minnesota towns word Word Searches

Word Search 2026-04-25

15 Items: forktwistclampscrubbrushthinkshapephonewhaleslidethemestormmagnetbasketnapkin

Word search 2026-04-27

15 Items: BatuArabNisanIndiaHindiaCambayMahatmaGujaratMoquettePijnappelPetrokimiaMaharasthraGandhinagarPerdaganganMalikussaleh

WORD WORK 2026-04-27

15 Items: apronsecretposterdegreebushelticketauthorrocketgatherratherdeclarewhetherachievechickenwhiskers

Word Search 2026-04-29

15 Items: DogFarmGamesSportSoccerGardenSchoolWinnerCookingRunningChickenReadingMuffinsHomeworkSunshine

WORD SEARCH 2026-05-01

15 Items: WaveEchoSoundSpeedCrestForceNewtonGravityDistanceLightWaveWaveLengthMagneticFieldTheLawOfInertiaLawOfAccelerationLawOfActionAndReaction

My Unit 2 Linear Equations Vocabulary 2025-10-08

13 Items: y = mx + bm/s, yards/sec, miles/hourHow quickly something changes over timeA point at which a graph intercepts the y-axisA point at which a graph intercepts the x-axisIt is the slope-intercept form but in different way!A fixed reference line for the measurement of coordinatesRun, going side to side, like the horizon. Paralell to the horizon....

Easter Word Search Word Search 2024-07-06

15 Items: egghuntlamblilybunnychicktulipbloombasketspringbonnetcarrotpastelchocolatejellybean

word 2023-03-10

9 Items: FOODBOOKSSERIESSPORTS& RELAXdancingworkoutpaintinggardening

Word 2021-01-21

9 Items: lumitalvpakanesuusadlumememmlumepalljääpurikaslumehelvekelumekindlus

games 2024-12-20

1 Item: search generator uses a basic word filter to prevent the accidental, random creation of offensive words. When you create your puzzle, please check it over it carefully to be sure unintended words were not added by our random letter generator.

SPP 203 WORD SEARCH PUZZLE 2025-02-27

10 Items: The study of human measurements for designing ergonomic spaces. (One word)The study and preservation of historic buildings and cultural sites. (Two words)A specialized service focused on controlling sound within a building. (Two words)A process of studying wind and sun patterns to optimize building design. (Two words)...

Hiragana Word Search 2025-07-24

10 Items: the japanese writing system for japanese wordsthe Japanese art of flower arranging that emphasizes form and balancea gambling device resembling a pinball machine but with automatic payoffJapanese comic books and graphic novels considered collectively as a genreone of a line of military governors ruling Japan until the revolution of 1867–68...

Understanding VERBS 2024-11-26

11 Items: means you are making, crafting or creating somethingmeans to get up high for a second or two by moving your legsmeans something like you or something is bad purposely to othersmeans you or something/someone is speaking a word out of their mouthmeans moving your body and hands mostly to float or move in the water...

find the words 2026-01-23

1 Item: nails for math sister word coper hair me other soccer dog love my people the

Space II 2023-03-09

23 Items: a moonless planetthe solstice on june 21another moonless planetthe name of pluto's moonmain gas in Mars' atmospherethe brightest star in TaurusFirst american woman in spaceWord meaning "around the sun"a moon feature named CopernicusThe liquid in the ocean of TritonWhat is the star nearest to the sunthe constellation for the star Vega...

Run It Back 2025-10-09

30 Items: Aka OJ.The metro.Worn by legs.Pancake maker.Cheese selector.ASH'S x ________Hola! in English.Hello! in Spanish.The capital of Spain.The opposite of walk.It's lonely at the top.A classic pancake topping._____________ to your cup!!How pancakes should be served.Bean juice that keeps you awake.Flies by when you're having fun....

Cougar Chaos 2026-03-29

23 Items: Utahs state flower(8)Maine State capital(7)The body’s largest organKanye Wests moms name(5)Genghis Khans real name(7)Lebron James' middle name(7)The fundamental unit of life (4)Phonk Clown (Why so serious?)(7)The capital of the Philippines(6)The # of hearts an octopus has(5)A triangle with all sides equal(11)A group of lions living together(5)...

EARTHQUAKE 2026-04-14

20 Items: – Another word for an earthquake.– The size or energy release of the quake.– The sudden upward movement of the ground.– Smaller quakes that follow the main event.– When one tectonic plate slides under another.– The breaking or tearing of the Earth's crust.– A long, narrow crack or opening in the ground....

