minnesota towns word Word Searches

State and their Capitals 2025-04-20

100 Items: IowaOhioUtahIdahoMaineTexasDoverBoiseSalemAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonStPaulHelenaAlbanyPierreAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraska...

General Technology 2025-08-20

70 Items: HPPDFMP4MP3WMAUSBURLPNGByteJPEGAcerAsusDellGridSaveTextWordFormFilesTowerChartTableMouseEmbedBuildWiresLaptopIPhoneManualOnlineFolderBackupDrivesLenovoSearchExportSystemAndroidStorageEditingDesktopMonitorGatewayBestBuyWalmartProfileImagingWebsiteComputerKeyboardHardwareSoftwareThinkpadFunctionInterfaceHypertextDeveloperMicrosoftAlgorithmGeekSquad...

Music 2025-11-04

51 Items: MassLuteViolNeumeMotetTenorModesShawmRebecLeoninTactusOrganumPerotinChansonMotetusCantataConsortSackbutMadrigalArs-NovaTrouvèreRecorderCrumhornPsalteryEstampieMonophonyPolyphonyImitationOrganettoPlainchantTroubadourMinnesingerWilliam-ByrdJohn-DowlandSacred-musicCounterpointCantus-FirmusGiovanni-PierThomas-TallisSecular-musicModal-harmony...

Annie's Surprise 60th Birthday Party! 2025-01-25

18 Items: Annie's maiden name.One of Annie's first jobs.Annie's favorite music genre.One of Annie's favorite candy.Country in Europe Ann has visited.Vehicle Nate is building for Annie.One of Annie's favorite things to do.Current dog's name (shared with Nate).Annie's summer occupation in childhood.One of Annie's favorite childhood candies....

States and Capitals 2023-05-16

100 Items: iowaohioutahidahomainetexasdoverboisesalemalaskahawaiikansasnevadaoregonjuneaudenvertopekabostonhelenaalbanypierreaustinalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingphoenixatlantaaugustalansingjacksonlincolnconcordtrentonsantaferaliegholympiamadisonarkansascoloradodelawareillinoiskentuckymarylandmichiganmissourinebraskaoklahoma...

US States and Capitals 2024-11-06

100 Items: iowaohioutahidahomainetexasdoverboisesalemalaskahawaiikansasnevadaoregonjuneaudenvertopekabostonhelenaalbanypierreaustinalabamaarizonageorgiafloridaindianamontananewyorkvermontwyomingphoenixatlantaaugustalansingjacksonlincolnconcordtrentonsantaferaleigholympiamadisonarkansasdelawareillinoisKentuckymarylandmichiganmissourinebraskaoklahomavirginia...

Hector Word Search 2024-11-20

103 Items: IowaOhioUtahKarenIdahoMaineTexasDoverBoiseSalemHectorArlethAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonHelenaAlbanyAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraska...

road trips 2025-04-21

101 Items: cargasiowaohioutahtriprainfuelidahomainetexasstateroadshillsparkshoteltollsmusicradiosunnystormwindytreesalaskahawaiikansasnevadaoregandesertforestplainsplatestravelmilagesnackshikingbreaksalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingmidwesttornadocanyonsbordersdrivinglicensecampingpackingluggageweathertraffichighwayarkansas...

States and Capitals Word Search 2025-12-12

100 Items: IowaOhioUtahIdahoMaineTexasBoiseDoverSalemAlaskaHawaiiKansasNevadaOregonHelenaJuneauAustinTopekaDenverBostonAlbanyPierreAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingAtlantaTrentonLansingMadisonConcordAugustaPhoenixLincolnJacksonRaleighSantaFeOlympiaArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahoma...

States and Capitals 2026-03-12

100 Items: IowaOhioUtahPaulCityCityIdahoMaineTexasDoverBoiseSalemAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonHelenaAlbanyPierreAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouri...

Pre- Word Search 2025-11-11

20 Items: to map out in advanceto purchase in advanceto reserve ahead of timewhat leads up to an eventto heat before it's neededto get ready ahead of timeto come before something elseto occur prior to the main eventeducation before formal schoolingto occur before the expected timeto warn of danger before it happensdone so something else doesn't occur...

