minnesota towns word Word Searches

Get to know your big 2026-02-28

10 Items: My majorZodiac signMy aestheticMy favorite appMy favorite foodMy favorite colorMy favorite seasonAn obsession of mineOne word to describe meThe milk I use in my coffee

Barbara'S Word Search 2023-06-10

15 Items: Your sonYour nameYour kittyYour puppyWord SearchWhite kittyYour streetWho you loveYour daughterWhere you liveYour other kittyYou love to playAnother favorite sportYour very favorite sportWhere you went to college

Letterbox Enjoyer 2026-01-28

10 Items: first datehorrible moviemy favorite movieyour favorite moviedisappointing sequelcronenberg at my housefirst movie bonded overreddit rabbithole neededyou almost said the word...silently cried together in the theatre

State Codes 2023-11-29

50 Items: ALAKAZARCACOCTDEFLGAHIIDILINIAKSKYLAMEMDMAMIMNMSMOMTNENVNHNJNMNYNCNDOHOKORPARISCSDTNTXUTVTVAWAWIWYVIRGINA WV

50 states 2026-01-01

100 Items: iowaohioutahidahomainetexasDoverBoiseSalemalaskahawaiikansasnevadaoreganJuneauDenverTopekaBostonHelenaAlbanyPierreAustinalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonarkansascoloradodelawareillinoiskentuckymarylandmichiganmissourinebraskaoklahoma...

USA 2026-03-13

100 Items: IowaOhioUtahBoiseDoverSalemIdahoMaineTexasAlbanyAustinBostonDenverHelenaJuneauPierreTopekaAlaskaHawaiiKansasNevadaOregonAtlantaAugustaConcordJacksonLansingLincolnMadisonOlympiaPhoenixRaleighSantaFeTrentonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingBismarckCheyenneColumbiaColumbusHartfordHonoluluRichmondArkansasColoradoDelaware...

DINO & SCIENCE 2025-11-30

15 Items: a dinosaur that hunts for meat.hot lava comes out when I erupt.another word for something HUGE.a dinosaur that eats only plants.sharp parts on dino feet or hands.a long body part used for balance.the loud sound dinos are famous for.dino footprints left in mud or sand.the time when many famous dinos lived.a dino’s imprint or bone turned to stone....

Demographic Transition Model 2026-02-10

10 Items: a graphthe post word for changethe posh name for farmingthe birth rate minus the death ratewhat the name of the model is shortened down towhat improved to reduce the death rate in stage 2the posh word for the structure of people in a countrywhat people are educated to use and can afford from stage 3...

Prayer Word Search 2025-04-30

10 Items: – A prayer calling down God's favor.– Trust in God and belief in His promises.– A posture that opens the heart to hear God.– The inspired Word of God used often in prayer.– To make holy through God's presence and action.– A word of affirmation meaning “so be it” or “truly.”– Personal acts of prayer and piety outside of liturgy....

Name,dinge en plekke. 2023-06-01

19 Items: Melk,botter,kaas,ens.Iemand wat foto's neem.Pêrels wat saam ingeryg isIemand wat baie graag terg.Iemand wat toneelstukke skryfIemand met dieselfde naam as jy.Iemand wat aanmekaar boeke lees.'n Dame wat lug passasiers bedien.'n Rower wat geld uit mense steel.Iemand wat andere in 'n lokval lei.Die plek waar mense op 'n skip slaap....

Synonyms 6th grade 2023-02-03

3 Items: to smileto be richanother word for cry

Word Word Search 2022-06-27

2 Items: bibleSEARCH

Research Methods 2026-01-31

15 Items: Research__________review________reviewResearch _____Research _________Research _________A type of time-horizonEvaluation of LiteraturesAnother word for populationGroup, subgroups or patternsAsking participant permissionA plan for conducting researchSomething a hypothesis is built onMoral guiding principles in research...

World's Most Silly Word Search 2025-09-24

2 Items: it's a three letter wordit's also a three letter word

1930s/Great Depression 2022-12-06

13 Items: another cause of the depressioncreated to help unemployed people get jobsFDR's weekly radio addresses to the nationelected president in 1932/ created new dealrose drastically as the stock market crashedcaused by drought and poor farming techniquesshanty/homeless towns named after a presidentamendment that limits a president to two terms...

