library Word Searches

Finished Word Search 2026-05-07

12 Items: They __________ the game. (enjoy)We _________ TV last night (watch).He _________ to fix the computer (try).I _________ the movie we watched (like).She _________ when she saw her gift. (smile).She _________ her homework yesterday. (finish)We _________ to the store this morning. (walk)She _________ her books to the library. (carry)...

Random 2023-03-28

113 Items: redwarjenomarkLovedinomarscakeworkkpopfrogdopefirebluetownbookeggslifesnowlimesalehomemoonrocktwicejiminkoreawooziateezoneussantamusicdramalemonmoneybeastbellekarmaswiftloverdracodobbywitchworldsmiledevilstylehoshistucknightwintersummerplanetbananaschooldisneyauroraprincestigmamalfoywizardgastonwatsonorangejisungjaemingoogleshineeamazonsearchlovely...

Spanish 1 Orange Vocab List 2026-05-14

41 Items: gymcaféhomemallparkworkhomefrombeachalonewhen?afterchurchmosquetempleto theto thewhere?libraryat homemountainsresturantsynagoguefree timegenerallywith whom?afterwardscountrysidepiano lessonmovie theaterswimming poolOn mondayy...to go shoppingto see a moviei stay at homewith my friendswith your friendsme digas You don say!...

Around Town 2026-01-12

10 Items: A tall buildingA place you can borrow booksA place you can park your carA place people store their moneyThe place you go to take the busSomething you use to find your way aroundA place where you can ride a rollercoasterA large square with many different sellersA place you go to practice different sports...

lo que hay en mi insti 2024-12-14

31 Items: gymtoiletslibrarycanteentheatrelockersuniformyou canto chatyou mustclassroomfacilitieslaboratorystaff roomyou cannotto be rudeto chew gumground flooryou must notto be silentto be politeto be on timeto pay attention(basketball)courtto shout in classto use your mobileto do your homeworkto respect the teachersto eat in the dining room...

NCE-51 2026-05-17

28 Items: 新的午餐音乐科学今天故事许多早上。星期一星期二星期三星期四星期五容易的星期六星期日放,安置图;地图制定,写学科,科目一日;白天找到,发现事情;物品计划,目标计算机,电脑在(某一天)字,词,单词图书室;图书馆

Nombres 2025-04-08

14 Items: Always on his ChromebookVery quiet sometimes lateWears glasses and is quietThe Library Spanish TeacherI love make up and StarbucksAlways sad when BFF is absentI travel during Fin de SemanaKnows everything about dirt bikesHe is just there...not doing muchGodzilla,Aliens,Video Games,GremlinsAlways has her hair up and is athletic...

School 2026-01-26

116 Items: pendeskdoorexammathquizbookschairchalkclockglobepaperrulertabletimercarpeteraserlaptoplockermanilapencilposterrecessscreenwindowbinderscompasscrayonsdisplayerasersfoldersjournallibrarymarkersplannerreadingsharingshelvessubjectteachertissueswritingadhesivebackpackbookcasecalendarcopybookcubicleshandbookhandoutshomeworkkeyboardlearningnotebook...

Irdecompras Word Search 2026-05-15

39 Items: gymthecafémallparkbeachwhen?afterchurchmosqueto thelibraryat homefrom, ofmountainssynagoguework, job(to) homefree timegenerallyrestaurantto (prep.)afterwardscountrysidehome, house(to) where?on weekendspiano lessonmovie theatreswimming poolto go shoppingto see a movieI stay at homeyou don't say!with my friendsquién? with whom?with your friends...

Spanish 2026-05-15

42 Items: togymcafemallparkworkwhenfromaloneafterchurchmosquetempleto thelibraryat hometo hometo wheremountainssynagoguewith whomfree timegenerallyhome,houserestaurantafterwardson mondayscountrysideplaya beachon weekendsin order topiano lessonmovie theaterswimming poolyou don't sayto go shoppingto see a movieI stay at homedonde to wherewith my friends...

Heritage Huskies 2023-01-06

119 Items: wulawliuwanxievexptaartlintanbowncarrcopadotyhillhydepacetianstemfiizkentdeepabairbbairblandcrookcrossgrosshenryhyattjonesmooremyerssmithspirewalshmarshblacklewisspireaikensarcherbarlowbarnescarperchurchcowleycurtishughesporterromerocsweattannertaylortollerzavalareevesashmeadelswoodfaucettfreitaggladdenhhansenrhanseniniguezpearsonkeyoungkryoung...

