medical Word Searches

wave 0 week 5 morning 2023-12-11

80 Items: louavesnmetninacardfamejhonaangiehippaformssmiledentalmanualmemberlauriemarnieleshonmiriamsnoopyconlancalaimhealthhealthmolarssocialtarnotcountybrailemedicalmichelemelissarichardfortunadentistmanagedacronymwebsiteweekfiveproviderjenniferkimberlysamanthagainwellbenefitsdocumentsealantsreferrascareplansecuritypinkformpersonalspeciatybreakoutresources...

Auto Insurance Word Search 2025-11-05

13 Items: A factor in car insurance ratesA discount for getting good gradesThe amount paid regularly to insuranceA discount for being a long-term customerA discount for having a good driving recordFinancial coverage for damage that you causedFinancial coverage that pays for damage from a crashProtects you from financial loss from accidents with you car...

Modmed 2023-08-29

12 Items: We are thego live dayrides bikeswe work forwhere we playNew EMR systemyour go to personone of the leadersdirector of operationsElectronic medical assistanthow a patient learns about the practicewill help you understand another language

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

ABD categorical relationships/programs 2023-12-12

17 Items: Disabled Child Program (acronym)Medicaid program handled by OHCALong-Term Care Program (acronym)State Supplemental Payment (acronym)Qualified Individuals - Group 1 (acronym)A categorical relationship for the ABD programA categorical eligibility for children with PKUA medical program that provides Medicaid & Buy-in...

Random 2022-11-21

76 Items: popsayfarsadcitywordhomelovehugspostopenwiferockfoodlefthalfhopearmyburnlifereadminehelpcoldprintsmilewitchnoonecloseproudfisrtpizzarightmummycrashdiarysharespicysweetloversrhythmrandomlistentiktokanyonereasonhomiesdrinksbottomcursedsearchfriendsmedicalhauntedhusbandcountryepisodewhisperdiamondtitanicjournalwebsitetwitterraggedyanythingbookworm...

Alcohol Word Search 2024-10-31

13 Items: "The shakes"____ use disorderMedical emergencyBind to GABA receptorsChronic Memory DisorderBlocks opioid receptorsHelps maintain abstinenceCalms autonomic hyperactivityAcute & reversible brain disorderCan be generalized or Tonic-ClonicTypically synonymous with Alcoholics Anonymous____ happens after reducing or quitting alcohol...

Disorders in the Muscle System 2025-07-14

16 Items: (Lack of strength)(Extreme tiredness)(Group of symptoms)(Lou Gehrig's disease)(Long-lasting condition)(Widespread pain disorder)(Medical care for illness)(Body's response to injury)(Muscle weakness condition)(Identification of a disease)(Muscle inflammation disease)(Body attacks its own tissues)(Unpleasant sensory experience)...

Acronyms 2023-11-16

20 Items: benefit Groupchild supportearned incomelong term carebehavior healthdate of serviceAccess to Recoveryfederal match codeAffordable Care ACTfair hearing BureauBureau Indian affairsdepartment of justiceBlue cross blur shieldAutomated teller machineindividual education planProtected health informationmedical assistance department...

Medical Documents & the Mail 2024-05-10

4 Items: To add explanatory notes or comments to a text or documentA definite or clear expression of something in speech or writing.A pre-designed format or layout used as a starting point for creating documents or files.A greeting or expression of goodwill, typically used in the opening of a letter or message.

Events of Discriminatory Medical Practices in History 2025-10-16

7 Items: CellsLatinaTuskegeeIndigenousHenriettaLacksSterilizationsAfrican-American

Inhalants Word Search 2022-10-13

13 Items: Street nameStreet nameMedical nameMedical nameAn effect by inhalantsInhaling from a soaked clothInhalants cause ________ damageproducts An example of inhalantsInhaling directly from the productInhaling from paper or plastic bagProvides local treatment locationsFirst time users might experience thissystem This system of the brain is affected

CannaChallenges 2023-11-27

6 Items: Type of nursing care for individuals using medical marijuanaExamples of these include drowsiness, restlessness, and changes in blood pressureA word to describe a nurse's role in helping patient's suffering from chronic painPrescribing Marijuana for chronic pain will potentially reduce the number of prescriptions of this medicine...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Medicalalertcodeblue Word Search 2024-12-02

12 Items: Smoke or FireA missing childYou found a suspicious packageSecurity assistance needed for a hostage situationExternal Threat requiring all entrances to be lockedSecurity Assistance Needed for a violent patient/visitor/employee with a weaponAny Staff/Visitor “Individual” experiencing any type of medical emergency situation...

