoomingyuvernonsoobinryujinjonghohaewonkyujinkazuhasakurayunjinsunwoojuyeons.coupsyeonjunbeomgyutaehyunhyunjinleeknowyeosangeunchaechaewonkeonheetheboyzhyunjaejeonghanbangchanseungminchangbinseonghwa...

High Flyers J Unit 3 2024-09-08

50 Items: BundChinaIndiaJapanItalySpainEgypttowerCanadaRussiathe UKMexicoFranceBrazilGreecedivingsafaribridgecastlemarketsquarestatuetempleIrelandthe USAGermanyBoliviaIcelandsurfingBig BenPortugalThailandshoppingtrekkingfountainAustraliacathedralHyde ParkYu GardenLondon EyeNew ZealandSouth KoreaSwitzerlandguided tourSouth AfricaCrown JewelsRiver Thames...

Pauvre Anne 1 2025-01-23

30 Items: dadmombuscarhousemoneystoreshoesfamilysisterschoolbrotherblousesclothesto helpto findmechanicto watchto laughlong hairsecretaryto pick upnew clothesa young girlbrown-hairedshopping mallto search forto save (money)bleus – blue eyesto leave (something)

Black Word Search 2025-04-25

80 Items: newredoldbig800subbirdbluetypemalehugedarkgraydeadlilyfinegreywildrarelivetameeyedhalfblackwhitegreenlargesleekyoungsouthshinygiantgrownolmecangrybrowncagedslungfemaleyellowfiercehungryheadedsavageseatedmarooneatingmightydrivengoldenlatestbrightcarvedspottedcoloredclassicelusivebelovedlargestwreckedmexicanamericanpowerfulenormousstylizedfamished...

Term One HASS 2026-03-24

80 Items: ACTMapPastLandLakeSandReefCaveEastWestMungoDiaryToolsRocksUluruCoralOceanCoastStoneEarthWaterBeachRiverNorthSouthStatesFossilSourceLetterPlantsDesertMarineIslandNatureLocateForestTravelRegionCapitalCultureHistoryPresentCountryAncientPrimaryObjectsNaturalStreamsExploreShelterHabitatCompassVictoriaTasmaniaPaintingEvidenceFeaturesApostlesMountain...

Danielle And Otto 2024-07-03

32 Items: Groom’s nameBride’s nameBest Man’s nameOfficiant’s nameGroomsman’s nameBridesmaid’s nameBride’s professionGroom’s professionBride’s maiden nameBest dog in the worldBride’s new last nameBride’s favorite foodGroom’s favorite foodBride’s favorite drinkMatron of Honor’s nameInstrument the groom playsFirst honeymoon destination...

APUSH Chapter 1 Word Search 2024-08-07

20 Items: Capital of the Aztec Empire.Spanish conquerors of the Americas.Native American empire conquered by Cortés.Spanish colonial territory in the Americas.Aztec god whom Moctezuma mistook Cortés for.People of mixed Indian and European heritage.Spanish conquistador who conquered the Incas.Native American people in the Rio Grande valley....

Going on Vacation 2025-06-17

30 Items: get toon vacation iscool museums full ofon shiny calm lakes orfantastic new places andand crashing waves whilegiant sandcastles by theunder the bright blue skyand amazing old treasuresroasting over a warm firebikes on fun twisty trailsincredibly exciting becausehappy songs by the campfirefor slippery fish in riversin the vast sparkly ocean or...

Voltage Word Search 2026-03-16

22 Items: 2 of the same atomcircuit with 1 loopthe push of electronsthe flow of electronspositive charge in an atom2 different elements bondedcircuit with more than 1 loopN is the symbol of this elementa neutral charge within the atomMg is the symbol of this elementNa is the symbol of this elementsand and water is an example of this...