Cultural variations in attachment 2026-02-25

8 Items: Type C attachmentA word used by Bowlby to describe attachment in infantsThe attachment type most commonly found across culturesThe norms and values which exist within a group of peopleThe word to describe the type of culture found in the UK and USAA country which is said to have a similar child-rearing style to Korea...

Grade Three Sight Words 2024-08-29

71 Items: usuporsawshewhywhooneusetwoanyaddsometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintoworkdoesonlyverymovepullevenfindtherethingwouldwheretheirwhichthesefirstwatergreatlargeagainstudylearnworldschoolnumberpeopletowardpleasefatherfollowanswerbrotherhundredbecausethroughquestionsentencebeautiful

Word3 2025-08-23

70 Items: EndMoreWantManyCareNeedLikeStarClubWordMostYearStaySameSickWithOpenGameWarsFourLifePlanBankSpaceSorryEverySillyThinkWomenSpeakLevelEnjoyCoverCrazyBlindFocusMusicPleaseAnyoneUpdateThanksSearchBottomMinuteAlwaysFutureLovelyCalledHeroesDefeatRobloxRapperPopularWelcomeBelieveYoutubePreviewPrivacyForwardStoriesEnemiesBattlesNoodlesFacecamDifferent...

Amazing I 2026-04-14

8 Items: A lizardTiny animalsBoots with bladesA favorite dessertA house made of snowThe opposite of outsideAnother word for pictureA land in the middle of the sea

Word Search - Symbols of Love 2026-02-02

15 Items: A feeling of happiness and delight.To value something or someone highly.A sense of togetherness among individuals.A decorative strip often tied around gifts.To mark an occasion with joy or activities.A gentle act that makes someone’s day better.A flower commonly given during valentines day.A cheerful sound made when something is funny....

Primary Word Search 2026-03-31

13 Items: built up towns and citiesvillages with not many servicesfeatures can be hills, mountains, lakesthis sector provides knowledge and skillsthe way people are spread out over an areathe movement of people from one are to anothera group of islands between north and south americathis sector turns raw materials into finished goods...

Maria & Jack 2025-05-29

20 Items: Jack's sisterJack's pet dogJack's birthstoneMaria's birth monthTheir college mascotMaria's only siblingCollege where they metState Jack was born inMaria's pet cat in DubaiTheir honeymoon destinationTown they currently live inCountry where Maria grew upMaria was born in this countrySport Jack played in high school...

Gato Word Search 2023-03-02

19 Items: a very common house petword to describe someone strongA place where people go to learna big gray animal with huge earswhat people are born with to seeOne of the most common house petswhat we use to type on a computerword used to describe someone weaksomething students use to write ina common instrument with 6 strings...

LOE 22C 2026-04-22

18 Items: Send me an ____ message.Her whisper was barely ____.Latin root word meaning footLatin root word meaning timeClover is ____ about potatoes!The bike had bright purple _____.Latin root word meaning sound or hearWhat ___ are potatoes: roots or stems?____ is essential to being a good student!Cora and Clover sometimes act odd or _____....

Vocab. 2-3 2025-11-20

6 Items: break downto lessen in intensitythe producer of an effectto caution against somethinga person who initiates a contactrepeating the same word or phrase

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

graph=write 2025-10-30

10 Items: the writing of one's own namea book written about a person's lifemapmaking/ the writing of a map or chartrecord player, turns writing on records into soundthe use of light to record an image using a camerawriting about a person's life written by that persona device that writes down the movements of the earth...

name of towns (easy mode for Chinese kid under 5 years old) 2025-09-03

10 Items: Bog areaFarm nameTown nameHill namewild troutRailway stationSuburb in SydneyLakeInMassachusetteVillage in the NetherlandsA small island in Tierra del Fuego

Las Posadas 2023-11-28

13 Items: They ______ holiday songs.The word posadas means ________.The word ______ means inn or lodging.These ________ can be held in churches.The _________ is usually shaped as a star.They sing holiday songs and carry a ________ scene.This tradition begins on the 16th of _____________.A child is sometimes chosen to be dressed as an ________....