KERJAYA 2025-11-04

30 Items: DoulaActuaryShipbrokerProsthetistGeoscientistCIA LinguistFoley ArtistPuppet MasterHippotherapistEthical HackerCourt ReporterData DetectivePiano TechnicianWelding EngineerCity IoT AnalystVoice-Over ArtistWaterslide TesterMedical ScientistCreative CatalystForensic LinguistStunt CoordinatorAirplane RepossessorBlockchain ArchitectAnimal Control Officer...

Where's Waldo? 2019-11-28

88 Items: OCDexamgaitnerveaortawaldobursaocularimmunevisualcortexdistaldorsallumbarkidneyspleenthymuslarynxqualityvertigomedicalsternuminsulinstationurinarybipolarscapulatracheastomachbladderforamenanxietyatrophyventralabdomenthyroidproviderfunctiondeferralevidencemandiblepancreasdiabetesligamentmembraneneoplasmcerebrumauditorymandibleproximalcervical...

PHS Career Clusters 2025-09-03

13 Items: DVMPharmD2 year degreepatient care technicianlicensed athletic traineremergency medical techniciandirect patient care career pathway"therapist" dealing with the lungscareers focused on testing for diagnosisservices that aid a health care facilityall aspects of managing health care agenciescareer pathway that focuses on research and development...

CHILD RIGHTS WORD SEARCH 2024-11-18

8 Items: PARAMOUNTIN DECISIONS THAT AFFECT THEMFORMAL SCHOOLING UP TO SECONDARYFREE FROM PHYSICAL,EMOTIONAL,MENTAL HARMFOR THEIR VOICE AND OPINIONS TO BE ACTIVELYDECISIONS MADE CONSIDERING THEIR INTEREST ASDUTY BEARERS AND CAREGIVERS ENSURING THEIR SAFETYGOOD NUTRION, ACCESSS TO MEDICAL SERVICES INFORMATION

Unveiling the Amazon's Medical Marvels: Antibiotics, Anti-Cancer Treatments, and Natural Therapies1. Amazon 2024-04-12

20 Items: VenomHerbsAmazonMedicineMedicinalEcosystemRainforestPropertiesIndigenousTreatmentsDiscoveriesAntibioticsPainkillersAnti-cancerTraditionalPilocarpineBiodiversityAdvancementsAntimicrobialMicroorganisms

TELECOMMUNICATORS WEEK 2025 2025-04-15

20 Items: PHASE ONEA BAD WORDGO GO JUICESTATION ONEOUR CAPTAINBOOGER SUGARWORK MUSTHAVEI HEAR VOICESFISHBOWL SHIFTGRAVEYARD SHIFTNEED ANOTHER UNITTRIAL BY FIRE SHIFT"I GOT ONE RUNNING"__________ TRAFFIC ONLY______ FIRE AND MEDICALWAIT TO BE ACKNOWLEDGED________ WARRANTS AND SHOW IN CUSTODYMONTH THAT TELECOMMUNICATORS WEEK IS IN...

ASU Well-being Word Search 2025-02-27

8 Items: Humana's well-being program is called?In March, we focus our wellbeing on this.How many VTO hours do full-time associates receive?April will kick-off Humana's largest belonging event, the 100-day....What provides quarterly metrics and updates on Humana's well-being initiatives?...