Birthday Boys Favorites 2026-01-30

16 Items: Favorite month: Jingle bellsFavorite sport: Ready, set, hikeFavorite food: A popular Italian foodFavorite color: The color of the oceanFavorite drink: Regular milk plus pizazzFavorite movie/show: Does Littlefoot ring a bellFavorite season: The season between spring and fallWhat he loves most: The people who care and love him most...

Yes sir 2024-09-11

195 Items: aisbedogoamheanwasarehadcanusehasseedidgetmaysaysetputasktryaddsawgotruneatletcutwaydaymanboyendmenaireyecarseaonealltwonewoldanybigownhaveweresaidwillmakelikelookbeencallfindcomemadetakeknowlivegivehelptellcamewantshowdoesmustwentreadneedmoveplaykeepturnseemopenwalkgrowtookhearstopmisstalkwordtimepartworkyearbacknamelinefarmlandhomehandpagefood...

Chai Spy Word Search 2026-02-13

47 Items: RAITACLOVEPEKOETABLAMALAIMANGOMEHNDIJALEBIPUNJABGINGERBENGALDHOLAKKOLKATAMONSOONSAFFRONNAMASTEKASHMIRCHUTNEYJAGGERYGUJARATCARDAMOMRICKSHAWTURMERICSHERWANITAMARINDDIASPORABOLLYWOODHIMALAYASSOUTHASIANGULABJAMUNDARJEELINGMULTICULTURALSTREETFOODPARTYA non-melting cheese common in South Asian cuisine....

Antiquity to Renaissance Word Search 2026-05-04

25 Items: This means one voiceThis means many voicesEarliest fragment of musicGuido invented this in 1030This french word means rebirthHe was a Fraco-Flemish composerEarliest period of music historyThe earliest complete piece of musicAnother name for the Medieval PeriodThis is music for religious purposesThis is the medieval name for trombone...

Word Search 2017-05-08

14 Items: hugefearalonecheerteasesillymutterscaredvisionstrangecustomerteleportchallengestrenghth

Word search 2022-07-07

14 Items: samcanemillstopsignslightssafetywilmargivewaycrossingrawsugarcrushinglocomotivetrainbrain

Word search 2023-02-01

14 Items: upbugrugmughugsuncuppupmudbudjugkeitotakahirotatsuomi

word search 2023-03-05

14 Items: imeyoulandprayermyselfrevivalamericaworshippreachernewcastleholyghostreverencesubmission

Word Search 2023-04-17

14 Items: andicocolillyaydenmasoncoreyjaceesadierayneembersheenabayleeemerieashton

WORD SEARCH 2023-06-09

14 Items: pilotnurseactordoctorartistsingerpostmandentistteacherengineermechanicstreamerarchitectfirefighter

WORD SEARCH 2023-08-14

14 Items: equityimpactaccessdigitallearningeducationcommunityfasttrackinnovationtechnologyopportunitydevelopmentinterventionsustainability