States and Capitals 2024-10-06

100 Items: IowaOhioUtahIdahoMaineTexasDoverBoiseSalemAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonHelenaAlbanyPierreAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahoma...

wedding 2025-03-28

100 Items: MayTieFunjoyBeerWineHugsLoveSuitPoolCakeVowsDateRSVPVeilBlueWifeLaceMindyBrideGroomRingsQuinnBellsDressPizzaShotsSweetMusicGreenPartySparkShoesLaughGuestTOASTTrainKissesSubaruchurchPablosRacingTravelHeartsBeautyCoffeeWishesCoupleDinnerinviteBronsonFlowersFriendsRomanceForeverDancingWeddingPuzzlesBourbonGoodhueCupcakeDiamondjourneymagicalperfect...

US State and Capitals Word Search 2026-02-24

100 Items: IowaOhioUtahDoverIdahoBoiseMaineSalemTexasAlaskaJuneauDenverHawaiiKansasTopekaBostonHelenaNevadaAlbanyOregonPierreAustinAlabamaArizonaPhoenixFloridaGeorgiaAtlantaIndianaAugustaLansingJacksonMontanaLincolnConcordTrentonSantaFeNewYorkRaleighVermontOlympiaMadisonWyomingArkansasColoradoHartfordDelawareHonoluluIllinoisKentuckyMarylandMichiganMissouri...

Book Word Search 2025-05-07

70 Items: EggMumDadFunChinappawnjumphintLavaPondWingDawnCardHelpPlaybookpagereadwordballbirdbonuslevelOceanBingoBlueyLearnEnjoyPeteyChiefarcadeSpringSummerHeelerKristyStaceyBorrowSquashCatwadletterauthorpigdaysneezeCatKidDogManFlippyMonarchClaudiaKeywordSpecialBadSeedGoodEggMaxMeowchapterstrategyLunaMothMaryAnneCoolBeanLightningLibrarianBigCheeseSourGrape...

Deutsch I Buchvokabeln 1 2026-01-15

23 Items: nounwordprefixto fitarticlein boldto opensentenceto closeparagraphadjectiveto repeatto explainto replaceto describeto pronounceto underlineline (of text)to tell, narratesection (of text)to match, categorizeto practice, rehearseto complete, supplement, fill in

Dancing Word Search 2025-10-19

18 Items: Casper is a ______Here, kitty kitty kittyWerewolves are also ___________Festive word from Daphne's recapMammals associated with vampiresNature's crime scene in AntarcticaThe word for being scared of fearsA multi-limbed fictitious sea monsterBreak this, get seven years of bad luckThe mess a spider leaves in the corners...

List 19 2025-10-29

10 Items: to giveto copyto wonderkind; courteouseasy to be seeneager interest; zealeasily done; easy to reachlovingly withholding punishmentto gradually get small; to run outknowledge and judgement based on God's Word

Vocab 19 2026-02-04

10 Items: to giveto copyto wonderkind; courteouseasy to be seeneager interest; zealeasily done; easy to reachlovingly withholding punishmentto gradually get small; to run outknowledge and judgment based on God's word

Annie's Surprise 60th Birthday Party! 2025-01-25

18 Items: Annie's maiden name.One of Annie's first jobs.Annie's favorite music genre.One of Annie's favorite candy.Country in Europe Ann has visited.Vehicle Nate is building for Annie.One of Annie's favorite things to do.Current dog's name (shared with Nate).Annie's summer occupation in childhood.One of Annie's favorite childhood candies....

The Spirit of America 2017-05-12

100 Items: USAArmyFlagIowaNavyOhioUtahGuanaHaitiIdahoMaineTexasAlaskaBrazilCanadaHawaiiKansasNevadaOregonPolandSpiritAlabamaArizonaFloridaFreedomGeorgiaGermanyIndianaIrelandLiberiaMarinesMontanaNewYorkNigeriaVermontVetransWyomingAirForceArkansasColoradoDelawareIllinoisKentuckyLouisanaMarylandMichiganMissouriNebraskaOklahomaOldGloryPatriotsTheAlamoUncleSam...

