medical Word Searches

Word Search Key Terms 2024-03-05

52 Items: ldlhdltactrategaitsignssignspulsesmellclearcolortriageplasmareflexmemoryvisionborderhistoryempathyfactorshormonehearingstridorrhonchisymptomsdemeanorpressuremovementstrengthresponsewheezingcracklesdiameterevolvingdiagnosiscomplaintleukocyteplateletssensationasymmetrymass indexhemoglobinhematocritmetabolismhomeostasiserythrocytethrombocyte...

Ch. 16 Medical Terminology 2024-02-16

5 Items: fear of heightsfluid in the brainuncontrollable sleep attacksfear of enclosed or narrow spacesdrug that prevents pain by causing a loss of feeling

Ch. 24 Medical Terminology 2024-05-06

5 Items: Involuntary, uncontrollable movementsweakness or slight muscular paralysisQuick, involuntary jerking of a muscle; muscle twitchThe loss of muscle mass, strength, and function that come with agingA band of fibrous tissue that holds structures together abnormally, usually form after injury or surgery

Ch. 19 Medical Terminology 2024-03-15

5 Items: ribskullvisual examinationsurgical puncture to remove fluidthe process of producing a picture or record

Ch. 20 Medical Terms 2024-04-15

5 Items: x-ray of blood vesselswire-mesh tube used to keep arteries openvisual examination using a lighted instrumenta mixture that is swallowed to make the digestive tract easier to see on an x-raya device that delivers electrical impulses to the heart to regulate the heartbeat

Ch. 14 Medical Terminology 2024-02-02

5 Items: Visible part of the toothhard, outermost layer of a toothmaterial covering the tooth rootlayer of the tooth under the enamelThe tissue that contains the blood vessels and nerves of a tooth

Ch. 21 Medical Terminology 2024-04-22

5 Items: ultrasound of the hearttapping on the surface of the body to determine the density of the underlying structurea substance that allows x-rays to pass through and appears black or dark gray on the resulting filmsubstance does not allow x-rays to pass through and appears white or light gray on the resulting film...

Ch. 22 Medical Terminology 2024-04-29

5 Items: Sway backHunchbackOriginating within anotherOriginating from one’s selfUpper portion of the sternum

Records and Documentation 2024-05-16

10 Items: In short means brief and to the point.Fill out completely all the forms used in the patient record.Words-to record the patient's exact words rather than your interpretation of them.Order-Entries in the patients records must be dated to show the order in which they are made....

Lab Week Word Search!! 2014-04-10

68 Items: ERICUPKUARUPDHMCNICUSTATswabbloodclerkcobanDavislabornerdsquestrehabtubesurinehealthscrubsanalyzeclinicscourierlabcorplabweekmedicalneedlesnurseryreagentsciencesurgerytestingweecarebandaidsHospitaldeliverymedicinepatientsrecoverysendoutssurgicalvampiresbloodbankbodyfluidchemicalschemistryemergencygraveyardheelstickhistologytelemetrycentrifuge...

Nurses Week! 2024-04-29

70 Items: cnodaisyacutecaringordersvaluesfamilykiyokoassisthealthstatimnursinghuddlesmedicalsurgeryhealingadversetedhoseaphasiapurposestaffingmeditechchartingteamworkpoliciespatientspolicieselsevierambulateprovideradvocateadvancedsedationtopnotchhospitaltouchetteprotocolsintegritybiohazardemergencytelephoneeducationknowledgedischargechesttubeassertive...

Medical Advancements from the Renaissance to the 19th Century 2023-02-09

15 Items: Invented bifocalsdiscovered X-raysFather of PsychologyInvented the stethoscopeFounder of Modern NursingRefined surgical techniquesstarted the American Red CrossDeveloped the Small Pox VaccinePublished the first Anatomy bookInvented the compound microscopefirst female physician in Americadiscovered the tuberculosis bacteria...

