maker a day Word Searches

DAILY PUZZLE 2.2.25 GROUNDHOG DAY 2025-01-31

16 Items: daysixPhilfilmBilltimeloopweekswinterspringMurrayweathergroundhogpredictionPennsylvaniaPunxsutawney

Woodshop Vocab Word search 2025-11-24

25 Items: part of an inchA long guide on a toolProtected by a third wireHow accurate we want to beChange from one system to anotherthe large flat surface of many toolsA hand held tool that can cut curvesThe smooth round part of a drill bitThe ratio between real life and paperSitting around in class doing nothingPart of a tool that holds a drill bit...

The Creation Stories 2025-04-14

8 Items: ____ and EveThe ______ EThe GeneratorThe destroyerOn which day did god restThe big bang was 13.7 _______ Years agoGoing from a group of cells to a speciesThe Creator of the universe in Abrahamic religions

Lit Term and Figurative language Review 2023-01-03

36 Items: dialoguecredibilitymain characterA play on wordsAppeal to logicAppeal to emotionRepetition of a vowel soundsthe giving of human qualitieseffective writing or speakingrepetition of consonant soundsfancy term for personificationcomparison not using like or asexaggerated statements or claimsA comparison using "like" or "as"...

Ten Word Search 2022-09-30

17 Items: tenreddaypetfishbookeyesbluewordlookshoesjeanspencilfamilychoosescotlandpassport

Weekly Spelling Word search 2023-01-23

17 Items: dayflynewthatwhatunderthankfoundweeklymyselfinsidealwayspleasetrustedproblemcampfireblooming

Lift Every Voice and Sing 2024-02-25

17 Items: seawonsundayliftsonghopeearthskiesmarchfaithvoiceheavenvictorylibertyharmoniesrejoicing

Trumpets 2024-03-27

17 Items: wardaylordzionfireedenarmyturnswordhearttrumpetpriestsrestoremountainsanctifyjerusalemearthquake

Stiff Word Search 2025-02-05

17 Items: dogdaygetcatduckbornstarstiffguesssevenjeanslindybreakinlovecharmsstreakhappygo

Focus Words - T2 Week 8 2025-06-15

17 Items: paydaywayatestaycamegavetakerainmailmainawaybabytrainpaintawakeholiday

Week 4 2025-10-31

17 Items: daysaywaylayraintailpailpainplaytraytraindraintrailSpainsnailspraytoday

Fable Word Search 2024-12-20

14 Items: A public square or open space in a city.A hard, shiny, gray metal used in alloys.A small baked good, often eaten with tea.A fleshy, spore-producing body of a fungus.A reflected sound that returns to the listener.A warm bed covering made of layers of fabric sewn together.A vehicle that runs on tracks and is powered by electricity....