In English we explore, 2026-02-04

9 Items: Life storiesFilm studiesStudy of languageStudy of word originsStudy of ancient storiesStudy of ancient culturesEvents and facts from the pastNature, places, people et cetera Etc.Study of ancient Greek and Roman cultures

NFL Team 2025-12-13

32 Items: Chicago BearsBuffalo BillsNew York JetsDetroit LionsDallas CowboysMiami DolphinsDenver BroncosHouston TexansAtlanta FalconsNew York GiantsBaltimore RavensTennessee TitansCleveland BrownsLos Angeles RamsSeattle SeahawksLas Vegas RaidersGreen Bay PackersMinnesota VikingsCarolina PanthersArizona CardinalsIndianapolis ColtsKansas City Chiefs...

Group Literacy Word Search 2025-08-14

31 Items: CiteInferThemeGenrePrefixSuffixAnalyzeComparePredictExplainClarifySupportContextLiteralSynonymAntonymContrastEvaluateDescribeIdentifyEvidenceSummarizeInterpretDetermineMain ideaRoot wordNarrativeConclusionFigurativePerspectivea list of 30 common **6th grade literacy vocabulary words**:

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Year 3 Term 2 Wk 2 Homework 2024-05-05

24 Items: DramaAn accidenta situation4 letter wordjoyful emotionsomething organisedPrecious to someone1st Month of the yearto won of give somethingorganising something nowOut in the bush on holidaysa crunchy red or green fruitEarth, Mars, Jupiter are theseTo get from one place to anotherA place where you go to get moneyNot perfect or excellent just.......

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Greenisland Word Search 2025-09-17

10 Items: Who said “I love you” first?He proposed during this monthTheir favorite breakfast drinkYear they started dating: 20___Where was their first trip together?Where was Lauren & Trevor’s first date?What is their favorite day of the week?Their favorite season to spend togetherWhat is the name of their wedding venue?...

miyas birthday word search only open if u a creep 2026-02-11

8 Items: addict.There’s __ to tsEcuadorian DelicacyBig word, first letter OShorthand for Nonchalant“We‘re gonna ___ these hoes”You and Col’s favorite sign offWorst flavor on earth but it’s one of your favs

Heat Transfer Vocabulary Wordsearch 2025-01-29

7 Items: Another word for HeatThe Definition of EnergyHow Temperature is measuredHow Radiations transfer heatHow Convections transfer heatHow Conductions transfer heatThe Type of energy that Thermal Energy is

Sentences, Subject, Predicate 2023-08-25

16 Items: a commanda questiona statementexpresses a strong feelingwhat the sentence is abouthas one subject and one predicateall the words in a subject of a sentencetells what the subject does, has, or is likeall the words in the predicate of a sentencea group of words that expresses a complete thoughtwhen two or more subjects share the same predicate...

Amazing E 2026-03-01

11 Items: A school supplyWe see with theseWe hear with theseChickens lay theseA purple vegetableThe number after 10Another word for liftAlbanian animal symbolAn electric sea animalAn animal with big earsThe planet where we live

the hatchet and people i know 2016-12-09

72 Items: MrMrfunbowbowDogoldBalDanJoeRobMrsbookmovefishtipswildwolfCarlSongWoodsongwordkithMattGregAlexLisakiwiGaryBillAdamMotaSovahatchbearsBrianstoryhonerAntonLauraAllanNancyshayaarrowsskunksauthorsearchRobertHarveyAngelaJustinshelteranimalsturtlesnewberydancingtrackerRobesonFrancesGrandmasurvivalsentriesserenitysurvivingGreg-dubewildernessthree-time...

