maker a day Word Searches

Patcham Science Department 2023-03-24

11 Items: dayhallmezeibakeregnerromijnhowardclaytonmcdowellgoodsellthompsonheath

NATURE (NATUREZA) 2025-09-01

11 Items: DAYSUNSKYSEAMOONRAINSTARTREENIGHTCLOUDBEACH

High Frequency Word Search 2025-11-03

11 Items: anddaynottwoforseethisthatwhatlookwhich

Billion Word Search 2025-11-26

11 Items: DAYSKYHEATMOONSTARLIGHTNIGHTDURINGBILLIONGIVEOFFCONSTELLATION

BeHorseSavvy Search 2025-08-05

16 Items: Where horses livePhysical activity for horsesHorses spending time togetherThe hard part of a horse’s footHeadgear used to control a horseWhen horses eat grass in a fieldAn animal healthcare professionalDried grass commonly fed to horsesThe physical well-being of a horseEquipment used when riding a horseA blanket used to keep horses warm...

christian-8th grade 2024-05-15

15 Items: temperature at which a solid meltshappens between metal and notmetaltemperature at which a gas condensestemperature at which a liquid freezes2 elements are sharing valence electronschange from a solid state to a liquid statechange from a gaseous state to liquid statechanging from a liquid state to a solid state...

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Santa Word Search 2025-12-04

20 Items: Another Christmas colorA sweet treat for SantaWhat Santa checks twiceThe man who brings giftsA bright Christmas colorA person made out of snowSomething you give someoneA ribbon tied on a presentWhat makes the tree sparkleSomething you wear to keep warmWhite flakes that fall in winterThe decorated Christmas evergreenSomething you ride on in the snow...

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Be curious 6 unit 2 vocab 2025-11-24

18 Items: to send an SMSlike whatsapp etc.electronic lettersa synonym for pressto "start" a deviceto "close" a devicethe code for a computeryou use this to type wordsto put a program on your deviceto put something on the internetto take something from the internetlike a computer you can carry with youa device you can use to make calls or text...

First Day of School 2025-08-12

16 Items: daybusstudylunchbooksschoollockerAugusthallwayreadingteacherhistorywritinghomeworkbackpackprincipal

General Knowledge 2023-09-08

33 Items: A group of islands.The genetic code of life.The study of celestial objects.A ruler, often a king or queen.The study of heredity and genes.The study of ancient life forms.A cloud of gas and dust in space.The variety of life forms on Earth.A cultural revival and rebirth of art.A dramatic change in form or appearance....

Planet Earth In Space 2020-12-04

11 Items: sundaymoonstarsnightsolargasessystemorbitssunsetsunrise

Creation of the Earth and heavens word search 2025-04-07

11 Items: GodDayAdamEarthNightHeavenGenesisAnimalsCreationOldTestamentGardenofEden

JZCA BDAY GAME 1: IN THE BEGINNING 2025-05-18

11 Items: IGodDayEarthLightNightHeavenWatersCreatedDarknessBeginning

Creation 2025-12-13

11 Items: dayGodloveearthexactnightdesignamazingprecisecreationperfectly

CVCSS Word Search 2022-07-22

20 Items: HabcluballycedarvalleyRapidscopinghealthcoffeesupportempowerempathyserviceswaterlooadvocatewellnessinvitingcommunityinclusiverelaxation

Bunk zayin week 3 2024-07-11

19 Items: pandayshiurrallybuseschallahachisarcadeslurpeeunitydayswimmingcheeringdesertlandoppositedaysevenelevencamppictureshabbospartymoshiachfairrollerskating

Field Day 2025-06-05

19 Items: DayFunRaceWaterCheerGamesRelaysFriendsRunningAthleteCompeteStationsSunshineTeamworkMemoriesThrowingEncourageClassmatesSportsmanship