Word Search 2025-10-01

98 Items: IOWAOHIOUTAHDOVERIDAHOBOISEMAINESALEMTEXASALASKAJUNEAUDENVERHAWAIIKANSASTOPEKABOSTONSTPAULHELENANEVADAALBANYOREGONPIERREAUSTINALABAMAARIZONAPHOENIXFLORIDAGEORGIAATLANTAINDIANAAUGUSTALANSINGJACKSONMONTANALINCOLNCONCORDTRENTONSANTAFENEWYORKRALEIGHVERMONTMADSIONWYOMINGARKANSASCOLORADOHARTFORDDELAWAREHONOLULUILLINOISKENTUCKYMARYLANDMICHIGANMISSOURI...

General Technology 2025-08-20

70 Items: HPPDFMP4MP3WMAUSBURLPNGByteJPEGAcerAsusDellGridSaveTextWordFormFilesTowerChartTableMouseEmbedBuildWiresLaptopIPhoneManualOnlineFolderBackupDrivesLenovoSearchExportSystemAndroidStorageEditingDesktopMonitorGatewayBestBuyWalmartProfileImagingWebsiteComputerKeyboardHardwareSoftwareThinkpadFunctionInterfaceHypertextDeveloperMicrosoftAlgorithmGeekSquad...

Music 2025-11-04

51 Items: MassLuteViolNeumeMotetTenorModesShawmRebecLeoninTactusOrganumPerotinChansonMotetusCantataConsortSackbutMadrigalArs-NovaTrouvèreRecorderCrumhornPsalteryEstampieMonophonyPolyphonyImitationOrganettoPlainchantTroubadourMinnesingerWilliam-ByrdJohn-DowlandSacred-musicCounterpointCantus-FirmusGiovanni-PierThomas-TallisSecular-musicModal-harmony...

Pre- Word Search 2025-11-11

20 Items: to map out in advanceto purchase in advanceto reserve ahead of timewhat leads up to an eventto heat before it's neededto get ready ahead of timeto come before something elseto occur prior to the main eventeducation before formal schoolingto occur before the expected timeto warn of danger before it happensdone so something else doesn't occur...

states and capitals 2023-11-16

100 Items: iowaohioutahdoveridahoboisemainesalemtexasalaskajuneaudenverhawaiikansastopekabostonstpaulhelenanevadaalbanyoregonpierreaustinalabamaarizonaphoenixfloridageorgiaatlantaindianaaugustalansingjacksonmontanalincolnconcordtrentonsantafenewyorkraleighvermontvirginaolympiamadisonwyomingarkansascoloradohartforddelawarehonoluluillinoiskentuckymaryland...

State and their Capitals 2025-04-20

100 Items: IowaOhioUtahIdahoMaineTexasDoverBoiseSalemAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonStPaulHelenaAlbanyPierreAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraska...

Cultural variations in attachment 2026-02-25

8 Items: Type C attachmentA word used by Bowlby to describe attachment in infantsThe attachment type most commonly found across culturesThe norms and values which exist within a group of peopleThe word to describe the type of culture found in the UK and USAA country which is said to have a similar child-rearing style to Korea...

Grade Three Sight Words 2024-08-29

71 Items: usuporsawshewhywhooneusetwoanyaddsometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintoworkdoesonlyverymovepullevenfindtherethingwouldwheretheirwhichthesefirstwatergreatlargeagainstudylearnworldschoolnumberpeopletowardpleasefatherfollowanswerbrotherhundredbecausethroughquestionsentencebeautiful

Word3 2025-08-23

70 Items: EndMoreWantManyCareNeedLikeStarClubWordMostYearStaySameSickWithOpenGameWarsFourLifePlanBankSpaceSorryEverySillyThinkWomenSpeakLevelEnjoyCoverCrazyBlindFocusMusicPleaseAnyoneUpdateThanksSearchBottomMinuteAlwaysFutureLovelyCalledHeroesDefeatRobloxRapperPopularWelcomeBelieveYoutubePreviewPrivacyForwardStoriesEnemiesBattlesNoodlesFacecamDifferent...

States and Capitals 2023-05-16

100 Items: iowaohioutahidahomainetexasdoverboisesalemalaskahawaiikansasnevadaoregonjuneaudenvertopekabostonhelenaalbanypierreaustinalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingphoenixatlantaaugustalansingjacksonlincolnconcordtrentonsantaferaliegholympiamadisonarkansascoloradodelawareillinoiskentuckymarylandmichiganmissourinebraskaoklahoma...