Monday Word Search 2023-09-11

72 Items: tvdogcatoneredfunyoushearecankingpassexamknowopenbookreadnounverbwordhavemustmarkthirdqueenlearnenjoythinkspeakpupilmathsmondaysundayaugustfriendfamilytwentylondonlessontravellistenadverbsuccesshundredbritainenglandirelandexploreanalyzepresentenglishpronounstudentteacherscotlandresearchcopybookworkbooktextbookmemorizealphabetwednesdayseptember...

slay 2025-10-24

59 Items: tearaeyupcartridewordmoonfishdirttreesimslionstorefartypartyfrogstoadsdancejoe'slibragoulsturtleribboncactusflowerspiderlettershartygallopdreamswarmthnovelsmozartsearchdangerspookyclownsghostsblockstalkingsnoringanimalsreadingnuggetschargeraxolotlgoblinsshoppingscorpionmcflurrymountainaquariusshortcakewinehousepepperoniplatformsliterature...

Floccinaucinihilipilification Word Search 2023-10-20

75 Items: okejoybitthesitpopmopboxfoxcatsczarzetapinkweekdayshardtreewordplantwinartslavagamethemwhatwilljumpwereablemoredoorrainquestwindywatercartsmusicglasstrainemoteciderfirststartslyncheshandiertheatersmonumentcesspoolscatalogedturnaroundwristwatchmanservantmemorandumsunutterableunnaturallymenstruatednanosecondsplayfulnesstimelessnessunattainable...

No Title 2025-05-06

75 Items: SumOddOneTenTenAddBarPartSkipEvenZeroUnitLessBaseHalfDataWordFormSensePlaceValueDigitWholeRoundOrderCountEqualAfterGroupTallyChartRatioGraphTotalNumberSymbolBeforeAddendDoubleComparePatternHundredNumeralGreaterBetweenNearestComposeFactorsProductDecimalPercentBalanceIntegerEstimateSequenceThousandEquationSubtractAdditionQuotientFractionRounding...

Cell Word Search 2026-01-03

4 Items: the basic unit of lifeanother word for digestLysosomes are _____ the cellLysosome have ______ for food and water

Farm 2023-05-08

32 Items: cowpigdoghayfarmBankduckmuleeggssoilgoatseedshorsecropssheepgoosefarmerplantsdonkeytractorchickensC S I T R E M R A F W M Q LH T C O W U C D Q B U I T VI S D E E S C R F I K Q T GC P F L J H E D O N K E Y OK O P E E H S L S P G M D OE S R O H F P X U G S O G SN P R P L A N T S M G P A ES V T P D Q V O D P I E Z TA R O T C A R T O P I G O S...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

And Word Search 2025-05-19

74 Items: ifonofandoffmadsadfathatyouearonetwosiztenlikeyourhatelovesingquizwordfoodnoseearsopenshutnicemeannounverbfourfiveninekitesandtrackangryhatedlovedlikedwordstrickmouthcloseknifenightnounsverbsthreeseveneightfightmightsandygramsfriendpluralpuzzlesearchtrickyclosedmurderknightgrainsouncesfriendssinginggumballhundredmultiplesingularthousandadjective

Ha’azinu 2024-09-29

18 Items: “Lawlessness”aka, Rosh HaShanahSimon Son of Jonah“Shuvah” means to _______The 8th letter of the alef-beit.This Hebrew word means “to speak”Repentance results in __________.Son of Barachel the Buzite (Job 32)“Heaven an earth” in the Song of Moses.HaShem’s revealed teaching for mankind.The letter peh has a pictograph of a ______....

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

Occupational Word Search 2025-03-23

20 Items: What is Ellee afraid of?What is Ellee's school mascot?What is Noah's sibling's name?What is Noah's favorite candy?What is Ellee's sibling's name?What is Noah's favorite soccer team?What is Ellee's favorite music group?What was the name of Ellee's hedgehog?What is Noah's favorite ride at Disney?What is Ellee's favorite ride at Disney?...

Literary Devices Crossword Grades 11-12 MA ELA Standards 2025-12-22

30 Items: an author’s word choicea word that imitates a sounda comparison using like or asthe emotional atmosphere of a textdeliberate exaggeration for effectlanguage that appeals to the sensesspecial importance given to an ideaa recurring idea, symbol, or subjectthe sequence of events in a narrativegiving human traits to nonhuman things...