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

French Vocab 2024-12-02

46 Items: ArtLawGymEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyphysique PEScholarshipArchitectureFashion designSocial studiesHigher educationComputer science(les maths) Mathpas I don’t likePolitical science...

SAMPSON STALLIONS 2025-09-07

115 Items: FOXLEEMATHALMSDUNNEARLHOODREEDREIDROLLROSERUDDYANGPOLKPREKFIFTHFIRSTARAVEASTONBAKERBONDYBOMBABORAKELETAGOMEZDAVISMOOREMURRYPEREZPERRYPRICEREYESSMITHPEAMSPEREZPERRYTHIRDFOURTHACOSTACDAVISFERRERFRENCHGARCIAHABADAHOPPERKONCIRMARTINMICHELMITTONMOTZNYRIVERASITLERTEMPLETHOMASZAPATASECONDGRAMMARLIBRARYBARAKATBARFUSSBICKHAMBRANDONBRELANDBYGNESSGAMBHIR...

Junk Journaling Game Night 2026-01-11

21 Items: cutsantique and oldsewing in pagesjunk journal insertaltered embellishmenthangs outside a journalitems in a junk journaljunk journal embellishmentcomes in different weightsgroups of pages in a journalused to create journal pageshanging journal embellishmentwraps to hold things in placespace to journal your thoughtsfasteners to hold things together...

Vocab 4A 2026-05-08

42 Items: gymcafémallparkhomebeachaloneWhen?afterchurchmosqueto theto thewhere?libraryat homefrom, ofmountainssynagoguework, jobfree timegenerallyrestaurantto (prep.)With whom?afterwardson Mondayscountrysidehome, houseon weekendspiano lessonmovie theaterswimming poolto go shoppingto see a movieI stay at homeYou don't say!with my friendswith your friends...

Junk Journaling Game Night 2024-01-20

21 Items: cutsantique and oldsewing in pagesjunk journal insertaltered embellishmenthangs outside a journalitems in a junk journaljunk journal embellishmentcomes in different weightsgroups of pages in a journalused to create journal pageshanging journal embellishmentwraps to hold things in placespace to journal your thoughtsfasteners to hold things together...

Berwyn 2025-04-25

117 Items: BnsfeasthomePaceYMCABtownFloodgrovejacksLalosMetramooseOgdenPipersokolTonysTrainAustinBennysBerwynCermakcuylereuclidGeorgeHarlemharveyIrvingJanuraLoverononnosPoliceProksaRedtopwesleycarboneCarshowclintonConnieselmwoodEmersonFreedomFreightGodsonsLibrarylincolnlombardMacnealoakparkPinkowlSpindleStanleyStodiloturanosWindsorBungalowCityhallclarence...

4A Vocab List 2025-09-16

41 Items: togymhomeparkworkwhenfieldbeachaloneaftercoffeechurchmosquetempleto thelibraryto homewith mewhere towith youfrom, ofmountainssynagogueafterwardfree timegenerallyrestauranton Mondayson weekendsin order topiano lessonshopping mallmovie theaterswimming poolyou don't sayto go shoppingto see a movieI stay at homewith my friendswith your friends...

2 | In der Schule 2025-10-03

50 Items: penmapbookeurogluedeskphotorulerpaperchairtablethingboardwindowbindertissuepencilcrayonmarkereraserfolderschoolteacherdividerlibrarystaplercalendarnotebooktextbookbackpackquestionhomeworkscissorsclassroomtrash canlunch boxcafeteriaeverythingdictionarycalculatorsticky notereport cardhour, coursewatter bottlecolored pencilwriting utensil...

Our Places We Have Traveled To 2026-01-23

44 Items: RokBCDDAMOBLUMHmartYoteaDanbiTsukeVidereStaggerOC FairDescansoKyuramenLacy ParkKettl TeaThe GroveCountdownAbout TimeCoffee MCOZuma BeachUrth CaffeDumbstruckLemon PoppySummerfieldPillow TalkVox KitchenMenya HanabiII CapriccioBoiling CrabBoiling PointColor Me MineBeverly HillsFashion IslandArcadia LibraryWhittier NarrowsGreystone Mansion...

New Vocabulary 2026-04-17

22 Items: not dirtynot cleanhaving no moneyfar up, not lowa marriage partybig shop for foodhair on a man’s chinhaving a lot of moneynot high, near groundplace to watch moviescosting a lot of moneynot costing much moneyhair above a man’s liphaving no hair on headneeding rest, no energyhaving few years of agehaving many years of agehaving a husband or wife...