Medical words 2023-06-20

2 Items: drugdangerous disease

Medical Terminology C. 5 - The Body as a Whole 2024-11-13

10 Items: groinred blood cellblood productionpertaining to the tailpertaining to the extremitiesparalys of one or both eyelidsinflammation of the peritoneumdestruction of red blood cellscancer cells spreading to sites away from where they originatea minute microorganism that replicates only within a cell of a living plant or animal

Ch. 13 Medical Terminology Word Search 2024-01-26

5 Items: red blood cellsabnormally swollen veinsdangerous infection of the blooda drug that prevents clotting of the bloodincreased number of red blood cells in blood

Hating Alison Ashley: Erica's Medical Conditions 2025-11-27

5 Items: CloverRhinitisSinusitisHeadachesHypersensitivity

FIRST AID 2025-06-18

10 Items: USED TO LIT CRACKERS.WE CROSS THE ROAD HERE.APPLY ANTISEPTIC CREAM.A CRACKOR BREAKAGE OF BONE.A VEHICLE FOR MEDICAL EMERGENCY.A DEVICE FOUND IN FIRST AID BOX.IT CAN HAPPEN ANYWHERE AT ANYTIME.IMMEDIATE HELP GIVEN TOAN INJURED PERSON.A PERSON WHO HELPS IN PUTTING OFF THE FIRE.EXTINGUISHER NOT USED TO PUT ELECTRICAL FIRE.

Case study on Charlie 2023-04-30

15 Items: type of formulaloss of body fluidloose watery stoolslab value to monitordifficulty swallowingcomplication from feedingabnormally low body weightcancer Past medical historycaused by not eating enoughfeeding type of tube feedingloss a reduction in body sizecancer treatment that kills cellssomething that you monitor with feeding...

British Military 2025-03-11

100 Items: RAFSASSBSSASArmyNavyTankBaseNATORankRoyalBeretMedalDrillCadetCorpsGuardsGurkhaArmourApacheAstuteHonourParadeSaluteBattleSignalMarinesCavalryBrigadePlatoonCompanyAdmiralCaptainPrivateDragoonMissionTacticsWarfareDefenceArsenalWarriorTyphoonTornadoFrigateCarrierTridentUniformRecruitVeteranOfficerNuclearMedicalInfantryRegimentDivisionSquadronSergeant...

Medieval Europe & The Middle Ages 2024-04-03

21 Items: plaguepitsPeasant: A farmer or poor labourer.Century: A period of one hundred years.Sanitation: Availability of clean water.Medieval: Another name for the Middle AgesSymptom: Evidence a person has an illness.Nobles: Wealthy class in the feudal system.Agrarian: Of farming or cultivation of land.Servitude: To be a slave or subject to someone....

CMS 855S 2025-10-13

45 Items: I Make TIFFSDo Not ForwardStop The ClockDate of ReceiptDoing Business AsStatement of WorkUS Postal ServiceLogging & TrackingWeb Based TrainingLegal Business NameAdverse Legal ActionBusiness Test AnalystChange of InformationCorrective Action PlanCritical Response TeamEnrollment Data ReportSocial Security NumberApplication Data Report...

Comment The First Medical College Which You Spot ❤️ 2025-09-27

9 Items: CMCMAMCAFMCAIIMSSGPGIPGIMERJIPMERIMSBHUNIMHANS

Gratitude 2025-01-19

20 Items: – Heavy walk (6)– Sweet reward (5)– Angry outburst (6)– Funeral lament (5)– French farewell (5)– Extremely angry (5)– Strings on stage (6)– Goal or bullseye (6)– Academic measure (5)– Fumed with anger (5)– Roof edge channel (6)– Weary or worn out (5)– Swollen or pompous (6)– Thanks, deeply felt (9)– Enclosed by barriers (5)...

Tough Word Search 2022-05-24

17 Items: widespreadto overcomebeing aloneextremely tiredto be all arounda win in an eventa medical operationhaving a lot of moneya place such as a cityto try to achieve somethingto repeat or reflect a sounda particular part of the worldvery great in size or quantitystrong or not easily broken or defeateda person who often takes part in sports...

Compliance Week Privacy Word Search Game 2022-10-24

10 Items: HIPAA _______ and security RulesWhat regulation provides protection for health data?In order to properly dispose of paper PHI you must _____ itWhat is the three-letter acronym for protected health information?What word do you put in the subject line to encrypt your confidential emails?...