Modmed 2023-08-29

12 Items: We are thego live dayrides bikeswe work forwhere we playNew EMR systemyour go to personone of the leadersdirector of operationsElectronic medical assistanthow a patient learns about the practicewill help you understand another language

Random 2022-11-21

76 Items: popsayfarsadcitywordhomelovehugspostopenwiferockfoodlefthalfhopearmyburnlifereadminehelpcoldprintsmilewitchnoonecloseproudfisrtpizzarightmummycrashdiarysharespicysweetloversrhythmrandomlistentiktokanyonereasonhomiesdrinksbottomcursedsearchfriendsmedicalhauntedhusbandcountryepisodewhisperdiamondtitanicjournalwebsitetwitterraggedyanythingbookworm...

wave 0 week 5 morning 2023-12-11

80 Items: louavesnmetninacardfamejhonaangiehippaformssmiledentalmanualmemberlauriemarnieleshonmiriamsnoopyconlancalaimhealthhealthmolarssocialtarnotcountybrailemedicalmichelemelissarichardfortunadentistmanagedacronymwebsiteweekfiveproviderjenniferkimberlysamanthagainwellbenefitsdocumentsealantsreferrascareplansecuritypinkformpersonalspeciatybreakoutresources...

Acronyms 2023-11-16

20 Items: benefit Groupchild supportearned incomelong term carebehavior healthdate of serviceAccess to Recoveryfederal match codeAffordable Care ACTfair hearing BureauBureau Indian affairsdepartment of justiceBlue cross blur shieldAutomated teller machineindividual education planProtected health informationmedical assistance department...

Medical Documents & the Mail 2024-05-10

4 Items: To add explanatory notes or comments to a text or documentA definite or clear expression of something in speech or writing.A pre-designed format or layout used as a starting point for creating documents or files.A greeting or expression of goodwill, typically used in the opening of a letter or message.

ABD categorical relationships/programs 2023-12-12

17 Items: Disabled Child Program (acronym)Medicaid program handled by OHCALong-Term Care Program (acronym)State Supplemental Payment (acronym)Qualified Individuals - Group 1 (acronym)A categorical relationship for the ABD programA categorical eligibility for children with PKUA medical program that provides Medicaid & Buy-in...

Inhalants Word Search 2022-10-13

13 Items: Street nameStreet nameMedical nameMedical nameAn effect by inhalantsInhaling from a soaked clothInhalants cause ________ damageproducts An example of inhalantsInhaling directly from the productInhaling from paper or plastic bagProvides local treatment locationsFirst time users might experience thissystem This system of the brain is affected

CannaChallenges 2023-11-27

6 Items: Type of nursing care for individuals using medical marijuanaExamples of these include drowsiness, restlessness, and changes in blood pressureA word to describe a nurse's role in helping patient's suffering from chronic painPrescribing Marijuana for chronic pain will potentially reduce the number of prescriptions of this medicine...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Where's Waldo? 2019-11-28

88 Items: OCDexamgaitnerveaortawaldobursaocularimmunevisualcortexdistaldorsallumbarkidneyspleenthymuslarynxqualityvertigomedicalsternuminsulinstationurinarybipolarscapulatracheastomachbladderforamenanxietyatrophyventralabdomenthyroidproviderfunctiondeferralevidencemandiblepancreasdiabetesligamentmembraneneoplasmcerebrumauditorymandibleproximalcervical...

Medical words 2023-06-20

2 Items: drugdangerous disease

Case study on Charlie 2023-04-30

15 Items: type of formulaloss of body fluidloose watery stoolslab value to monitordifficulty swallowingcomplication from feedingabnormally low body weightcancer Past medical historycaused by not eating enoughfeeding type of tube feedingloss a reduction in body sizecancer treatment that kills cellssomething that you monitor with feeding...

Unveiling the Amazon's Medical Marvels: Antibiotics, Anti-Cancer Treatments, and Natural Therapies1. Amazon 2024-04-12

20 Items: VenomHerbsAmazonMedicineMedicinalEcosystemRainforestPropertiesIndigenousTreatmentsDiscoveriesAntibioticsPainkillersAnti-cancerTraditionalPilocarpineBiodiversityAdvancementsAntimicrobialMicroorganisms

Ch. 13 Medical Terminology Word Search 2024-01-26

5 Items: red blood cellsabnormally swollen veinsdangerous infection of the blooda drug that prevents clotting of the bloodincreased number of red blood cells in blood

Medieval Europe & The Middle Ages 2024-04-03

21 Items: plaguepitsPeasant: A farmer or poor labourer.Century: A period of one hundred years.Sanitation: Availability of clean water.Medieval: Another name for the Middle AgesSymptom: Evidence a person has an illness.Nobles: Wealthy class in the feudal system.Agrarian: Of farming or cultivation of land.Servitude: To be a slave or subject to someone....