1 Corinthians 2014-06-14

12 Items: daydiedsinsthirdpassedChristburiedraisedReceivedaccordingscriptureimportance

Valentine's Day 2022-02-14

12 Items: DayjoyloveSaintcandycardsheartscaringkindnessmemoriesValentinesfriendship

Happy Word Search 2023-09-05

12 Items: daybaikcutehappycewekgalakbocahdancelegalketjehcantikbontot

God Word Search 2023-10-18

12 Items: goddaywindbeganearthchaoslightnightcreatewatersheavensdarkness

Kiersten's Word Search 2024-02-28

12 Items: daywaygraymailplayrainawaychainsnailfrailfeatureappearance

IDI week 2 2025-04-09

12 Items: dayhaysaywailnaildrainstrayplainpaintsprainsleighfrieght

Cake Word Search 2025-06-19

12 Items: dayevecaketreecardpartycarolspiritlightspuddingpresentstocking

Cake Word Search 2025-06-19

12 Items: dayevecaketreecardpartycarolspiritlightspuddingpresentstocking

sdfadsf 2025-08-04

12 Items: dayeggjamyuzunightpastahighlylikelymatchaavocadogranolaespresso

back to school 2025-08-08

12 Items: TOMRMYDAYBACKTEAMLOVEFIRSTLOPEZCLASSSCHOOLENERGY

123 2025-08-30

12 Items: dayhuglovekisskindbestgifthappythanksmilefamilygrandparent

Logan's Word Search 2025-09-22

12 Items: daysayrainpaidhailmadecametaketapeplaychainsnake

Logan's Word Search 2025-09-23

12 Items: daysayrainpaidnailmadecametaketapeplaychainsnake

Day Word Search 2025-10-07

12 Items: todaywayhayyouplaypraygraystayclayspraystray

Spelling list 2025-11-09

12 Items: todaywayhayyouplaypraygraystayclayspraystray

Unit 4 Review 2025-11-12

12 Items: baydaysayhaypaymayrainsailnailmailtailwait

Sunshine In A Bowl 2025-12-01

12 Items: sunskydaycloudnightearlysummerbananabrightrainbowcinamonmorning

SPACE 2025-10-08

20 Items: DAYTILTMOONSPACENIGHTORBITSYSTEMGALAXYSEASONSECLIPSEEQUINOXEQUATORROTATIONROTATIONSOLSTICESATELLITESPHERICALASTRONOMYREVOLUTIONHEMISPHERE

Pulmonary Embolism (PE) 2025-05-08

15 Items: A modifiable risk factor for PE.A symptom of a PE in which the heart is racing.A habit that is a modifiable risk factor for PE.A person may experience this feeling when having a PE.A patient with a PE may experience a ___ blood pressure.The new MAMC Team that assists with PE (Call 253-968-6666)...

Eternal God - Psalm 90:1-2, 4 2023-06-18

14 Items: onedaylordyearsearthworldplacebeforeforevereternalthousandmountainseverlastinggenerations

KG's Christmas Word Search 2022-12-18

11 Items: Where Jesus was bornThe number of wise menPole Where Santa LivesFood eaten at ChristmasA jaggy Christmas plantSend these at ChristmasThe day before ChristmasUsed to decorate the treeUse a carrot for his noseYou pull this at ChristmasThis is hung up by the fireplace

Seqta orientation 2019-01-31

14 Items: OcrZipdayDDR2KbpsZeroUserIMAPOutputDeviceBitmapexploitinterfaceActive-matrix

English 2024-05-02

14 Items: ofdaythetacodeadbackspicymexicocomingburritotequilaenchiladarelativesbutterflies

CRM 3.3 2024-04-05

12 Items: a fallacy that is used to distract from a key issuea fallacy that oversimplifies and misrepresents an argumenta fallacy that uses the popularity of an idea to persuade othersa fallacy that uses a chain of events to result in an extreme outcomea fallacy that uses the conclusion as a premise for proving the argument...

Latin Halloween 2024-10-29

17 Items: a moonOctobera treatcostumea graveof nightpumpkinsof a ghost(in) blood(in) autumnspirits (nom)of the wolvesI had trickeda ghoul (acc)they terrifiedcauldrons (acc)he was laughing

a 2024-11-29

14 Items: foyerrochesseismemanteauruptureRichterMercalliepicentremagnitudevolcaniquesismologietectoniquessismographeartificielle

🌸Bathukamma Special Word Search 🌸 2024-09-30

10 Items: A simple, lentil-based dish loved during festive timeGoddess worshipped during the festival for prosperity and well-beingAnother name for marigold, a vibrant flower essential to the festivalA significant day following Bathukamma, symbolizing the victory of good over evil...

World War II 2024-12-15

19 Items: WarAxisArmyNavyTankD-DayPeaceAlliesSoldierVictoryTheBlitzBlackoutAirForceAnneFrankRationingEvacuationAdolfHitlerAirraidshelterWinstonChurchill

Find the HEAT 2025-03-21

19 Items: daytimegladheargreatrelaxhappyactionhelpfulhearingornamentquestionattentionempathizeapologizethoughtfulfrustrationinformationdisappointing

Escape from Mr. Lemoncello's Library Vocabulary 2025-03-17

55 Items: oldequalto rushforbiddenpunishmentmysteriousto figure outto take turnsto throw awayto crash intorefuse to obeyA central roomjudge's hammerto think aboutto leave behindno longer in useto steer or directa noisy disturbanceto pronounce clearlyvery great in degreethe study of animalsA secure room; a safeto settle differenceselegant and fashionable...