US States by Capital 2025-10-07

50 Items: BoiseDoverSalemAlbanyAustinBostonDenverHelenaJuneauPierreTopekaAtlantaAugustaConcordJacksonLansingLincolnMadisonOlympiaPhoenixRaleighTrentonBismarckCheyenneColumbiaColumbusHartfordHonoluluRichmondSanta FeAnnapolisFrankfortNashvilleCharlestonDes MoinesHarrisburgMontgomeryMontpelierProvidenceSacramentoSaint PaulBaton RougeCarson CityLittle Rock...

Amazing G 2026-03-22

12 Items: A colorMy mom's dadMy dad's momA farm animalAn instrumentA purple fruitA jumping insectAnother word for presentYou use it to drink waterAn animal with a long neckA bigger version of monkeyA place where you exercise

I N F O R M A T I K A 2025-08-29

75 Items: LanManWanRj45HdmiCCTVAsusAcerOppoVivoMeshStarRingBiruWifiWordTreeModemMouseKabelTeslaAppleStackQueueHijauHelioLinuxCyberExcelCiscoSwitchServerTesterLenovoIphoneXiaomiCameraHybridCoklatOrangeLaptopMemoryUbuntuRouterCodingNetworkMonitorSamsungPrinterAdaptorSortingWindowsInfinixChipsetHotspotJaringanKomputerKeyboardInternetCrimpingMacintosTopologi...

The Black Death 2026-03-20

20 Items: death ratetime periodmain outcomepainful lumpseasily spreaddeadly diseasetype of plaguecommon symptomskin darkeningdisease carriersisolation methodsigns of illnessspreading illnessspread the bacteriawidespread outbreakcause of the plaguetried to help peopleburial site for manyanother word for plagueheavily affected continent

Grammar Review & Roots 2026-02-06

12 Items: ACTION WORDDESCRIPTIONTHE STUDY OF LIFEFOUNDATION OF WORDSMEANING OF ROOT "BIO-"PERSON, PLACE, OR THINGSTORY OF SOMEONE'S LIFEBEES POLLINATE ___________FISH THAT FOLLOWS SHARKS AND RAYSCLOWNFISH LIVE IN AN ____________PLACE WHERE MANY DIFFERENT SPECIES LIVERELATIONSHIP WHERE 2 CREATURES LIVE TOGETHER

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

__? 2026-04-09

4 Items: what fills booksyou and __ on the rockan imaginary number, pluralthe number of years we’ve been together

April Word Search 2026-04-29

13 Items: What does GTM stand for?Name of our smallest watchAprils townhall safety topicWho won last month's word search?The largest trade-only event for divingWhat is the third word? Powerful, Simple,...Full FIRST name of our Sun Run team 1st place winnerName of our product that is used to monitor air levels...

Rote Words 2025-12-16

15 Items: A person, place, or thingThe sequence of the storyA word that means the sameAn action or state of beingA comparison of unlike ideasA word that means the oppositeThe time and place of the storyA person in a book, play, or movieA comparison of unlike ideas using like or asThe universal meaning of the story, a life lesson...

Chukat ~ “Statute” 2024-07-07

17 Items: Moses’ sisterAbraham’s nephewHe dies at Mount HorHebrew word for “statute”Hebrew word for a good work.Hebrew for “instruction” or “teaching”“outside the camp” during Temple times.Messiah Yeshua is the _____ of the Torah.The last enemy to be destroyed. 1Cor15:26The person who took Yeshua’s body away for burial....

Gravity Falls 2024-03-06

8 Items: Who worships Stan?Who is Mabel’s pet?Who is a mind demon?Whose real name is Mason?What does Wendy represent?Who loves to wear sweaters?What is a popular soda brand?What word does Soos mispronounce?