Tree Word Search 2023-04-20

15 Items: cardaytreekindboatdollfoodgamebikehappyplanefriendweatherbeautifulfavourite

Atomic Search 2023-06-29

15 Items: dayredjulyblueflagwhitefourthunitedpicnicamericasparklerfireworkspatrioticfirecrackerindependence

Atomic Search 2023-07-03

15 Items: dayredjulyblueflaggrillwhitestarsfourthpicnicamericasparklerfireworkspatrioticindependence

1-100 2023-11-28

15 Items: manwaydayusetimeyearlifeworkbackthingwomanchildworldpeopleschool

33 2024-01-27

15 Items: jardayratnotehandrestunitrouteframetigerkittygroundpopcorncrackeropinion

Cruise: Day 10 2024-06-01

15 Items: daydonelasthomelovespainpetitjeanieverdotfamilybalconypicturesbarcelonaadventuresnuggling

Current Events 11-5-24 2024-11-05

15 Items: DayRaceOathTrumpHarrisSenateBattleGroundStatesOfficeJanuaryElectionDemocratPresidentRepublican

IS Word Search 2025-05-01

15 Items: DayBeeRainMailPlayStayTrayGrayTreeFeetSnailPaintChainGreenSheep

Time & Calendar 2025-06-18

15 Items: DayHourWeekYearLeapMonthClockWatchSecondMinuteDecadeSeasonCenturyCalendarSchedule

Opposites 2025-06-18

15 Items: UpInHotBigOutDayColdFastSlowDownLeftSmallRightNightEmpty

Spelling Week 10 2025-07-01

15 Items: daymaypaylaywaysayawaygrayplaystaysaidwereheretherethese

Psalms 2025-08-25

15 Items: goddayLordwombevilpowerlightnightmotherenemiesthoughtspresencedarknessfearfullywonderfully

Week 3 2025-08-25

15 Items: DayDidGetMayNewFindLongDownComeMadePartOverTakeOnlySound

Opposites Game 2025-09-14

15 Items: upinhotbigsadoutdaycolddownfastslowleftsmallhappynight

Days of the Week 2025-09-14

15 Items: dayweektodaynightmondayfridaysundaytuesdaymorningeveningthursdaysaturdaytomorrowwednesdayyesterday

Sean is great 2025-10-15

15 Items: byebuyabc123idkthedaygreatremindbelongsuckerproductproducemultiplyaaaahhhh

golden hour 2025-11-04

15 Items: daynewcalmdawncolornightendinggoldennaturesunsethorizonsunrisetwilightbeautifulbeginning

St andrews day 2025-12-09

15 Items: DayLambFishFoodJesusSaintPartyAndrewThirtyNationSingersNovemberScotlandTraditionCelebration

Movies 2025-11-12

12 Items: ABBA songs and Greek islandsA classic love story in MoroccoA humble boxer becomes a championA giant shark attacks a beach townA smart little girl with magical powersA Roman fighter seeks revenge in the ColosseumA magic carpet, a lamp and a genie in the desertA romantic story between a living woman and a ghost...

Spanish 6A 2024-10-16

22 Items: rugbedlampwalluglysamebluelargesmallgreenmirrorprettybedroomcurtainspaintingimportanttelevision setown, one's owncloset, wardrobeshelf, bookshelfclock(alarm clock)night table, end table

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

my your his her 2024-03-18

24 Items: my/bagyour/penher/chairshe/has...he/has/a..i/have/a...his/notebookit's/my/robot.it's/his/crayon.she/has/a/skirt.this/is/his/kite.we/have/two/eyes.what/do/you/have?you/have/a/marker.it/has/a/red/bell.what/does/he/have?it's/my/pencilcase.this/is/your/ruler.what/does/she/have?he/has/a/skateboard.this/is/her/umbrella.it's/your/teddy/bear....

HFW 2025-09-23

56 Items: aIamathetowemyupdoofhadseethewasandforoneshearebuytooyououreatwhohowoutputdayflygoodmadelikethisfindjustmanythensaidwilllivewhatwithyourmakelooktheyhavefirstwritewantsabouttakeseverylittle

Tiktok Word Search 2025-07-21

13 Items: A famous personWords of a songLives in HollywoodOne part of seriesA group of musiciansA collection of songsLive musical performanceSocial media with short videosA device for watching televisionA musical instrument with keyboardA group of people who watch a performanceThe scenery created for a scene in a film...

Stephen ministry 2025-09-16

28 Items: Provide ______ supportTake the ________ seriously.Remain ______ on the process.______ with the CR, as appropriate.Or continued ________ and instability.Be _______, consistent and dependable.Help the CR to ______ in the crucible.Begin by _______ care as soon as possible.A state of crisis is referred as a _________....

Consider Word Search 2022-08-02

20 Items: onenotonedayuntolovegoodsomeworksmanneranotherprovokeanotherconsidertogetherforsakingourselvesexhortingassemblingapproaching

Big Talk Word Search 2025-05-09

18 Items: dayyouknowhomelifeleapdeepminefiveborednoisephonesdreamspictureprofileweekendexploremetaphor

HDFS 2025 2025-08-20

18 Items: DAYKADEPOPPCOVEYHENRYLATTYANGERAEMBREYPRIESTWELLERDONOHUEHOFFMANSCHAFERDAVIDSONLEWSADERMCGOVERNPRITCHARDGEISTHARDT