Word search 2024-08-30

15 Items: AcatCuplionFIFAUEFALigazebraSoccerLeagueLeagueelephantFootballBundesligaMan's best friend

Word Search 2024-09-17

14 Items: LucyRingCakeSheepMarcusMashamWeddingDancingFlowersHoneymoonYorkshireCambridgeCelebrateDarlington

Word Search 2024-10-26

15 Items: PrayHoldMarkBoatWalkGloryJesusWaterPassesPeopleJoyfulPeopleGlimpseObserveReasons

Word Search 2024-10-30

14 Items: BooPinkDanceBeingBrutalMichaelMagentaFuchsiaDarlingMegastarSunshineAddictionElectronicPictionary

WORD SEARCH 2024-11-30

14 Items: LOVEWIFEVOWSCAKEBRIDEGROOMRINGSWEDDINGHUSBANDFOREVERMARRIAGEELOPEMENTWINTERSETIRISAISLE

Word search 2024-12-22

14 Items: SoapJohnMaryFlushMartinFamilyKellieMadisonDominicMichiganNotreDameBoardGamesPharmacistToiletpaper

word search 2024-12-24

14 Items: ModLovePeaceMusicDiscoFlowerNatureGroovyFreedomRainbowMushroomKindnessHappinessCoolbeans

Word Search 2025-01-14

14 Items: TarVapeMistLungsHealthArsenicTobaccoBenzeneAerosolNicotineAcroleinECigaretteCarbonMonoxideDiethyleneglycol

Word Search 2025-03-13

14 Items: HopeLentFaithJesusPrayerBishopPriestDeaconClergyJubileeCatholicCardinalAdorationSacraments

Word Search 2025-03-17

14 Items: isnohemegetsheyesarewasandyoucantisntunder

WORD SEARCH 2025-03-18

15 Items: CellsJasmonatePerceptionGeotropismAntibodiesNociceptorsBlood CellsPhototropismPhytoalexinsThigmotropismImmune SystemImmune SystemPhotoreceptorsMechanoreceptorsThigmomorphogenesis

Word Search 2025-03-31

14 Items: JourneyMysteryDiscovertreasureAdventureBrilliantChallengeFascinateKnowledgeLightningWhisperingElectricityImaginationSpectacular

Word Search 2025-05-26

14 Items: lacktenddailyfloatcauseprefershrinkweightroutinemaintainterrificextremelygraduallyenvironment

Word Search 2025-07-15

14 Items: treespacemathsqueenorangewindowfactordegreejupiterrainbowelephanttextbookchemistryelectricity

Word Search 2025-07-31

14 Items: savecrossJesusdeedswrongtrulytodayjustlyMessiahkingdominsultscriminalparadiseremember

Word Search 2025-08-28

14 Items: goalstressempathyhonestypatienceteamworkfeedbacklisteningcompetencediscretionenthusiasmleadershipcommunicationdependability

Word Search 2025-10-07

14 Items: boykeyegggirlbabyapplechairorangeoctopuselephantumbrellaengineerice-creampoliceofficer

Word search 2025-11-03

14 Items: AgebirdWantniceTalkTownNamePupilGradeLessonFamilySchoolEnglishteacher

Word Search 2025-11-17

14 Items: icewoodwoolgoldsaltsugarglasssteelrubbercottonplasticleatherconcretetoothpaste

Word Search 2025-11-18

14 Items: DuaImanSawnHajjHalalZakatQuranIslamSalahMasjidHadithMuslimShahadaRamadan

Word Search 2025-11-23

14 Items: LongBaldShortGlassesDarkHairWavyhairFrecklesBlueeyesBrownhairCurlyhairBrowneyesGreeneyesBlondehairStraighthair

word search 2025-12-12

14 Items: mapraftsandfishfoodoceanwaterbeachspearislandcoconutsurvivestrandedtreasure

Word Search 2025-12-24

14 Items: PigFlagKingLegoTrollQueenHotDogCastlePastryVikingHerringFairyTaleHollyhockLittleMermaid

Word Search 2026-01-18

14 Items: AliRingLoveBrideGroomShadiTexasDanceMendhiSaguftaDentistFloridaMarriagePhysician

Word Search 2026-02-04

14 Items: AnnaAnujRyanLanceYogeshMatheoAnazkaAvelinNashlynKidtadaAsianthySuraphatChristopherKityavorleak

Word Search 2026-02-05

14 Items: sheamiffycraftstequilamrdarcyfriendsmamdanibirthdaybadbunnyearmuffshellokittypicklebacksailormoonpedropascal

Word Search 2026-02-14

14 Items: My favorite Boba shopPlace of my first jobThing i always call youThe name of Gigi's loverCity i would like to live inThe first thing i cooked for youFossils Name of my favorite bandThe restaurant of our second dateThe first thing you cooked for mePlace where we took our first pictureThe city where I first said i love you...

Word Search 2026-02-24

14 Items: bluegownsdssdeltamascotyellowdiplomaseniorsyearbookclassroomhighschoolgraduationtsawwassenvaledictorian

WORD SEARCH 2026-03-08

14 Items: meanarguefaithdirectdemandpreparepreventpreviewrequestuncertainunfriendlyconcentratecomplicateduncomfortable

Word ID 2026-04-02

15 Items: myskypielieflybitelikebikelikelightsightslidemightnightbright

WORD SEARCH 2026-04-13

15 Items: FigPearPlumDateFruitFruitAppleLycheeApricotAvocadoBlueberryRaspberryMuskmelonJackfruitBlackberry

BIOL 12 module 2 word search 2024-10-29

20 Items: activated subunit of PKAgatekeeper of the nucleuscommon effector of subunit aforms and rearranges disulfide bondsran GDP to ran GTP in the nucleoplasmstring of positively charged amino acidsmolecular chaperone that recognizes carbsanother word for the calvin cycle in plantsthe arrangement that clathrin assembles into...

grade 5 revision 2025-05-11

21 Items: Way What galaxy do we live in?What falls during an ice storm?What is the closest star to Earth?What is the North Star also called?What force pulls tectonic plates apart?What phase comes after a crescent moon?What type of front brings stormy weather?What is the outermost layer of Earth called?What is plant and animal matter in soil called?...