US States and Capitals 2024-11-06

100 Items: iowaohioutahidahomainetexasdoverboisesalemalaskahawaiikansasnevadaoregonjuneaudenvertopekabostonhelenaalbanypierreaustinalabamaarizonageorgiafloridaindianamontananewyorkvermontwyomingphoenixatlantaaugustalansingjacksonlincolnconcordtrentonsantaferaleigholympiamadisonarkansasdelawareillinoisKentuckymarylandmichiganmissourinebraskaoklahomavirginia...

Hector Word Search 2024-11-20

103 Items: IowaOhioUtahKarenIdahoMaineTexasDoverBoiseSalemHectorArlethAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonHelenaAlbanyAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraska...

road trips 2025-04-21

101 Items: cargasiowaohioutahtriprainfuelidahomainetexasstateroadshillsparkshoteltollsmusicradiosunnystormwindytreesalaskahawaiikansasnevadaoregandesertforestplainsplatestravelmilagesnackshikingbreaksalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingmidwesttornadocanyonsbordersdrivinglicensecampingpackingluggageweathertraffichighwayarkansas...

States and Capitals Word Search 2025-12-12

100 Items: IowaOhioUtahIdahoMaineTexasBoiseDoverSalemAlaskaHawaiiKansasNevadaOregonHelenaJuneauAustinTopekaDenverBostonAlbanyPierreAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingAtlantaTrentonLansingMadisonConcordAugustaPhoenixLincolnJacksonRaleighSantaFeOlympiaArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahoma...

States and Capitals 2026-03-12

100 Items: IowaOhioUtahPaulCityCityIdahoMaineTexasDoverBoiseSalemAlaskaHawaiiKansasNevadaOregonJuneauDenverTopekaBostonHelenaAlbanyPierreAustinAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingPhoenixAtlantaAugustaLansingJacksonLincolnConcordTrentonSantaFeRaleighOlympiaMadisonArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouri...

Word Search - Symbols of Love 2026-02-02

15 Items: A feeling of happiness and delight.To value something or someone highly.A sense of togetherness among individuals.A decorative strip often tied around gifts.To mark an occasion with joy or activities.A gentle act that makes someone’s day better.A flower commonly given during valentines day.A cheerful sound made when something is funny....

Maria & Jack 2025-05-29

20 Items: Jack's sisterJack's pet dogJack's birthstoneMaria's birth monthTheir college mascotMaria's only siblingCollege where they metState Jack was born inMaria's pet cat in DubaiTheir honeymoon destinationTown they currently live inCountry where Maria grew upMaria was born in this countrySport Jack played in high school...

Gato Word Search 2023-03-02

19 Items: a very common house petword to describe someone strongA place where people go to learna big gray animal with huge earswhat people are born with to seeOne of the most common house petswhat we use to type on a computerword used to describe someone weaksomething students use to write ina common instrument with 6 strings...

Las Posadas 2023-11-28

13 Items: They ______ holiday songs.The word posadas means ________.The word ______ means inn or lodging.These ________ can be held in churches.The _________ is usually shaped as a star.They sing holiday songs and carry a ________ scene.This tradition begins on the 16th of _____________.A child is sometimes chosen to be dressed as an ________....

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

graph=write 2025-10-30

10 Items: the writing of one's own namea book written about a person's lifemapmaking/ the writing of a map or chartrecord player, turns writing on records into soundthe use of light to record an image using a camerawriting about a person's life written by that persona device that writes down the movements of the earth...

Vocab. 2-3 2025-11-20

6 Items: break downto lessen in intensitythe producer of an effectto caution against somethinga person who initiates a contactrepeating the same word or phrase

In English we explore, 2026-02-04

9 Items: Life storiesFilm studiesStudy of languageStudy of word originsStudy of ancient storiesStudy of ancient culturesEvents and facts from the pastNature, places, people et cetera Etc.Study of ancient Greek and Roman cultures

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Group Literacy Word Search 2025-08-14

31 Items: CiteInferThemeGenrePrefixSuffixAnalyzeComparePredictExplainClarifySupportContextLiteralSynonymAntonymContrastEvaluateDescribeIdentifyEvidenceSummarizeInterpretDetermineMain ideaRoot wordNarrativeConclusionFigurativePerspectivea list of 30 common **6th grade literacy vocabulary words**:

NFL Team 2025-12-13

32 Items: Chicago BearsBuffalo BillsNew York JetsDetroit LionsDallas CowboysMiami DolphinsDenver BroncosHouston TexansAtlanta FalconsNew York GiantsBaltimore RavensTennessee TitansCleveland BrownsLos Angeles RamsSeattle SeahawksLas Vegas RaidersGreen Bay PackersMinnesota VikingsCarolina PanthersArizona CardinalsIndianapolis ColtsKansas City Chiefs...

miyas birthday word search only open if u a creep 2026-02-11

8 Items: addict.There’s __ to tsEcuadorian DelicacyBig word, first letter OShorthand for Nonchalant“We‘re gonna ___ these hoes”You and Col’s favorite sign offWorst flavor on earth but it’s one of your favs

Year 3 Term 2 Wk 2 Homework 2024-05-05

24 Items: DramaAn accidenta situation4 letter wordjoyful emotionsomething organisedPrecious to someone1st Month of the yearto won of give somethingorganising something nowOut in the bush on holidaysa crunchy red or green fruitEarth, Mars, Jupiter are theseTo get from one place to anotherA place where you go to get moneyNot perfect or excellent just.......

name of towns (easy mode for Chinese kid under 5 years old) 2025-09-03

10 Items: Bog areaFarm nameTown nameHill namewild troutRailway stationSuburb in SydneyLakeInMassachusetteVillage in the NetherlandsA small island in Tierra del Fuego

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Amazing E 2026-03-01

11 Items: A school supplyWe see with theseChicken lay thesean electric animalWe hear with theseA purple vegetableThe number after 10Another word for liftAlbanian animal symbolA planet where we liveAn animal with big ears

Heat Transfer Vocabulary Wordsearch 2025-01-29

7 Items: Another word for HeatThe Definition of EnergyHow Temperature is measuredHow Radiations transfer heatHow Convections transfer heatHow Conductions transfer heatThe Type of energy that Thermal Energy is

Greenisland Word Search 2025-09-17

10 Items: Who said “I love you” first?He proposed during this monthTheir favorite breakfast drinkYear they started dating: 20___Where was their first trip together?Where was Lauren & Trevor’s first date?What is their favorite day of the week?Their favorite season to spend togetherWhat is the name of their wedding venue?...

Sentences, Subject, Predicate 2023-08-25

16 Items: a commanda questiona statementexpresses a strong feelingwhat the sentence is abouthas one subject and one predicateall the words in a subject of a sentencetells what the subject does, has, or is likeall the words in the predicate of a sentencea group of words that expresses a complete thoughtwhen two or more subjects share the same predicate...

Floccinaucinihilipilification Word Search 2023-10-20

75 Items: okejoybitthesitpopmopboxfoxcatsczarzetapinkweekdayshardtreewordplantwinartslavagamethemwhatwilljumpwereablemoredoorrainquestwindywatercartsmusicglasstrainemoteciderfirststartslyncheshandiertheatersmonumentcesspoolscatalogedturnaroundwristwatchmanservantmemorandumsunutterableunnaturallymenstruatednanosecondsplayfulnesstimelessnessunattainable...

No Title 2025-05-06

75 Items: SumOddOneTenTenAddBarPartSkipEvenZeroUnitLessBaseHalfDataWordFormSensePlaceValueDigitWholeRoundOrderCountEqualAfterGroupTallyChartRatioGraphTotalNumberSymbolBeforeAddendDoubleComparePatternHundredNumeralGreaterBetweenNearestComposeFactorsProductDecimalPercentBalanceIntegerEstimateSequenceThousandEquationSubtractAdditionQuotientFractionRounding...

Ha’azinu 2024-09-29

18 Items: “Lawlessness”aka, Rosh HaShanahSimon Son of Jonah“Shuvah” means to _______The 8th letter of the alef-beit.This Hebrew word means “to speak”Repentance results in __________.Son of Barachel the Buzite (Job 32)“Heaven an earth” in the Song of Moses.HaShem’s revealed teaching for mankind.The letter peh has a pictograph of a ______....