A Day at the Museum 2025-11-20

10 Items: humanmuseumpeopleunearthhistoryancientcultureartifactlearningdiscover

Motivational Interviewing Word Search 2024-12-24

18 Items: Done with a purposeA form of drawing out information.Showing that you are doing something together.The second letter of PACE in the spirit of MI.Seeing a situation through another's point of view.The last letter of DARN that shows a ______ to change.The first letter of DARN that shows a ______ to change....

6C 2024-04-17

22 Items: kylelilyellenstevecollinjulianoliviasuyoungryanjangryanyoonused as moneya swinging beda kind of rock"start to now""how much time"used for diggingused to unlock thingsused to cover a damaged eyeused to see things far awaycan be filled with valuable itemsa tree that grows in hot countriesa empty space in a object's surface

Word Search 2 2013-12-18

20 Items: CzarDasaCasteD-DayBrahmaCreoleDaimyoDeistaDespotBushidoCalpullCitadelChariotColdWarCavalierChinampasCuneiformDeathrateDemokrasyaCreationist

Presidents Day  2021-02-16

21 Items: DayRedJoeFlagBlueWhiteTrumpHarisEagleStarsPeopleGeorgeDonaldBiddenCamilaAbrahamLincolnAmericanCardinalPresidentsWashington

FIND WORD 2022-03-09

21 Items: daytimeWentDownlivehousehappyneveraftersummerfamilylookedfollowBehindbrotherflowersCuriousbeautifulsurprisedgrandfatherbutterflies

April word search - difficult level  2022-04-27

23 Items: DAYDAYDAYRAMPEABULLARIESAPRILARBORDAISYEARTHSWEETTAXESFOOLS’EASTERFOURTHSPRINGTAURUSDIAMONDRAMADANSHOWERSBASEBALLPASSOVER

Grumpy Monkey 2022-11-01

21 Items: daynapwalktruesongsweetlemursnakeswingstompbrightraisedgrumpystrollsplashbananashunchedtrippedconfusedeyebrowswonderful

EARTH DAY 🌿 2024-04-23

21 Items: airbindayoilbagscoaldirtdumpwatereartherodetreesgrassmetalozonefaucetnatureoxygenecosystemcarbondioxidebiodegradable

Creation Word Search 2025-05-10

21 Items: GodDaySunSeaManMoonLandGoodRestLightEarthNightStarsImageHeavenWatersPlantsAnimalsCreationDarknessLikeness

5H 2025-05-13

21 Items: daykalizachnoahmikoavenjackerrorsadiejesseloganlucasmorganrachelelijahmaryjolilliemelanieaddysonroslynnkhaleesi

Mothers Day 2025-05-16

21 Items: DayMomYouHugEricRyanBestLoveKissCardJesseChampTexasMothersSluggerFlowersFloridaSeafoodAtlanticCelebratePeptobismo

DAILY PUZZLE 7.4.25 INDEPENDENCE DAY 2025-07-03

21 Items: sixdayhotJulypooldogsfourthUnitedStatesfamilyseventycookoutfriendsbeachesbarbecuegrillingoutdoorsseventeenfireworkscelebrationindependence

SS and Christmas 2025-12-17

27 Items: African holidaygiven to naughty kids____ branch creates lawspopular Christmas balletlack of government systempopular eggy festive drinkname of the third reindeername of an electoral districtgrouchy green Christmas charactergiven on the 5th day of Christmasname of the current Prime MinisterAppointed by the PM with portfolios...

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

times and dates 2021-11-08

22 Items: oninatdaydayhalfhourJulythirdSundayMondaysummerspringseasono'clockquarterminutesJanuaryweekendmother'sbirthdayindependence

Bay Word Search 2023-03-23

21 Items: baydayhayjaylaymaypayraysaywayyayclaygrayfrayawaystayplayokaypraytraytoday

Time 2023-10-11

21 Items: dayeralatepastweekalarmearlytodaydecadefuturesecondpresentsunriseweekendcalendardurationstopwatchtimeframeyesterdaychronologynanosecond

Months and seasons 2024-03-12

21 Items: maydayjunejulyfallyearweekmarchaprilmonthaugustspringsummerwinterjanuaryoctoberfebruarynovemberdecemberbirthdayseptember

ai 2024-04-03

21 Items: baydayhaymaypaywaymaidpaidmailhailsailjailplaybrainamberjoycehenryethanstellakelvinminnie

Love Word Search 2025-02-06

20 Items: RedBowDayLovePinkBearRCSASTEMHeartArrowCandyRomanceFlowersKindnessFebruaryBromanceAffectionSoulmatesGalentinesValentines