Nadine & Shaun 2026-04-06

28 Items: Who is the better cook?Who is the "messy" one?The formal "I do" event?The name of the Best Man?word they use most often?What the Bride walks down?The location of the proposal?The month of their first date?The name of the Maid of Honour?The colour theme of the wedding?What they like to drink together?The stone on the engagement ring?...

Word Search for Lovers 2025-11-04

16 Items: ughhh deanna and her?who made our favorite puzzles?what can you find in new jersey?we love rudy- even though hes ____who are ur two biggest opps? (romantic rivals)what did they include in the new hallmark movie?how did my grandma describe you when she met you?we sing this song when things are absolutely fucked...

Soul Surfer Word Search 2023-04-11

20 Items: Someone who guides and advises.jewelry that Bethany likes to wear.What Bethany suffered after the attack.Bethany's youth group leader and friend.the name of Bethany's best friend.something that is ongoing and never stops.Treating others with dignity and admiration.Bethany's favorite activity that she excels at....

GPT 2023-12-14

20 Items: Lacking energy; sluggishIn excellent order; satisfactoryWicked, criminal, or evil in natureIn its original condition; unspoiledPleasingly smooth and musical to hearA harsh, discordant mixture of soundsPresent, appearing, or found everywhereLasting for a very short time; transientExtremely happy, peaceful, or picturesque...

Us 2024-04-05

26 Items: Our youngestOur firstbornOur middle childAge of the brideBest man at weddingMonth we got marriedType of party we met atMaid of honor at weddingSong Teresa sang at weddingWe both prefer these to dogsWe lived there for six monthsShampoo Byron used when we metWe've been married this many yearsBuffet in Eugene that we frequented...

Physical and Chemical Properties 2025-02-20

22 Items: rustingnot shinyeasily brokenAnother word for smellto make or become liquidthe process of burning somethingcapable of breaking down naturallyThe amount of water vapor in the airMatter with a definite shape and volume.Material that allows heat to pass throughTemperature which a liquid changes into solidtemperature at which a solid becomes a liquid...

Abrahamic Religions Word Search 2025-06-11

28 Items: Islamic ProphetHoly book in IslamWhere Muslims prayChristian holy textName of God in IslamHoly text in JudaismOldest Abrahamic ReligionSomeone who follows IslamSomeone who follows JudaismLeader of the Catholic ChurchOne of the two sects of IslamOne of the two sects of IslamPlace where Jewish people prayIn Christianity, the Son of God...

WORD SORT 2015-11-26

14 Items: sprayscramstrapscrapscreenstrongspringsprainstrictstressscreamsproutstringstrange

Word Search 2016-05-02

15 Items: VICESENATECABINETCONGRESSJUDICIALBRANCHESPRESIDENTAMENDMENTBICAMERALPRESIDENTEXECUTIVEUNICAMERALGOVERNMENTLEGISLATIVECONSTITUTION

Word Search 2016-05-02

15 Items: VICESENATECABINETCONGRESSJUDICIALBRANCHESPRESIDENTAMENDMENTBICAMERALPRESIDENTEXECUTIVEUNICAMERALGOVERNMENTLEGISLATIVECONSTITUTION