Paraprofessional Team Building 2022-11-29

14 Items: code for a medical emergency (BLUE)the female external catheter (VERSETTE)common name for the urinary catheter (FOLEY)acronym used to identify signs of a STROKE (BEFAST)the type of bath that is secondary to regular bath (CHG)machine used to help prevent blood clots in a patient's legs (SCD)...

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

Protocol 16-18 Word Search 2024-02-09

16 Items: T=_ hoursBlood in the irisProblem Suffix = JProtocol for FallsProtocol for HeadachesAnother word for BleedingProtocol for Eye ProblemsInfection around the brain_Blow is a Severe Eye InjuryConsidered a small event in dispatchOften called Arc Eye or Welder's FlashMost recognized method in airway control_ lenses are considered a minor eye injury....

Verrucae/Warts 2025-11-24

11 Items: warts can be verythe root cause of wartsalso known as a plantar wartthe medical term for verrucaewarts aren't malignant they'reshould immediately report wartsthis is used to freeze off warts.washing your hands helps with wartthese people are at higher risk for wartsthis type of acid removes one layer at a time...

Open Enrollment 2022-10-03

11 Items: dental plan providerRetirement departmentvision plan provider abbreviationHealth Savings Account Abbreviationoptional benefits like pet insuranceThe new medical plan provider for 2023Flexible Spending Account AbbreviationDiscount provider for wellness discountsWhere you log in to review/change your benefits...

N5-2C12 2025-01-15

32 Items: jobsoonrecallfuturewriterrapidlylifespanmoreovergraduallyto appearrepeatedlyto decreaseto threatento cope withto be chillyto take awayto come truepromising jobcommunicationto get rid ofto live longerto be automatedto be promisingto be mechanizedto substitute formedical specialistto design the futureto predict, forecastto predict the future...

Hospital Words 2025-05-30

99 Items: EMS,ICU,CareMRI,Draw,Care,Dead,Nurseswab,Womb,Cough,COVID,Death,gland,Rehab,CanterWoundeAgency,Biopsy,Center,Clinic,Dental,Doctor,Fester,Health,Doctor,Center,Medico,Office,organs,Trauma,Dentist,Disease,Funeral,Hospice,PharmacyHospitalNursing,Ovaries,Patient,HospitalSurgeon,Surgery,Clinical,Delivery,Dialysis,Doctoral,Hospital,Location,Meconium,...

BoxER 2022-10-26

10 Items: HRA Carly's ext.: 38_0ARA Wilson Park CT: 4_33Quarry Ultrasound 1: 464_NAMC Main ER #: 512-901-60_7Main # for TX Orthopedics: 512-439-100_Seton Hays S.4B sound phone: 512-93_-9660Seton Main Specials Direct #: 512-_09-6901Michelle Markley, MD's cell phone #: 512-_25-1532Sami Aboumatar, MD's office phone #: 512-_39-8831...

Verrucae/ Warts 2025-11-25

11 Items: warts can be verythe root cause of wartsalso known as a plantar wartthe medical term for verrucaeshould immediately report wartsthis is used to freeze off wartswashing your hands helps with wartwarts aren't malignant they're benignthese people are at higher risk for wartsthis acid helps remove warts a layer at a time...

Ben Carson 2025-02-18

11 Items: Dr Benjamin _________A book Ben Carson wrote T_____B___Characteristic of Ben Carson A______ousCharacteristic of Ben Carson A______ive.Characteristic of Ben Carson Cons______usBen Carson went to _______ from 1969-1973Personality trait of Ben Carson Re______fulBen Carson recieved what from President Bush?...