Streets of Rye 2026-04-22

7 Items: Paradise lostA precious streetLots of trees grow hereA kid's dream destinationThe seat of local commerceHow they might say pretty in OklahomaNative American word for "the covering tree"

Greek roots week 3 2025-09-09

10 Items: not academicextremely activetaking no actionsextremely sensitivesame types of graphssame word different meaningcoming together and talkingover active and doing to muchopinions or doctrines with the official positiongrouping made up of many differing or unlike parts

States and Capitals Word Search 2025-05-22

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaVermontWyomingColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaNew YorkOklahomaVirginiaLouisianaMinnesotaTennesseeWisconsinCaliforniaNew JerseyNew MexicoWashingtonConnecticutMississippiNorth DakotaPennslyvaniaRhode IslandSouth Dakota...

Week 8 2026-04-17

15 Items: SkyeYoyoDeeanHaydenMargaretNot the sameA small mountainWhat's the matter?A part of your bodyAnother word for floorSomething that you needFruits can give you a lotCan protect you from the SunYou should do this before a quizYou should do this before you play sports

3 year anniversary 2026-03-05

13 Items: my nameyour namecrazy dashawnmy favorite foodcity where we metwhat is march 5th?where we first metyour favorite foodyour number 1 drinka word you always saymovie on our first dateyour favorite basketball teamcalm elagant cat, grey and white

Caps 2024-12-29

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaKansasNevadaOregonAlabamaArizonaFloridaGeorgiaHawai'iIndianaMontanaVermontWyomingArkansasColoradoDelawareIlliniosKentuckyMichiganMissouriNebraskaNew YorkOklahomaVirginiaLouisianaBaltimoreMinnesotaTennesseeWisconsinCaliforniaNew JerseyNew MexicoWashingtonConnecticutMississippiNorth DakotaPennsylvaniaRhode Island...

NFL Teams 2025-12-16

32 Items: Chicago BearsBuffalo BillsNew York JetsDetroit LionsDallas CowboysMiami DolphinsDenver BroncosHouston TexansAtlanta FalconsNew York GiantsBaltimore RavensTennessee TitansCleveland BrownsLos Angeles RamsSeattle SeahawksLas Vegas RaidersGreen Bay PackersMinnesota VikingsCarolina PanthersArizona CardinalsIndianapolis ColtsKansas City Chiefs...

Dover Word Search 2025-10-06

50 Items: OhioIowaUtahMaineTexasIdahoOregonKansasNevadaAlaskaHawaiiGeorgiaVermontIndianaAlabamaFloridaMontanaWyomingArizonaDelawareMarylandVirginiaNew YorkKentuckyIllinoisMissouriArkansasMichiganNebraskaColoradoOklahomaTennesseeLouisianaWisconsinMinnesotaNew JerseyCaliforniaWashingtonNew MexicoConnecticutMississippiPennsylvaniaRhode IslandNorth Dakota...

Blessedtrinity Word Search 2024-12-17

17 Items: The freedom and ability to choosean agreement with God and his people(hint: What does the word Gospel mean?)- Good News(hint: What does the word Genesis mean?)- beginningA thought, word, deed, or omission against God's lawan area in the Middle East that Include's present-day IsraelRevelation - God making himself known to us through creation...

Where Am I? 2025-11-24

7 Items: Sounds like a bubble pop — twice.Shares its name with what you do to cards.Begins with a strong K and a punchy “-ump".Contains a word you use to keep a door shut.Starts with a big, wide W, has double A’s, and hints at arms swinging again and again.The word starts with “Break,” but no objects are damaged it’s about crashing into moves....

2026-04-19: Two Kings, Two Feasts 2026-04-19

16 Items: Today's preacher___ Worldly RuleThe Herod in this chapterOne word of how we should serveThe RHC family who moved to JapanOne word of how we shouldn't serveThe first thing we can do when respondingJesus's preaching in the preceding chapter 13Serve where He calls us, not according to ___Herod gave the head of John the Baptist on a ___...