Dan's Lost Hat 2 2025-05-15

21 Items: hatbedmatdaybadsadlostfindthatnewsunderlooksshelfchairfoundflyingfridgecannotaroundfeelingeverywhere

Prayer Word Search 2025-05-19

21 Items: DAYACTHELPBESTKINDLOVEHANDMESSTRASHHEARTTODAYEARTHWORDSSHINEWORLDPRAYERPOLITEREGRETBETTERPARENTHOMEWORK

Luca word search find 2025-08-05

20 Items: meThedayizmcampgagatripfirstthosecabinLucasAlfieTankaJesseHarisBenjiAshleyfactoryarcherychocolate

Spelling List October 7th 2025-10-07

21 Items: gotdaygoesjusthomelotsfromwantsuretakewhatneatbeatwordfoundthrewskilllearnthrowmaybesecret

Australian Dietary Guidelines - Eating Healthy! 2025-10-23

21 Items: daygrowfoodtimefatsrulesdairywaterenergygroupsgrainsweightsportstreatsvarietymusclesmineralsproteinshydratedpossibleunhealthy

Red Words 2025-11-18

21 Items: USEDAYEYESAWOURALSOYOURWEREBOTHOVENDOESPARKSOMEGOODTODAYWHICHAGAINCOULDWOULDSHOULDYESTERDAY

Vowel Diagraph 2014-03-21

10 Items: dayraintailnailplaytraypraychaintraincrayon

Meg's magical day @ Rotto 2017-11-04

10 Items: MegdayBubutandemschookquokkamagicaldolphinplatypussandwich

PGA Winners Part 1 2019-01-26

10 Items: DayYangKoepkaThomasWalkerDufnerKaymerMcIlroyBradleyHarrington

Like Word Search 2023-03-28

10 Items: daylikefoodyeardonotspellcolorsportmonthtvprogram

Words With Y 2023-08-11

10 Items: daykeywaycryflysayawaymakeplaymaid

Unit1 Part2 2024-05-03

10 Items: dayseecookswimreadstudyeveryspeaklittlecannot

16. time 2024-05-04

10 Items: dayhouryearclocktimersecondminutesundialcalendarstopwatch

Wordsearch Week 8 2024-05-17

10 Items: daymaywayclayplaypraytrayrakewakegave

ARABIC LANGUAGE DAY 2024-12-23

10 Items: DAYPENBOOKWORDARABICSCHOOLLETTERTEACHERSTUDENTLANGUAGE

100th Day Celebration Theme 2024-12-25

10 Items: fundayhatshappycheercounthundredballoonscupcakescelebrate

NATIONAL BOBBLEHEAD DAY 2025-01-02

10 Items: FUNDAYDATEEVENTPARTYFAMILYICONICTRADITIONANNIVERSARYCELEBRATION

AUSTRALIA DAY 2025-01-23

10 Items: DAYBBQFLAGPARTYKOALABEACHPARADESYDNEYKANGAROOAUSTRALIA

Ethnic Studies 2025-01-27

10 Items: DayWordFirstRulesEthnicSpringSearchStudiesSemesterExpectations

Ethnic Studies 2025-01-29

10 Items: ArtDayOneSongLyricEthnicPosterStudiesProjectActivism

Ethnic Studies 2025-02-04

10 Items: DayLyricThreeDraftTodayEthnicFinishPencilStudiesProject

Ethnic Studies 2025-04-02

10 Items: OneDayTwoPagerEthnicSchoolStudiesProjectPovertyRedlining

Mothers Day 2025-04-02

10 Items: MomDayDadSonGiftMommyMotherFlowerJewelryDaughter

Sun Word Search 2025-04-22

10 Items: sundaymoonaxistiltearthnightseasonrotationrevolution

SE2.3 U13-U14 2025-05-12

10 Items: dayWorkfullfoodalikenightshareinsectdifferentgrasshopper

FLAG DAY 2025-06-09

10 Items: DAYUSAREDFLAGBLUESTARSWHITEPROUDHONORSTRIPES

Opposites 2025-07-07

10 Items: UpHotBigDayColdFastSlowDownSmallNight

Phone Word Search 2025-07-16

10 Items: daysaylayphewplayclayphonephotophasegraph

2 Peter 3:1-13 2025-07-26

10 Items: daynewfireLordwaitwaterPeterheavenpatientpromise