Medical Terminology Vocabulary 2025-11-14

2 Items: Gastricto the stomach

Medical Terminology Vocabulary Chapter 3.4 2025-11-14

3 Items: A cut or surgical woundSkin graft from another person or cadaverThe use of cold in the treatment of a disease

Medical Terminology Vocabulary 2025-11-14

2 Items: Gastricto the stomach

POP QUIZ 7 2025-11-12

14 Items: TBADIYGOATMoMAYOLOFOMOTotally, completely, entirelypersonal identification numberof only average quality, not very good, MIDSELF CONTAINED UNDERWATER BREATHING APPARATUSa sudden, violent gust of wind, often with rain or snowthe scientific study of the Earth's atmosphere and how it causes weather changes...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Clinical Research 2025-06-03

10 Items: Lead researcher at a siteInactive control substanceConcealment of treatment group assignmentAny untoward medical event in a participantQuestionnaire where site records study dataMasterplan that spells out every study procedureFinal variable used to judge a treatment's effectChance method for assigning volunteers to study arms...

PLACES IN THE CITY 2025-05-23

11 Items: where bakers make pastrywhere you go to watch movieswhere we go to get medical carewhere you go to see wild animalswhere you wait for transportationwhere you can drink coffee, tea or eatwhere children and teenagers go to studywhere firefighters work and wait for firesa gallery to see pieces of art and history...

Infection control 2025-02-05

19 Items: harmful microbesa type of microbemicroscopic organismsasepsis kills pathogensgobbles up invading pathogenspersonal protective equipmentorganism transmitted by touchmicrobe that causes flu/covid/HIVmicrobe that causes athlete's footmicrobe that needs a host to surviveasepsis physically removes pathogenssets guidelines for infection control...

The Secrets Behind Extending Human Lifespan: Unveiling Medical, Lifestyle, and Tech AdvancementsHealthcareDiscoveries TreatmentsVaccinesSurgeryNutrition 2024-04-14

10 Items: dietssurgeryhygienevaccinesnutritionhealthcaretreatmentsdiscoveriesinformationtransportation

Vet Science 2024-09-11

19 Items: away from centertowards the headtowards the tailtowards the bellytowards the spineendotoxins in bloodtowards the surfaceaway from the midlinetowards the tip of the nosedecreased blood volume in the bodyanother name for the large intestineheart is beating faster than it shoulda medical term for stomach pain in horses...

Patient Access Week 2025 2025-03-24

131 Items: DHSHPEBellDSNPKeckScanUCLAAetnaCignaMLKCHNobleOptumRegalWattsAnthemHumanaKaiserLaCareMolinaStJohnStJudeStMaryAltamedAngelesChampusDignityElMonteKindredMedicalMonarchSeasideSelfPayTriCareCaremoreCentinalGlendaleLakesideLakewoodLaPuenteMedpointOmnicareProspectStJosephTorranceWellcareAlignmentCaloptimaAppleCareAxminsterBlueCrossCoveredCAHealthnet...

Protocol 19-21 Review 2024-02-21

15 Items: Problem Suffix HProblem Suffix CThis is another name for AEDsAnother name for a Heart AttackPale, Grey, numb, bloodless and coldAn example of Heart Rhythm ComplaintsAn illness or other biological maladyThis is an example of a blood thinnerThis is an example of a bleeding disorderSluggish, decreased level of consciousness...

Chapter 4 Word Search 2023-05-12

20 Items: Fail to care for properlyFree from outside controlFailure to take proper careLack of respect of courtesyMaking false spoken statementsUsing finances inappropriatelyBeing worthy of honor or respectUnacceptable or improper behaviorKeeping something secret or privateActs which do not suit one's statusMoral principles that govern conduct...

Diseases and Disorders of the Skin 2024-10-28

30 Items: persistent itchingover-production of pigmentabnormal growth of the skinredness caused by inflammationcluster of boils caused by staphabnormally thick build-up of cellsflat spot or discoloration on the skindead cells that form over a wound/blemishoccurs when follicles become clogged with oilcontagious infection around the eye; pink eye...

Federal Revenue Vocab 2025-11-07

9 Items: A Tax on their net profitsSpending that is fixed by lawFund Social Security & Medical benefitsProvide the largest share of federal revenueA source on specific goods, services, and activitiesThe total amount owned by nation's government as a result of borrowing...