Root Word #11 Practice 2025-03-25

10 Items: breakgood, wellmake, donebear, bring, carryflee, runaway, escapeto move to another placea part of a larger wholea protected place to flee toa place where things are madereplacing an offensive word with an offensive one

Word Search Fun 2025-08-14

10 Items: The number 14The number 19Belonging to usPast tense of “say”The opposite of badPast tense of “come”Shows necessity; have toAt this moment; immediatelyAsks about a place or locationA polite word used when asking for something

Random 2022-11-21

76 Items: popsayfarsadcitywordhomelovehugspostopenwiferockfoodlefthalfhopearmyburnlifereadminehelpcoldprintsmilewitchnoonecloseproudfisrtpizzarightmummycrashdiarysharespicysweetloversrhythmrandomlistentiktokanyonereasonhomiesdrinksbottomcursedsearchfriendsmedicalhauntedhusbandcountryepisodewhisperdiamondtitanicjournalwebsitetwitterraggedyanythingbookworm...

Medicine 2024-07-03

6 Items: You put it on your woundsA tube used by a doctor or nurseYou take them to grow well and be healthyYou spread it on your skin, esp arms and legsPeople who can't walk sit on it and move through it...

Happy Birthday Netta 2024-10-12

10 Items: The Blue & The White?Netta’s favorite emoji?Some good shopping in Minnesota?I grow on a vine & I clutch my___.They know her by name? Bling! Bling!Netta’s favorite color? (Chewing Pink)She has been playing in this since childhood?Netta’s favorite restaurant? (Known for steaks)Netta’s Favorite place to visit? (The capital of England)...

CRM 3.2 2025-01-17

19 Items: poetic paragraphsthe universal messagetwo lines of verse that rhymeA set of 2 lines, usually rhymingrhymes found at the end of a versewords or phrases that are repeated.Last name of the poet behind Romanticismrhymes found within a single line of versethe repetition of beginning consonant soundsWordsworth focused on this instead of "reason"...

About Word Search 2025-03-25

76 Items: asbydogoifitmemynooforsotoupusallanydidhasherhimhisitsoneseetrytwousewhowhywonalsobeencallcomedoesdonedowneachfindgoodintoknowmademanymoremostonlyoverpartsaidsomethemtimeverywerewhatwhenwordworkyouraboutcouldfirstotherrightsmalltheirtherethesewaterwherewhichnumberpeopleshould

Wheelock's Chapter 5 Vocabulary 2025-11-13

25 Items: skywordwhenyouthglorycourageour (f)if everto dineto stayfree (m)tomorrowto blamethereforeyesterdaybecause ofto overcomemind, spiritfault, blamebeautiful (neut)sound, healthy (m)then, at that timeenough, sufficient(ly)you, yourself (acc/abl)[enclitic particle that denotes a question]

Word Search Competition 2025-11-25

79 Items: HotGasRedFunSunHeatColdJustMeltBlueCoreMarsMoonWordZoomReactScaleSolidStillFlameGreenCrustOceanEarthVenusPlutoExpandEnergyStatesLiquidUsefulYellowSaharaArcticRobloxMantleIndianSaturnUranusSearchCelsiusConductMeltingBoilingDisplayMixtureExplodePacificNeptuneJupiterMercuryExploreBecauseInsulateFreezingDiscoverZimbabweAsteroidThailandAtlanticRadiation...

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

the slanders word search 2025-04-11

11 Items: favorite hobbyyour birthstonethe puppers nameyour zodiac signwhere you grew upyour most used wordyour most worn colorone of ur fav sayingsyour favorite child’s namethe stare we get when ur angyshrinkos fav thing to say 2 ace

Math 2025-10-09

14 Items: the backpropertylike termthe oppositeno equal signgiven or receiveadding a variablegetting the answercompares two equationbasic algebraic equationa value that won't changesomething to fill a questiona word with multiple meaning'ssomething with more that 3 or more equation

Family 2023-05-06

10 Items: the shy girlthe quirky kidthe energetic onehas big curly hairthe boss of the kidsthe boss of the housegets attacked by Brodythe strong and funny onewants to be the rich kidgoes outside and explore the word