Influential People 2025-09-21

18 Items: goingetputfordaycashcoldfeetminddrivecrazydon’tasiderainyaroundcirclessomeone

a 2021-06-19

15 Items: âneamipâtelaitmaisvoilàaimerfairelainepairegâteaumaisonballonsemaineplaisir

A 2021-08-26

15 Items: amidéjàpâleavionvoilàfemmerepasavantgâteauamusantvillageagréableaccidentpatiemmentanniversaire

A 2025-02-18

15 Items: HuntMurkyGillsSpeedStrongStockyRobustEstuaryShallowCoastalBullSharkSaltwaterDangerousAggressiveFreshwater

A 2025-02-18

15 Items: TailSlapJumpDeepEyesLongWhipSpeedAgileSleekWaterStrikeHuntingThresherPredator

a 2025-07-09

15 Items: JudeCocoLanaNiniNanaKevinBarryJerryChrisDavidNannyAdolfoPatrickVanessaChristian

a 2025-08-14

15 Items: AresMedusaAtenasPerseuGréciaEspartaPikachuHistóriaMitologiaPeloponesoPalasAtenaDemocraciaOligarquiaCharmanderAntiguidade

a 2025-09-18

15 Items: ROMALOBAREMOTIBREMARTEROMULOITÁLIAPLEBEUCOLISEUPATRÍCIOESCRAVOSCLIENTESPOLITEÍSTALEGIONÁRIOANTIGUIDADE

Apple Word Search 2025-06-22

12 Items: A food made from wheatAn orange root vegetableA big orange food used in piesA soft food with a hard outsideA yellow food that grows on a cobA sweet treat often eaten in fallA crunchy fruit that grows on treesA sweet fall drink made from applesA small food that grows in green podsA small red fruit that’s a little sour...

Waves and Sound Vocab Review 2023-10-11

15 Items: The number of waves in one second.The material that carries the wave.How quickly a wave travels forwards.The lowest point of a transverse wave.The highest point of a transverse wave.Sound waves with a frequency less than 20 Hz.The number of seconds it takes one wave to happen.Sound waves with a frequency greater than 20,000 Hz....

Rebecca & Blair's Super Fun, Super Challenging Wedding Word Search 2025-09-18

21 Items: A fancier suit.A translucent accessory.The first event of today.Something better when open.A promise, but more serious.Selena Gomez' diamond shape.Something that was tied today.The job of two super cute nieces.Another word for a wedding ceremony.September 27, 2026 will be the first.Another word for "bachelorette" in the UK....

First Grade Sight Word Practice_1 2014-01-27

14 Items: boydaybackbeeneachjumpthemeveryaboutagainfunnyhousewritepeople

Unit 18 Brody 2015-08-31

14 Items: begpegpentenjetpetonedayoverhousewouldclassschoolteacher

Week of 2/25 2019-03-01

14 Items: dayrarereadfoundSeussacrossdoctorIslandsAmericareadingtortoiseGalapagoslibrariescelebrate

Bat Word Search 2024-01-23

15 Items: batdaybirdfoodeyeswingsnightfruitsmallteethanimallistendifferentdifferentinteresting

mississippi children's choir when Gods children Get together party 2025-05-19

14 Items: djgetdaywhenchoirgod'sHappyBirthpartyDancechildrentogetherchildren'smississippi

This Little Piggy 2025-07-07

15 Items: hadweealldaythiswenthomebeefnonehomeoinkpiggylittlemarketstayed

God's Creations 2025-10-14

14 Items: GODDAYSUNSEASFISHMOONWORLDEARTHLIGHTNIGHTWATERPEOPLEAngelsHEAVENS

SUMMER 2025-05-01

20 Items: Clothing made for swimming or sunbathing.The warm, bright light that shines from the sun.A man-made basin filled with water for swimming.A frozen dessert made from sweetened cream or milk.A long, flat board used to ride waves in the ocean.A sandy or rocky shore beside an ocean, sea, or lake.A structure made from wet sand, usually at the beach....

Ancient Rome 2025-06-08

20 Items: The first emperor of Rome.The king of the Roman gods.The ruler of the Roman Empire.A large unit of the Roman army.A garment worn by Roman citizens.A member of the wealthy, ruling class.A common citizen or lower-class Roman.A term Romans used for non-Roman people.A political body that advised Roman leaders....

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

Valley Word Search 2023-02-23

25 Items: a combination of tread and riserthe upper interior surface of a rooma upper horizontal portion of a stepthe horizontal member of the shutterdevice giving protection from the suna vertical distance between two successive treadthe lowest part of the base of an architectural columnThe angle formed at The intersection of two roof slopes...