Cat Word Search 2024-10-30

10 Items: Skin picking disordercauses blackheads due to cloggingan inflammation of the conjunctivageneral term for skin inflammation or irritationskin rash caused by contact with a certain substance.occurs from dried exudate overlying and impaired epidermissac filled with fluid, semi-fluid, or keratin that develops within skin tissue...

Pathophysiology Word Search 2025-02-16

15 Items: damaged tissue.Infestation with liceNon-cancerous skin tumor.Mass of pus in the tissue.Small area of discolored skin.Physical suffering or discomfort.medical term for itching of the skin.Cancer that forms in epithelial tissue.Type of skin cancer that arise from melanocytes.Also called fungal infections diseases caused by a fungus....

Joint Commission Readiness Word Search 1 2023-12-14

13 Items: You can find policies on __ ___.A code black is called for a ___.Informed consent is obtained by the ____.If a patient is suicidal you call a ____.The SDS for any chemical is found in ___.Glucometer test strips are good for ___ ___.What is the wet kill time for purple top wipes?How long do you have to report critical results?...

WORLD HAND HYGIENE DAY 2025 2025-05-02

17 Items: HandHygieneThe step after scrubbing handsThe final step in hand hygieneRecommended time for hand scrubbingMicroorganisms that can cause diseaseThe result of germs entering the bodyThe central part of the hand to scrubA goal of proper hand hygiene practicesMust be cleaned to prevent germ buildupA part of the hand often missed when rubbing...

DISCOMBOBULATED 2024-10-25

150 Items: BIDSBLOBDIALDOSELAMELEADLITELOSTMASTMEATMELTMESAMILDMOLDMOODOBOESEALSEAMTOILTOMEACUTEALTOSEMAILEMITSMOUSESABLESCOOTSCOUTSIDEDABDUCTADMITSALBEITAMBLEDBABIESBAILEDBAMBOOBLAMEDBLOUSEBOILEDCALMEDCAMELSCAMEOSCLAIMSCLAUSECLEATSCLOSEDCLOSETCOBALTCOMBATDEBITSDEDUCTDUTIESHOUSEDIDEALSLOCATEMEDALSMIDDLEODIOUSSALTEDSELDOMTUMBLEAMOEBICAUDIBLEBADDESTBAUBLES...

What's Sup? 2025-01-12

10 Items: The __process begins in Medicare SalesforceAgents do not save or __the application for Medicare SupplementMost Medicare beneficiaries__ get Part A and Part B upon turning 65Members should sign up for Medicare when first eligible to avoid late enrollment__...

Firstaid Word Search 2025-04-17

18 Items: - Heavy, uncontrollable bleeding- The sudden stoppage of the heart- Damp, soft, sticky, and unusually cool- A snug bandage used to control bleeding- ointment and bandages applied to the wound- A reduction of blood flow to a part of the brain- Approval for what is to be done or proposed by another...

Occupations and Professions 2025-04-14

10 Items: LITERARY : Related to literature or writing.TEACHER : A person who educates and instructs students.BOTANIST : A scientist who studies plants and plant life.ARCHITECT : A person who designs buildings and structures.HISTORIAN : A person who studies and writes about history.PHYSICIAN : A medical doctor who treats illnesses and injuries....

POSTIES 0331 COVER 2025-02-20

6 Items: a doctor who studies and treats the diseases of childrenAchondroplasia is a condition that affects how ____ grow.People with dwarfism are often referred to as "_____ people".a sloping surface that joins two places that are at different heightsa physical condition that makes it difficult for somebody to do some things that most other people can do...

WARD ROTATIONS 2025-11-02

15 Items: – the patient’s medical record.– evaluating a patient’s condition.dressing – cleaning and covering a wound.– drugs or treatments prescribed to a patient.– the area immediately around a patient’s bed.– when a patient is released from the hospital.– patient’s permission for treatment or procedure....

Chapter 16 - Key Terms 2023-11-01

29 Items: A legally enforceable agreement.The cost of the coverage provided by an insurance policy.Payment by the insurer or by the patient of more than the amount due.A person designated by an insurance policy to receive benefits or funds.The determination of the exact coverage to which the insured is entitled....