Unit 1 2026-03-01

9 Items: An adult personMy dad's parentsMy mom's brotherEinstein's traitMen's facial hairAnother word for beautifulA person that everyone knowsWhen you don't know what to doyou get this feeling when you need to drink something

random words 2026-04-24

80 Items: medogcatlegeyetenonetwoforsixpenfryflydieicegympopthejoysadmaddaylipssinghairdrawninefourfivemathfeardeadshowdicewordparkcorntheybellyellkilnbandbandgladknowzebraphonetitlelungsmouthbraidheartcolorskirtshirtthreeseveneightshorttiredfiredcreamprintwaterundershellhappyupsetearthlightknowndreadsshortsfidgetpencilsearchinsidepopcornelephantthankful

Marie Curie 2025-12-05

9 Items: A type of prizeHer middle nameShe was born hereFirst field of studySecond field of studyFirst element she createdSecond element she createdEmissions from certain elementsA type of machine made during World Word One

Polydactyly 2025-05-14

6 Items: A felineEden's Polydactyly catAnother word for fingers or toesA man who loved Polydactyly catsA syndrom causing extra toes/digitsWhat Polydactyly syndrom causes extra of in cats

Everything! 2013-11-20

113 Items: catdograteatredpenbedboxmanskysunsuntaxlionfoodbluepinkgoldmeatryanlukecakehardeasydeskdeerbearbirdmoonfaceeyesbandsingfeetlegsdoorzebrahippophonemousedrinkgreenblackbrownsteaksarahjennimagiccolorpaperhouseshackwomenchildmapletigermouthsocksstorehumanshirtpantshockeyfamilyorangeyellowpurplesilversoccersydneydakotapencilpillowracoonanimalground...

Chapter 6 ED310 2023-02-14

10 Items: Data software______ ProcessingAllows ______ on documentsAssess the _______advantage_____lesson results and impactEncourages writing across the_________________dynamics within collaborative writingShare lessons, _______, and outcomes with other peer teachersTeachers create documents for instructions and _________ tasks...

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

Arianne Word Search 2024-10-23

15 Items: mebffmontanacapybarawhere im frommy dog's nameyoghurt and herbthe couch potatoeI "blank" you allthe name of our schoolthe meaning of my namewhat sofie says i havethe subject i hate the mostme and ariannes favorite thingthe word the boys are literally attracted too

Week 12 2023-05-17

15 Items: Another word for _________________ is new.I would love a ______________ pokemon doll!He _______________ the cookies for the party.Crabs and lobsters are ______________________.Their form of ____________________ is dancing.A cat in a tree writes _______________ for me.The water was too ______________ so I got sick....

AHA SLEEPOVER 2025 2025-12-11

15 Items: Mr Suleiman’s surnameUstadh Adam’s 3rd son’s nameName of Class of 2024 head boyWhat is Aliyu Tanko’s full nickname?Number of houses in Al-Hidaayah AcademyThis family have enrolled 5 kids in AHAWhat book do AHA students read in Year 8?The male companion green house is named after2026 is AHA’s ___________ year since opening....

Adult simp search 2024-04-26

9 Items: something you cravea personality traithow you should behavea term to describe youhow you should address mesomething you want to takesomething you do frequentlya word to describe your body partthe only way you get near a women

Everything! 2013-11-20

113 Items: catdograteatredpenbedboxmanskysunsuntaxlionfoodbluepinkgoldmeatryanlukecakehardeasydeskdeerbearbirdmoonfaceeyesbandsingfeetlegsdoorzebrahippophonemousedrinkgreenblackbrownsteaksarahjennimagiccolorpaperhouseshackwomenchildmapletigermouthsocksstorehumanshirtpantshockeyfamilyorangeyellowpurplesilversoccersydneydakotapencilpillowracoonanimalground...

50 States and Capitals (Includes USA) 2025-03-13

51 Items: USAOhioUtahIdahoMaineAustinBostonPierreTopekaAlaskaHawaiiGeorgaOrgeonIndianaAlabamaMontanaFloridaVirginaVermontArizonaWyomingArkansaColoradoNew YorkMissouriDelawareSt. PaulNebraskamichiganIllinoisMarylandKentuckyLouisianaTennesseeWisconsinDes MoiseNew MexicoNew JerseyConneticutWashingtonCaliforniaPensylvaniaMississippiCarson CityRhode Island...