Cocktails 2024-12-30

15 Items: An Italian cocktail made with gin, Campari, and sweet vermouthA stirring technique used to mix ingredients and chill a drinkA tool used to mix and chill cocktails by shaking them with iceA refreshing rum cocktail with mint, lime, sugar, and soda waterA concentrated flavoring used in small amounts to enhance cocktails...

Chapter 8 2025-11-23

17 Items: Linear ordering of monomers in a biopolymer.enzyme that cut foreign DNA at specific sites.A monosaccharide with a phosphate group attached.Large conformational change of the enzyme and DNAA critical structural feature in certain biological moleculesEssential molecule that stores and transmits genetic information....

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

unit 15 2025-06-02

19 Items: saydayaskbusynextweekplansfollowaskingformaldeclinemessagepolitelytomorrowinformalrequestssomethinginvitationstatements

東京 ユニット2 2025-07-02

31 Items: Easterto sayalwaysto cutto washto needto maketo callto cookit rainsto thinkto cleanto beginto stareto answerLabor Dayto operateto be latethis monthlast monthevery weeknext monththis morningMemorial Dayto throw awayto do laundryPresident's DayIndependence Dayto take (a thing)the day after tomorrowto stare (negative connotation)

40 literary terms,elements,& devices 2022-10-07

40 Items: meaningA words literal definitionSomeone who is the voice of the poem.the time and place in which a story is toldA person who tells a story in a film or literatureA figure of speech that is an exaggeration for emphasisAn obstacle that characters have to overcome in a storyThe main message that is being conveyed throughout a story...

Anchor Word Search 2023-02-20

25 Items: where people take coverthe top level of a buildingis the ceiling or ceiling of the houseWindow placed on the roof of the buildingis the best way to cover your house from sun lightit is the base where the windows of the building restthe side-post or lining of a doorway or other aperture.a non-load bearing walls that separate spaces in buildings...

Woodshop Vocab Word search 2025-11-24

25 Items: part of an inchA long guide on a toolProtected by a third wireHow accurate we want to beChange from one system to anotherthe large flat surface of many toolsA hand held tool that can cut curvesThe smooth round part of a drill bitThe ratio between real life and paperSitting around in class doing nothingPart of a tool that holds a drill bit...

Woodshop Vocab Word search 2025-11-24

25 Items: part of an inchA long guide on a toolProtected by a third wireHow accurate we want to beChange from one system to anotherthe large flat surface of many toolsA hand held tool that can cut curvesThe smooth round part of a drill bitThe ratio between real life and paperSitting around in class doing nothingPart of a tool that holds a drill bit...

Special dates! 2025-11-11

7 Items: DayDayEasterCarnivalChristmasHalloweenYear's Day

Courthouse Word Search 2023-10-18

18 Items: Lying in courtPerson who is on the juryPromise to tell the truthAn expression of disapprovalLawyers examination before trialThe official decision of a courtRepresents the defendant in courtThe decision of a jury or a judgeAn invalid trail, caused by big errorA claim that someone has done somethingAsk a higher court to review a decision...

Vocabulary unit 11 2025-05-19

18 Items: A mark indicating the quality of a student's work.The grounds and buildings of a university or college.A college or university student who's not a graduate student.A first-year student at a university, college, or high school.Based on or characterized by the methods and principles of science....

The Write Stuff: A Storyteller's Challenge Word Search 2024-06-10

14 Items: inkheromagicclichevillainchaptermysterydialogueplottwistadventurefairytalecliffhangerA short story with a moral lesson is called a(n) ________.The opposite of a synonym is a word with the ________ meaning.

Math Maze 2025-10-08

16 Items: compares two quantitiesgives one output for each inputshows that two ratios are equalshows how steep a line is on a graphshows that two expressions are equalmeasures the space inside a 3D shapemeasures the outside area of a 3D shapeis the number that multiplies a variableis a statement proven to be true in math...