Compliance Week Privacy Word Search Game 2022-10-24

10 Items: HIPAA _______ and security RulesWhat regulation provides protection for health data?In order to properly dispose of paper PHI you must _____ itWhat is the three-letter acronym for protected health information?What word do you put in the subject line to encrypt your confidential emails?...

Tough Word Search 2022-05-24

17 Items: widespreadto overcomebeing aloneextremely tiredto be all arounda win in an eventa medical operationhaving a lot of moneya place such as a cityto try to achieve somethingto repeat or reflect a sounda particular part of the worldvery great in size or quantitystrong or not easily broken or defeateda person who often takes part in sports...

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

Open Enrollment 2022-10-03

11 Items: dental plan providerRetirement departmentvision plan provider abbreviationHealth Savings Account Abbreviationoptional benefits like pet insuranceThe new medical plan provider for 2023Flexible Spending Account AbbreviationDiscount provider for wellness discountsWhere you log in to review/change your benefits...

Paraprofessional Team Building 2022-11-29

14 Items: code for a medical emergency (BLUE)the female external catheter (VERSETTE)common name for the urinary catheter (FOLEY)acronym used to identify signs of a STROKE (BEFAST)the type of bath that is secondary to regular bath (CHG)machine used to help prevent blood clots in a patient's legs (SCD)...

Protocol 16-18 Word Search 2024-02-09

16 Items: T=_ hoursBlood in the irisProblem Suffix = JProtocol for FallsProtocol for HeadachesAnother word for BleedingProtocol for Eye ProblemsInfection around the brain_Blow is a Severe Eye InjuryConsidered a small event in dispatchOften called Arc Eye or Welder's FlashMost recognized method in airway control_ lenses are considered a minor eye injury....

BoxER 2022-10-26

10 Items: HRA Carly's ext.: 38_0ARA Wilson Park CT: 4_33Quarry Ultrasound 1: 464_NAMC Main ER #: 512-901-60_7Main # for TX Orthopedics: 512-439-100_Seton Hays S.4B sound phone: 512-93_-9660Seton Main Specials Direct #: 512-_09-6901Michelle Markley, MD's cell phone #: 512-_25-1532Sami Aboumatar, MD's office phone #: 512-_39-8831...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

The Secrets Behind Extending Human Lifespan: Unveiling Medical, Lifestyle, and Tech AdvancementsHealthcareDiscoveries TreatmentsVaccinesSurgeryNutrition 2024-04-14

10 Items: dietssurgeryhygienevaccinesnutritionhealthcaretreatmentsdiscoveriesinformationtransportation

Protocol 19-21 Review 2024-02-21

15 Items: Problem Suffix HProblem Suffix CThis is another name for AEDsAnother name for a Heart AttackPale, Grey, numb, bloodless and coldAn example of Heart Rhythm ComplaintsAn illness or other biological maladyThis is an example of a blood thinnerThis is an example of a bleeding disorderSluggish, decreased level of consciousness...

Chapter 4 Word Search 2023-05-12

20 Items: Fail to care for properlyFree from outside controlFailure to take proper careLack of respect of courtesyMaking false spoken statementsUsing finances inappropriatelyBeing worthy of honor or respectUnacceptable or improper behaviorKeeping something secret or privateActs which do not suit one's statusMoral principles that govern conduct...

Joint Commission Readiness Word Search 1 2023-12-14

13 Items: You can find policies on __ ___.A code black is called for a ___.Informed consent is obtained by the ____.If a patient is suicidal you call a ____.The SDS for any chemical is found in ___.Glucometer test strips are good for ___ ___.What is the wet kill time for purple top wipes?How long do you have to report critical results?...