Word Box 2020-09-19

14 Items: incurehavehuntmagicamazedcommonproduceprotectsucceedprogressknowledgegenerationrelationship

FINDS WORD  2021-01-29

14 Items: BERTYBOTTSCHEESBEBEKKEPALALORKANDITTANYTANGKERDUCKBEKGILLYWEDSLOTROOMMANDRAKEALIGATORBUBOTUBER

Word Search 2023-01-25

14 Items: wifispamcybercloudaccesbackupserveraccountwebsitenetworkcomputerpasswordsecurityphishing

word Search 2023-06-22

14 Items: twoaskeggheadnestknownewsbirdgonechickthreeafraidmakinghatching

WORD SEARCH 2023-10-12

14 Items: staystoptimemakeplaygamemorelesspraylovelivegivewishstar

word search 2023-12-13

14 Items: funlovehopecaretimehometruehappylaughfaithheartsisterfamilyspirit

Word Study 2014-12-11

14 Items: AuditAudiblePredictVerdictDictionAudienceAuditoryAuditionAudiotapeAuditoriumContradictDictionaryAudiovisualUnpredictable

word search 2024-06-14

15 Items: orcabalugapacificsombriodolphinsaturnasombriocarmanahhumpbackgallianomouchabaysalishseabotanicalsaltspringnootkasound

Word Hunt 2024-07-03

14 Items: lovetoastfaithbloomfamilyforevermarriageceremonystairwayreceptionhoneymoonbridesmaidcelebrationsurrendership

word search 2024-09-26

15 Items: tocatdogranbenyouranmomdadmenuplaylanehippoplanehight

Word Search 2024-10-03

14 Items: earmaybayboatsoapfeetseatmeatstaykitelightnightrightbright

Word search 2024-12-22

14 Items: SoapJohnMaryFlushMartinFamilyKellieMadisonDominicMichiganNotreDameBoardGamesPharmacistToiletpaper

word search! 2025-02-07

15 Items: catdogratlionfishlionzebrahippomousehorsetigerrabbithamsterdolphinelephant

Word Parts 2025-02-11

14 Items: recoverbrighterquickestunafraidpowerfulprewritemisbehavecompletesextremelyrefreshesdisrespectexplaininguntouchabledisagreement

WORD SEARCH 2025-03-15

14 Items: BODYBREADWATERBLOODJESUSPRAYERSPIRITPROMISEPARTAKEREMEMBERCOVENANTORDINACEREVERENTSACRAMENT

Word Search 2025-06-17

14 Items: BOASCystotomyEnterotomyGastropexyTyphlectomyRhinoplastyUrethrostomyExenterationTonsillectomyAdrenalectomyMandibulectomyCholecystectomySialoadenectomyPericardiectomy

Word Sarch 2025-07-07

14 Items: kidsninerulesdinnerfamilyfuturealcoholbondinghealthyparentspreventboundariesmonitoringdisapproval

word search 2025-08-21

14 Items: transfertransientextraneoustransplanttransitionextravaganttranslucentextravaganzaextramundaneextraordinarytranscriptiontransformationextracurricularextraterrestrial

Word Search 2025-08-28

14 Items: goalstressempathyhonestypatienceteamworkfeedbacklisteningcompetencediscretionenthusiasmleadershipcommunicationdependability

WORD SEARCH 2025-09-21

14 Items: bikesloyalbacongeniusfiancethirtymurghaprodigyradianthandsomeromanticgenerousmasochisticcutiepatootie

Word Search 2025-09-22

14 Items: actwagecivilpolicyshermanprotestbusinessrooseveltgovernmentindustrialrevolutioninnovationimmigrationprogressivism

word search 2025-10-17

14 Items: Dewduelosejuicyprovecanoechoosegrooveendureusuallyenthuseconcludecommunittydistribution

WORD SEARCH 2025-10-20

14 Items: dewduelosejuicyamusebruisehumourgroovesecureapprovegenuineusuallycommunitydistribution

Word Search 2025-11-23

14 Items: mayjunejulyMarchaprilmonthaugustJanuaryoctoberFebruarynovemberdecembercalendarseptember

Word List 2025-11-26

15 Items: not far away: _________not in a good condition: _________to become twisted together: _________a meal eaten in the evening: _________a very small jumping insect: _________to pull something forcefully: _________a facial expression showing anger: _________to make small folds or lines appear: _________to move something from side to side: _________...

word search 2025-12-08

14 Items: RINGLOVECAKEDRESSBRIDEGROOMCHEERSWEDDINGBESTMANCEREMONYHONEYMOONFLOWERGIRLCELEBRATIONMAIDOFHONOR

Word Search 2026-01-02

14 Items: UysSteynHingeBrideGroomBritsPotatoHikersWeddingKunkuruEngineerHoneymoonDurbanvilleSweetpotato

Word Search 2026-01-19

14 Items: lioncarezebrapridefrankwoodshealthdignityrespecthewisonelephantwellbeingexcellencecompassion