Cell Word Search 2026-01-03

4 Items: the basic unit of lifeanother word for digestLysosomes are _____ the cellLysosome have ______ for food and water

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

Occupational Word Search 2025-03-23

20 Items: What is Ellee afraid of?What is Ellee's school mascot?What is Noah's sibling's name?What is Noah's favorite candy?What is Ellee's sibling's name?What is Noah's favorite soccer team?What is Ellee's favorite music group?What was the name of Ellee's hedgehog?What is Noah's favorite ride at Disney?What is Ellee's favorite ride at Disney?...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

And Word Search 2025-05-19

74 Items: ifonofandoffmadsadfathatyouearonetwosiztenlikeyourhatelovesingquizwordfoodnoseearsopenshutnicemeannounverbfourfiveninekitesandtrackangryhatedlovedlikedwordstrickmouthcloseknifenightnounsverbsthreeseveneightfightmightsandygramsfriendpluralpuzzlesearchtrickyclosedmurderknightgrainsouncesfriendssinginggumballhundredmultiplesingularthousandadjective

the hatchet and people i know 2016-12-09

72 Items: MrMrfunbowbowDogoldBalDanJoeRobMrsbookmovefishtipswildwolfCarlSongWoodsongwordkithMattGregAlexLisakiwiGaryBillAdamMotaSovahatchbearsBrianstoryhonerAntonLauraAllanNancyshayaarrowsskunksauthorsearchRobertHarveyAngelaJustinshelteranimalsturtlesnewberydancingtrackerRobesonFrancesGrandmasurvivalsentriesserenitysurvivingGreg-dubewildernessthree-time...

Monday Word Search 2023-09-11

72 Items: tvdogcatoneredfunyoushearecankingpassexamknowopenbookreadnounverbwordhavemustmarkthirdqueenlearnenjoythinkspeakpupilmathsmondaysundayaugustfriendfamilytwentylondonlessontravellistenadverbsuccesshundredbritainenglandirelandexploreanalyzepresentenglishpronounstudentteacherscotlandresearchcopybookworkbooktextbookmemorizealphabetwednesdayseptember...

slay 2025-10-24

59 Items: tearaeyupcartridewordmoonfishdirttreesimslionstorefartypartyfrogstoadsdancejoe'slibragoulsturtleribboncactusflowerspiderlettershartygallopdreamswarmthnovelsmozartsearchdangerspookyclownsghostsblockstalkingsnoringanimalsreadingnuggetschargeraxolotlgoblinsshoppingscorpionmcflurrymountainaquariusshortcakewinehousepepperoniplatformsliterature...

I N F O R M A T I K A 2025-08-29

75 Items: LanManWanRj45HdmiCCTVAsusAcerOppoVivoMeshStarRingBiruWifiWordTreeModemMouseKabelTeslaAppleStackQueueHijauHelioLinuxCyberExcelCiscoSwitchServerTesterLenovoIphoneXiaomiCameraHybridCoklatOrangeLaptopMemoryUbuntuRouterCodingNetworkMonitorSamsungPrinterAdaptorSortingWindowsInfinixChipsetHotspotJaringanKomputerKeyboardInternetCrimpingMacintosTopologi...

Literary Devices Crossword Grades 11-12 MA ELA Standards 2025-12-22

30 Items: an author’s word choicea word that imitates a sounda comparison using like or asthe emotional atmosphere of a textdeliberate exaggeration for effectlanguage that appeals to the sensesspecial importance given to an ideaa recurring idea, symbol, or subjectthe sequence of events in a narrativegiving human traits to nonhuman things...

Farm 2023-05-08

32 Items: cowpigdoghayfarmBankduckmuleeggssoilgoatseedshorsecropssheepgoosefarmerplantsdonkeytractorchickensC S I T R E M R A F W M Q LH T C O W U C D Q B U I T VI S D E E S C R F I K Q T GC P F L J H E D O N K E Y OK O P E E H S L S P G M D OE S R O H F P X U G S O G SN P R P L A N T S M G P A ES V T P D Q V O D P I E Z TA R O T C A R T O P I G O S...