Chapter 16 - Key Terms 2023-11-01

29 Items: A legally enforceable agreement.The cost of the coverage provided by an insurance policy.Payment by the insurer or by the patient of more than the amount due.A person designated by an insurance policy to receive benefits or funds.The determination of the exact coverage to which the insured is entitled....

health and safety 2023-02-27

15 Items: warm cover on a bedvery quickly, without waitingtaking air in and out of your bodysheets,covers.that you put on a bedto cover something with cloth or paperthe possibility of being hurt or killedto leave a place because it is not safepeople who come to help you very quicklydoing something when someone talks to you...

Medical paractitioners 2023-05-26

1 Item: - angiologist - arborist - audiologist - biochemist - chemist - chiropodist - craft paper - dermatologist - domain expertise - educationist - Egyptologist - endocrinologist - entomologist - epidemiologist - Es - ethicist - expert - expertise - geneticist

World Safety Month Word Search 2 2024-04-08

20 Items: I wear my _____I _____ the joblikelihood x consequenceI follow my lifting _____I _____ myself against fallsabsolute way of life at TerexI _____ myself in a safe zonethe most effective hazard controlset of behaviors that prevent SIFsthe least effective hazard controlthink _____, work _____, home _____set of behaviors that prevent common injuries...

Getting Paid 2024-04-29

20 Items: A tax on earned and unearned income.Outlines the deductions made to wages.Agreement between an employer and employee.The regular schedule that employers pay employees.A person who relies on someone else for financial support.A check written to a worker in the amount of money earned.A fee that a salesperson receives upon completion of a sale....

Dental Acronyms 2023-12-15

35 Items: - claim- Billing- Application- Beneficiary- claims payment- Claim inquiry form- Accounts Receivable- Claims Billed Amount- California Civil Code- Change Control Number- Claim inquiry response- Computer Based Training- Adjudication Reason Code- Corrective Action Request- Current Dental Technology- Beneficiary Correspondence...

MEDICAL TERMINOLOGY 2022-12-29

1 Item: ABRASION, ACUTE, ANAPHYLACTIC, ARREST, ASTHMA, CARDIAC, CASUALTY, CHRONIC, CONSCIOUSNESS, DEFIBRILLATOR, EMERGENCY, HEMORRHAGE, HIVES, HYPERTENSION, LACERATION, MIGRAINE, MYOCARDIAL, OVERDOSE, PREGNANCY, PRESSURE, PULSE, STROKE, TRAUMA, VENTRICULAR

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Health Insurance 2024-04-17

6 Items: The healthcare items or services covered by a health plan.A legal agreement between two parties; the insurer and the insured.Legal entitlement to payment or reimbursement for your health care costs.The amount you pay for covered health care services before your insurance pays its share....

Posties Dec 18 - Big Read 2023-11-24

6 Items: another word for "rubbish"knives, forks and spoons, used for eating and serving foodable to be decomposed by bacteria, so that it doesn't pollute the environmentto be unable to breathe because the passage to one's lungs is blocked by somethinga sea creature with a body like jelly and long thin parts called tentacles that can give a sharp sting...

Health Insurance 2024-04-16

7 Items: The conditions for which the insurance company will payThe Payment of benefits for covered sickness or injury.The Health care items or services covered by a health planA legal agreement between two parties; the insurer and the insured.What you pay annually for health services before your insurance company pays its share....

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Absence from Work Policy Terminology 2024-04-16

6 Items: Any form of absence from the workplaceFailure to submit a valid medical certificate when one is required is an example of _ absence.An employee leaving work earlier than the agreed end of the work/shift time refers to early _.When an employee is absent for more than 6 days over a 3 month period refers to frequent or _ absenteeism...

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Masthead Word Search 2023-02-21

28 Items: journalista reportercapital letterstype of letteringtitle of an articlea piece of reportinga thick visible printa popular type of papera news article or bulletinnewspaper published everydayline giving the date of writingnewspaper published once a weekthe main article in a newspaper.information about current eventsnewspaper appearing every 4-weeks...