A 2025-02-18

15 Items: SealApexJawsColdTeethSpeedDepthTorpedoHuntingSurfacePredatorBreachingCartilageMigratoryGreatWhite

A 2025-02-18

15 Items: JunkHuntNightTeethLargeGillsTurtleStripedBuoyantShallowOmnivoreTropicalScavengerTigerSharkAggressive

a 2025-07-22

15 Items: CartaCabralLisboaColôniaCaminhaVeraCruzFeitoriaPortugalCalicutePaubrasilNavegaçãoTupiniquimColonizaçãoEspeciariasGuardacostas

a 2025-10-14

15 Items: QAOTMDBAOASORMGRCAUDITONBASESECURITYORACLEDEVMESSAGINGINTEGRATIONAPPDELIVERYDATAANALYTICSDATACONVERSION

a 2025-11-14

15 Items: RomaFeudoAtenaMarteAntigaTeatroServosGréciaColiseuOdoacroFrancosPlebeusGladiadorVisigodosFeudalismo

Payments, Payment Cancellation, and Payoffs 2025-06-04

20 Items: 30 daysthe lien release fee.The ____ _____ is the one who_____ payoff requests should notWe cannot cancel an ______ payment.To run a payoff we need a delivery method and a _____.Which servicer can homeowners make wire payment's through?The once monthly automatic payment option we have at newrez....

• W O R D S E A R C H • 2024-03-24

13 Items: wesoofanddayareyouadekveryhappyproudgraduationcongratulations

Hundred Word Search 2025-01-28

13 Items: DayMathDrawLearnCraftSchoolFriendHundredTeacherStudentProjectCountingCelebrate

What's the time? 2025-01-28

13 Items: DaytimeMonthhoursclockDecadeMinuteanalogCenturyforeverdigitaltimelineMillennium

SNOW ____ 2025-12-11

13 Items: MANDAYBALLFALLSUITPLOWBANKDRIFTFLAKESHOESMOBILEBLOWERSHOVEL

BJ 2024-04-11

20 Items: A lover of books.Calm and peaceful.Calm and unemotional.Walking in one's sleep.Done without preparation.A playful or fanciful mood.Keeping watch with alertness.Lasting for a very short time.A sentimental longing for the past.Impossible to understand or interpret.(Of a person) determined and persistent.Happening by chance in a beneficial way....

Earth Sun Moon 2018-12-12

16 Items: DayYearUmbraTidesSeasonWaxingWaningEquinoxGravityGibbousEclipseRotationSolsticeCrescentSatelliteRevolution

5.1-5.2 Word Search 2019-11-11

16 Items: DayYearUmbraSeasonWaxingWaningEquinoxGravityGibbousEclipseRotationSolsticeCrescentPenumbraSatelliteRevolution

Little red riding hood 2020-07-25

16 Items: mydothedaywashfaceyogabrushteethwritedrinkstartwakeupjournalmeditatesmoothie

bj 2022-01-02

16 Items: DayOurWhoEvilGiveLeadWillDailyEarthHeavenDeliverForgiveKingdomHallowedTemptationTrespasses

look for words in the story 2022-03-06

16 Items: daytimehousehappyneveraftersummerfamilylookedfollowbrotherflowersbeautifulsurprisedgrandfatherbutterflies

Watches Word Search 2023-03-13

16 Items: sundaynowhandmoonkeepharmlifebothshaderightnightgoingcomingwatchesforevermore

Watches Word Search 2023-03-13

16 Items: sundaynowhandmoonkeepharmlifebothshaderightnightgoingcomingwatchesforevermore

Lesson 7-8 Review 2023-09-19

16 Items: dayoncewashweekoldertwicebrushoftencleanbiggerfastertallerbetterheavierworkoutstronger

Day Word Search 2024-01-04

16 Items: daymayyearoncejulyfirstthirdapriltwicemonthmarchtuesdayfebruarynovembersaturdaywednesday

calendar 2024-02-09

16 Items: dayendtermyearweekmonthfirstthirdstartsecondeasterpublicholidaysemesterpicnicdayboxingday

Starscape Word Search! 2025-01-20

16 Items: DAYEVEANNAABBYJOJOMATTTINYBRIARGOOMYWIDOWFARLEYLUCIELLUCITALUCIFERPARADOXVERONICA

Easy words 2025-03-20

16 Items: DogDayWorkRoomFastLateBabyTableEmailMusicFriendFamilyFlowerSpiderBeforeComputer

The Sun 2025-10-24

16 Items: DAYSKYSTARHEATWARMRAYSSOLARLIGHTEARTHBRIGHTORANGEYELLOWSUMMERSUNLIGHTSUNSHINEDAYLIGHT