Chapter 9 2025-11-18

10 Items: request for paymentproduct offered by an insuranceperson financially responsible for paying a medical billfederal health insurance program for people 65 and olderpayments for office visits, diagnostic procedures, and other expensescompanies that specialize in submitting claims to insurance companies...

health and safety 2023-02-27

15 Items: warm cover on a bedvery quickly, without waitingtaking air in and out of your bodysheets,covers.that you put on a bedto cover something with cloth or paperthe possibility of being hurt or killedto leave a place because it is not safepeople who come to help you very quicklydoing something when someone talks to you...

Skills Unit 5 Ch 31 Urinary Elimination and Care 2025-07-15

14 Items: Kidney stones.A medical term for urinate.Painful or difficult urination.The absence of urinary production.Urine eliminated by an alternative route.Urinary output of less than 30 mL per hour.Waking up often during the night to urinate.Urinary output greater than 3000 mL per day.Either visible or microscopic blood in the urine....

World Safety Month Word Search 2 2024-04-08

20 Items: I wear my _____I _____ the joblikelihood x consequenceI follow my lifting _____I _____ myself against fallsabsolute way of life at TerexI _____ myself in a safe zonethe most effective hazard controlset of behaviors that prevent SIFsthe least effective hazard controlthink _____, work _____, home _____set of behaviors that prevent common injuries...

Getting Paid 2024-04-29

20 Items: A tax on earned and unearned income.Outlines the deductions made to wages.Agreement between an employer and employee.The regular schedule that employers pay employees.A person who relies on someone else for financial support.A check written to a worker in the amount of money earned.A fee that a salesperson receives upon completion of a sale....

Public Health Literacy Word Search Puzzle 2025-03-25

25 Items: Actions taken to avoid the onset or spread of disease.An epidemic that spreads across countries or continents.A state of complete physical, mental, and social well-being.The process of being admitted to a hospital for medical care.The body’s ability to resist disease-causing organisms or toxins....

Cysticfibrosis Word Search 2025-10-17

20 Items: What is a truffle?What is Stella's sister's nameWho has a code blue emergency?Where was Stella's senior trip?What is Will's favorite activity?What happened to Stella's G-Tube?Where does Stella post her videos?What is Stella's best friend's name?What does Stella eat her pills with?What does Will like to draw the most?...

CPR 2025-02-22

10 Items: The organ that pumps blood through your body.Saving someone from danger or a bad situation.When someone does not react or cannot be awakened.A method used to help someone when their heart stops.Pushing down on the chest to keep blood moving during CPR.What you do to reach emergency services when someone needs help....

Identifying Abuse 2025-04-01

10 Items: excessive or unjustified use of a drug.reducing the risk of future harm for DV patients.type of violence that patients above the age of 65.signs of bruising, cutes, burn marks, and swelling.failing to provide adequate care or support to a individual.identifying signs of abuse in patients upon initial encounter....

cardiac 2025-06-22

16 Items: High blood pressureMass of blood that can block vesselsMovement of blood throughout the bodySmall tube used to keep an artery openMedical specialty that focuses on the heartBulge in a blood vessel wall that can burstLower chamber of the heart that pumps bloodUpper chamber of the heart that receives blood...

Chronic Illness and Acquired Disability: Quality of Life 2025-11-26

11 Items: MSK chronic conditionMental health chronic conditionResponding adaptively to chronic disabilityLoss of this can involve a grieving process and adjustmentsWhat a patient might set themselves as part of their recoveryWho else is involved in improving their quality of life (inits.)(Something), psychological and social functioning needs to be addressed...

Dental Acronyms 2023-12-15

35 Items: - claim- Billing- Application- Beneficiary- claims payment- Claim inquiry form- Accounts Receivable- Claims Billed Amount- California Civil Code- Change Control Number- Claim inquiry response- Computer Based Training- Adjudication Reason Code- Corrective Action Request- Current Dental Technology- Beneficiary Correspondence...