Grammar Review & Roots 2026-02-06

12 Items: ACTION WORDDESCRIPTIONTHE STUDY OF LIFEFOUNDATION OF WORDSMEANING OF ROOT "BIO-"PERSON, PLACE, OR THINGSTORY OF SOMEONE'S LIFEBEES POLLINATE ___________FISH THAT FOLLOWS SHARKS AND RAYSCLOWNFISH LIVE IN AN ____________PLACE WHERE MANY DIFFERENT SPECIES LIVERELATIONSHIP WHERE 2 CREATURES LIVE TOGETHER

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

US States by Capital 2025-10-07

50 Items: BoiseDoverSalemAlbanyAustinBostonDenverHelenaJuneauPierreTopekaAtlantaAugustaConcordJacksonLansingLincolnMadisonOlympiaPhoenixRaleighTrentonBismarckCheyenneColumbiaColumbusHartfordHonoluluRichmondSanta FeAnnapolisFrankfortNashvilleCharlestonDes MoinesHarrisburgMontgomeryMontpelierProvidenceSacramentoSaint PaulBaton RougeCarson CityLittle Rock...

Gravity Falls 2024-03-06

8 Items: Who worships Stan?Who is Mabel’s pet?Who is a mind demon?Whose real name is Mason?What does Wendy represent?Who loves to wear sweaters?What is a popular soda brand?What word does Soos mispronounce?

Chukat ~ “Statute” 2024-07-07

17 Items: Moses’ sisterAbraham’s nephewHe dies at Mount HorHebrew word for “statute”Hebrew word for a good work.Hebrew for “instruction” or “teaching”“outside the camp” during Temple times.Messiah Yeshua is the _____ of the Torah.The last enemy to be destroyed. 1Cor15:26The person who took Yeshua’s body away for burial....

Greek roots week 3 2025-09-09

10 Items: not academicextremely activetaking no actionsextremely sensitivesame types of graphssame word different meaningcoming together and talkingover active and doing to muchopinions or doctrines with the official positiongrouping made up of many differing or unlike parts

Rote Words 2025-12-16

15 Items: A person, place, or thingThe sequence of the storyA word that means the sameAn action or state of beingA comparison of unlike ideasA word that means the oppositeThe time and place of the storyA person in a book, play, or movieA comparison of unlike ideas using like or asThe universal meaning of the story, a life lesson...

States and Capitals Word Search 2025-05-22

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaVermontWyomingColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaNew YorkOklahomaVirginiaLouisianaMinnesotaTennesseeWisconsinCaliforniaNew JerseyNew MexicoWashingtonConnecticutMississippiNorth DakotaPennslyvaniaRhode IslandSouth Dakota...

Where Am I? 2025-11-24

7 Items: Sounds like a bubble pop — twice.Shares its name with what you do to cards.Begins with a strong K and a punchy “-ump".Contains a word you use to keep a door shut.Starts with a big, wide W, has double A’s, and hints at arms swinging again and again.The word starts with “Break,” but no objects are damaged it’s about crashing into moves....

3 year anniversary 2026-03-05

13 Items: my nameyour namecrazy dashawnmy favorite foodcity where we metwhat is march 5th?where we first metyour favorite foodyour number 1 drinka word you always saymovie on our first dateyour favorite basketball teamcalm elagant cat, grey and white

Caps 2024-12-29

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaKansasNevadaOregonAlabamaArizonaFloridaGeorgiaHawai'iIndianaMontanaVermontWyomingArkansasColoradoDelawareIlliniosKentuckyMichiganMissouriNebraskaNew YorkOklahomaVirginiaLouisianaBaltimoreMinnesotaTennesseeWisconsinCaliforniaNew JerseyNew MexicoWashingtonConnecticutMississippiNorth DakotaPennsylvaniaRhode Island...

NFL Teams 2025-12-16

32 Items: Chicago BearsBuffalo BillsNew York JetsDetroit LionsDallas CowboysMiami DolphinsDenver BroncosHouston TexansAtlanta FalconsNew York GiantsBaltimore RavensTennessee TitansCleveland BrownsLos Angeles RamsSeattle SeahawksLas Vegas RaidersGreen Bay PackersMinnesota VikingsCarolina PanthersArizona CardinalsIndianapolis ColtsKansas City Chiefs...

Blessedtrinity Word Search 2024-12-17

17 Items: The freedom and ability to choosean agreement with God and his people(hint: What does the word Gospel mean?)- Good News(hint: What does the word Genesis mean?)- beginningA thought, word, deed, or omission against God's lawan area in the Middle East that Include's present-day IsraelRevelation - God making himself known to us through creation...