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

Gardner Denver Thomas 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Wuxi Word Search 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

BASIC TERMINOLOGY USED IN ATHLETIC TRAINING 2022-08-25

35 Items: broken bonelying face uplying face downblood in a jointpooling of bloodabove or head endcause of an injurytoward the mid-lineswelling with a jointback it sorsal aspectconnect muscle to bonefront or ventral aspectstretch or tear of ligmentbelow or away from head enddecrease in size of body partbruising or crushing of tissue...

Wine Word Search 2023-08-16

250 Items: gasoiltaxdbafeewinebeercoalcasebondsodalienfilenrsrsalelevyfundfuelerrorwaterciderfarmsjointamendassetdebtsgoodsmotorgrossvaluestockpoboxlegalevadeexcisereturnbrewerannualperiodreportcreditagencyincomewealthverifyseizedmalignpoisedsolemnquenchdappertobaccoinvalidmytaxesrenewalindiciamonthlymedicalutilityoverpayaddressforeigncompanyventureclosing...

Wine Word Search 2023-08-17

250 Items: gasoiltaxdbafeewinebeercoalcasebondsodalienfilenrsrsalelevyfundfuelerrorwaterciderfarmsjointamendassetdebtsgoodsmotorgrossvaluestockpoboxlegalevadeexcisereturnbrewerannualperiodreportcreditagencyincomewealthverifyseizedmalignpoisedsolemnquenchdappertobaccoinvalidmytaxesrenewalindiciamonthlymedicalutilityoverpayaddressforeigncompanyventureclosing...

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Chapter 1-4 Review 2023-12-07

25 Items: Body erect with palms upA hospital-acquired infectionAbnormal softening of the cartilageAttach only posteriorly to the vertebraeThe multilayered abdominal organ membraneThe inflammation of the voluntary musclesMovement that bends the foot downward at the ankleContains the thoracic, abdominal, and pelvic cavities...

Addictionary Word Search 2 2023-08-08

10 Items: An often binding process for the resolution of disputes outside of court.The progressive or gradual increase in drug dosage to reach an optimal therapeutic outcome.A group of signs and symptoms that appear together and characterize a disease or medical condition....

Claims 2023-05-24

18 Items: DN11(PPO, CPPO, DTMX)January 1st to December 31stWhere we review claims that have been receivedNot a specialist. Responsible for routine careCareington services client with processing claimsThe number of procedures covered during a state periodallows services or treatment to be reviewed for medical necessity...

Recovery 2022-10-15

12 Items: non-use of any addictive psychoactive substance.A dysfunctional state resulting from the use of psychoactive substances.A state in which an increased dosage of a psychoactive substance is needed to produce a desired effect.A process of withdrawing a person from a specific psychoactive substance in a safe and effective manner....

OnCore Research-Related Phrases 2023-02-08

33 Items: Visit windowCount of subjects on a studyElectronic medical record systemThe full-length name of the protocolConsole where subject staff are enteredBase template for an OnCore study calendarThe institutional funding body for the studyOrganization or company supporting the trialList of team member contacts for the protocol...

Unit 3 Vocabulary Crossword 2023-02-23

25 Items: The chromosomes duplicated in ____.The Mona Lisa is famous for her ____ smile.It was a very hot day so Joe walked at a ____ pace.Alice in the Looking glass has many ____ characters.The term ‘Karen” often refers to a rather litigious woman.Sherlock Holmes’s ____ is what made him such a good detective....

A- Word Search 2023-01-25

26 Items: Kinetic Engineer: A kinetic engineer is an engineer that emphasizes on heat and mass transfer and deals with the process of design.Utility Engineer: A utility engineer is a civil engineer who works for a utility company, such as a water, gas, or electric company....

Electronic Vocab Puzzle 2022-10-05

35 Items: and personal fulfillment.Ideas one regards highly.A defining characteristic.Waiting until the last minute to do something.Person sending the message in verbal communication.Person receiving the message in verbal communication.The body’s natural response to any demand or pressure.Convictions individuals hold, without proof or evidence....

Electronic Vocab Puzzle 2022-10-05

64 Items: vision.people.disease.emotions.medicines.wellbeing.clarification.and adversity.or opposite thing.excreted through urine.and personal fulfillment.functions such as hair growth.and becomes insulin resistant.Values: Ideas one regards highly.Criteria: A defining characteristic.This can cause a heart attack or stroke....