Mid-term vocabulary wordsearch 2025-01-28

20 Items: Stay fit and healthyAffected with a diseaseTo stop doing somethingA plan to improve yourselfTo continue doing somethingWell-known for something badGive medical care to someoneGet well again after being illA lack of equality or similarityTo fix a problem or find a solutionExtend over a large, increasing areaTo start something for the first time...

New Mexico Wellness Rio Rancho 2024-12-16

13 Items: airborne virusthe acronym for our facilitywho will arrive on December 25worn to protect against airborne virusesMedical Opiod Assisted Treatment acronymhow many days a week is our facility opentesting we perform to detect drugs and metabolitesHealth Insurance Portability and Accountability Act...

Medical paractitioners 2023-05-26

1 Item: - angiologist - arborist - audiologist - biochemist - chemist - chiropodist - craft paper - dermatologist - domain expertise - educationist - Egyptologist - endocrinologist - entomologist - epidemiologist - Es - ethicist - expert - expertise - geneticist

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Donation Word Search 2024-10-16

161 Items: EXAMNDDRCDCSDAERFLOWWRAPKITSGEARDONORBLOODEVENTTRENDVIRALCODESLABELWASTECYCLESETUPSERUMAUDITLUNGSCHESTHEARTRANGERATIOUNITSALERTRISKSCENTERCHECKSDEVICEWEIGHTFROZENERRORSORPHANETHICSMANUALSALINESHARPSRETURNFLUIDSBOTTLECHARTSGRAPHSVITALSPORTALDOCTORLITERSSAFETYADDRESSREVIEWSNEXLYNKPROGRAMQUALITYTESTINGSAMPLESADVERSERESULTSPROTEINRESTICKRBCLOSSMACHINE...

Health Insurance 2024-04-17

6 Items: The healthcare items or services covered by a health plan.A legal agreement between two parties; the insurer and the insured.Legal entitlement to payment or reimbursement for your health care costs.The amount you pay for covered health care services before your insurance pays its share....

MEDICAL TERMINOLOGY 2022-12-29

1 Item: ABRASION, ACUTE, ANAPHYLACTIC, ARREST, ASTHMA, CARDIAC, CASUALTY, CHRONIC, CONSCIOUSNESS, DEFIBRILLATOR, EMERGENCY, HEMORRHAGE, HIVES, HYPERTENSION, LACERATION, MIGRAINE, MYOCARDIAL, OVERDOSE, PREGNANCY, PRESSURE, PULSE, STROKE, TRAUMA, VENTRICULAR

Posties Dec 18 - Big Read 2023-11-24

6 Items: another word for "rubbish"knives, forks and spoons, used for eating and serving foodable to be decomposed by bacteria, so that it doesn't pollute the environmentto be unable to breathe because the passage to one's lungs is blocked by somethinga sea creature with a body like jelly and long thin parts called tentacles that can give a sharp sting...

Health Insurance 2024-04-16

7 Items: The conditions for which the insurance company will payThe Payment of benefits for covered sickness or injury.The Health care items or services covered by a health planA legal agreement between two parties; the insurer and the insured.What you pay annually for health services before your insurance company pays its share....

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

VR - Chapters 6-8, 12, and 20 2025-09-21

22 Items: symptom of stresssymptom of stressagainst medical adviceexample of folk healingliteral meaning of wordslearn by touching and doingperiods of worsening symptomsshows concern and willingness to helplearn by seeing, reading, and watchingcommunication by the conscious use of wordsreflects the same words back to the patient...

8th-Ethics Committees 2024-11-13

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Safety and Injury Prevention 2025-04-01

15 Items: What number should you call in an emergency?What should you do if someone is having a stroke?Which organization provides first aid certification?What type of website domain is usually more credible?What procedure is used to help someone who is choking?What is the process of evaluating risks before acting?...

Cycle 1 S2 Week 1 2025-01-15

5 Items: A list of numbers or objects in a special order.The use of statistics to determine the probability that a given hypothesis is trueA restatement of a text or passage giving the meaning in another form, as for clearness; rewordingUS History: The withdrawal from the Union of 11 Southern states in the period 1860-61, which brought on the Civil War....