Root Word #11 Practice 2025-03-25

10 Items: breakgood, wellmake, donebear, bring, carryflee, runaway, escapeto move to another placea part of a larger wholea protected place to flee toa place where things are madereplacing an offensive word with an offensive one

Word Search Fun 2025-08-14

10 Items: The number 14The number 19Belonging to usPast tense of “say”The opposite of badPast tense of “come”Shows necessity; have toAt this moment; immediatelyAsks about a place or locationA polite word used when asking for something

Random 2022-11-21

76 Items: popsayfarsadcitywordhomelovehugspostopenwiferockfoodlefthalfhopearmyburnlifereadminehelpcoldprintsmilewitchnoonecloseproudfisrtpizzarightmummycrashdiarysharespicysweetloversrhythmrandomlistentiktokanyonereasonhomiesdrinksbottomcursedsearchfriendsmedicalhauntedhusbandcountryepisodewhisperdiamondtitanicjournalwebsitetwitterraggedyanythingbookworm...

Medicine 2024-07-03

6 Items: You put it on your woundsA tube used by a doctor or nurseYou take them to grow well and be healthyYou spread it on your skin, esp arms and legsPeople who can't walk sit on it and move through it...

Dover Word Search 2025-10-06

50 Items: OhioIowaUtahMaineTexasIdahoOregonKansasNevadaAlaskaHawaiiGeorgiaVermontIndianaAlabamaFloridaMontanaWyomingArizonaDelawareMarylandVirginiaNew YorkKentuckyIllinoisMissouriArkansasMichiganNebraskaColoradoOklahomaTennesseeLouisianaWisconsinMinnesotaNew JerseyCaliforniaWashingtonNew MexicoConnecticutMississippiPennsylvaniaRhode IslandNorth Dakota...

Happy Birthday Netta 2024-10-12

10 Items: The Blue & The White?Netta’s favorite emoji?Some good shopping in Minnesota?I grow on a vine & I clutch my___.They know her by name? Bling! Bling!Netta’s favorite color? (Chewing Pink)She has been playing in this since childhood?Netta’s favorite restaurant? (Known for steaks)Netta’s Favorite place to visit? (The capital of England)...

About Word Search 2025-03-25

76 Items: asbydogoifitmemynooforsotoupusallanydidhasherhimhisitsoneseetrytwousewhowhywonalsobeencallcomedoesdonedowneachfindgoodintoknowmademanymoremostonlyoverpartsaidsomethemtimeverywerewhatwhenwordworkyouraboutcouldfirstotherrightsmalltheirtherethesewaterwherewhichnumberpeopleshould

Wheelock's Chapter 5 Vocabulary 2025-11-13

25 Items: skywordwhenyouthglorycourageour (f)if everto dineto stayfree (m)tomorrowto blamethereforeyesterdaybecause ofto overcomemind, spiritfault, blamebeautiful (neut)sound, healthy (m)then, at that timeenough, sufficient(ly)you, yourself (acc/abl)[enclitic particle that denotes a question]

Word Search Competition 2025-11-25

79 Items: HotGasRedFunSunHeatColdJustMeltBlueCoreMarsMoonWordZoomReactScaleSolidStillFlameGreenCrustOceanEarthVenusPlutoExpandEnergyStatesLiquidUsefulYellowSaharaArcticRobloxMantleIndianSaturnUranusSearchCelsiusConductMeltingBoilingDisplayMixtureExplodePacificNeptuneJupiterMercuryExploreBecauseInsulateFreezingDiscoverZimbabweAsteroidThailandAtlanticRadiation...

the slanders word search 2025-04-11

11 Items: favorite hobbyyour birthstonethe puppers nameyour zodiac signwhere you grew upyour most used wordyour most worn colorone of ur fav sayingsyour favorite child’s namethe stare we get when ur angyshrinkos fav thing to say 2 ace

Math 2025-10-09

14 Items: the backpropertylike termthe oppositeno equal signgiven or receiveadding a variablegetting the answercompares two equationbasic algebraic equationa value that won't changesomething to fill a questiona word with multiple meaning'ssomething with more that 3 or more equation