Emotions & Sentiments About The Nearing End of The Year 2025-05-30

11 Items: FearTiredReliefStressElatedChangeSadnessBurntOutExcitementBittersweetAccomplishment

Halloween Trivia Word Search 2025-10-17

11 Items: used to locate returned or rejected ACH itemsBeneficiaries can only be added to an account byNever speak to a ________ on a rep payee accountWhat transaction code is used when issuing a cashier checkWhere on Symitar can you locate if a member has a pin on their cardaccounts are prohibited from completing phone transfers to alternate memberships...

US History Unit 7 Word Search 2023-02-28

10 Items: what war happened in 1998?Who built the Panama Canal?What act was passed in 1914?What act was passed in 1934?What was built in the year 1904?what policy was created in 1899?The germans sank what ship in 1915?What factory fire happened in 1911?Who attacks the "triple wall of privilege"?Who used pesticides to eliminate dangerous tropical diseases?

Inspection Word Search 2025-01-06

10 Items: UPMNCHFAfriendlycareful examination or scrutinyoccurring once every quarter of a yeartrash that is left in an open or public placethe process of keeping something in good conditiona person living near of next door to the person referred toa particular area or place considered together with its inhabitants...

Chemistry Vocabulary Word Search 2026-02-17

19 Items: single unit of an elementmade of only 1 type of atom2 or more atoms bonded together2 or more elements bonded togethermixture that is the same throughouta mixture in liquid (usually water)mixture that is not the same (different)anything that has mass and takes up spacea new substance is created in a ____ change...

大きい Word Search 2025-07-17

12 Items: bigoldnewsmallquietfamouslivelyconvenientbeautiful-uinterestingtraditionalbeautiful-ki

Wedding Word Search 2025-09-19

8 Items: Where Lauryn is fromMonth we got engagedTown that we live inWhere Alejandro is fromThe bride's new last nameMonth we are getting married inWhere we are going for our honeymoonThe name of Lauryn and Alejandro's dog

Brazil 2026-03-09

10 Items: very largewhere two rivers meetthe usual weather of a placeraised areas of land or plateausthe line where two countries meetthe visible land features of an areaan area of land with similar featuresa dense forest that receives heavy rainland covered with water for most of the yearimaginary lines that measure distance north or south

Simile Word Search 2025-08-18

10 Items: with "like" or "as"The feeling a poem givesThe beat or pattern of a poemDescribing with the five sensesvoice speaking in a poem → SpeakerGiving human traits to non-human thingsTime of year (often used in nature poems)A comparison that says one thing is anotherWords that imitate sounds (e.g. buzz, crash)...

Big Room 2022-12-28

1 Item: population, understand, carry, wood, cake, profession, commitment, match, bird, quit, order, award, basis, climb, castle, surprise, house, game, self, new, year, 2023, happy.

Just a Bunch of Words 2025-11-17

220 Items: ashoakelmcowcatdogpigcryskysunmanbignewredbowboyhatbedwetdryeyeearseelegarmpinetreebirdduckswanlakealpsshipbabycutestarmoondarkyarnfreeflagloudjoketypedatetinycoldwarmcoatyearfarmbarnsongsingrainsnowbluepinkgraycyangirlmalefullroombathhaircombhandfootnosehearbrowgoldlipschinshinpoutheadaspenhorsemousepuppygooseriverpatchoceantearstiredhappylaugh...

Greenisland Word Search 2025-09-17

10 Items: Who said “I love you” first?He proposed during this monthTheir favorite breakfast drinkYear they started dating: 20___Where was their first trip together?Where was Lauren & Trevor’s first date?What is their favorite day of the week?Their favorite season to spend togetherWhat is the name of their wedding venue?...

Aquarium Word Search 2026-02-05

10 Items: Month we metyour favorite colormy nickname for youfirst day trip we tookWhere we had our first kissWhere we went on our first datewhere we went on our second datewhere we took our first train ride towhere we take a photoboth picture every yearanimal we saw when you asked me to be your girlfriend