Fly High 3 2026-05-05

113 Items: upshymapArtskiMaysunbuyauntflagtaximeatleafshowbirdlateJuneJulyrainsnowwindcooktalkmakewashdishropewaitmovestopunclecreamshirtsmileplanemoneyMathsalbumpandaearlyMarchAprillearnboredfloortastechasethiefbravefightswingtowelargueAfricacousinFranceGreececheesedinnerTurkeyshortsticketMondayFridaySundayletterparcelwintersummerspringautumnAugustcinema...

Find the right words 2025-02-14

8 Items: This is the default value of the penThis is the default color of the penYou will find the sound effects hereit creates a copy of the sprite on the stageUP It will stop the sprite from drawing a trailIt allows the sprite to draw shapes on the screenIt removes all the marks made by the pen or stamping...

Community Helpers 2025-04-14

6 Items: TAILOR : A personGROCER : A person who sells food and other everyday items.FIREFIGHTER : A person who fights fires to keep people safe.PLUMBER : A person who fixes water pipes and plumbing systems.MECHANIC : A person who fixes and repairs machines or vehicles.LIBRARIAN : A person who works in a library and helps find books.

Read Word Search 2026-01-11

10 Items: - an image that helps tell a story.- a person who writes books or stories.- letters put together to make meaning.- to have fun and feel happy while reading.- one side of a book with words or pictures.- a place where people borrow and read books.- to make pictures in your mind while reading.- to look at words and understand their meaning....

English Discovery Words 2025-09-22

15 Items: an animal who barksthe king of the junglea white drink from a cowsomething you use to drinkto move your body in watera place where the doctor worksa place in school with many booksa big room for meetings or eventsa long yellow fruit that is sweetsomething you use to sweep the floora place where children playing around...

Clue #3 2025-10-30

1 Item: library

Where is your next clue? 2025-12-06

1 Item: library

Harry Potter 2025-08-03

123 Items: FangBlonDobbyErrolMoonyGoyleLinnyAragogCharmsCrabbeFawkesProngsFluffyDrarryHedwigNaginiPeevesTreverPotionsLibraryPadfootFirenzeNorbertBuckbeakHogwartsChoChangScabbersWormtailKreacherKatieBellAstronomySirCadganPansmioneLeeJordanTomRidlleRosemertaHouseElvesArgusFilchRemusLupinLilyPotterViktorKrumPadmaPatilIrmaPrinceDeanThomasOliviaWoodHarryPotter...

Giant Word Search for ESL 4th Grade (1.0) 2026-02-05

120 Items: uponsadhotWowredarmlegtagcapMaypiepenoffGoodlikefinecoldnicepinkblueheadnosechinfootJuneJulysoupfishgamesaletaxistopopenmenunewsdownHellonighthappytiredangrydreamgreensnowyrainysunnybrownshirtblackbootsMarchAprilsaladrulerjuiceSeeyousleepyhungrylemonsyellowpurpleorangecloudyfingerglovesMondayFridaySundayAugustpencilerasermarkermagnetschoolpolice...

Unit 2 lesson 2 2026-05-14

55 Items: penmapfunmadsaddoorglueflagtapeeasybusychairpaperchalkfieldtirederaserpencilwindowpostermarkerboringofficeWhere?pencilsstaplerlibraryhallwaystadiumexcitednervousnotebookbackpackscissorshomeworkbathroomprojectordifficultcafeteriaclassroomgymnasiumdepressedWhere to?calculatorwhiteboardwhiteboardsclock/watchinterestingteacher deskstudent desk...

Tournament : Geography Special 2026-07-14

25 Items: Moroccan cityOmani capitalRussian CapitalAndalusian CityIranian CapitalNorwegian CapitalEast African cityHungarian CapitalCentral European CityCanals replace streetsWhere Europe meets AsiaGulf City on a PeninsulaCity near ancient wondersDesert city of manuscriptsSouthern city of the YarraPort city on a global routeJapan's former imperial home...

Deutsch I Wortsuchsel 4.3 2026-01-20

31 Items: lablockerlibraryTheaterto beginschoolyardauditoriumHighschoolindoor gymright, truesports fieldadmin officeto give backwrong, falseto drive backthat's wrong!exit (on foot)toilet, bathroomelementary schoolto pick up, fetchentrance (on foot)pardon, excuse me?comprehensive schoolto take with, take alongcafeteria (school or work)...

Ashlynde's resistance of Mr. Kloiber's unbearable words. 2026-03-09

10 Items: ____ before the thunderevery one has some _______every one does it to othersThe first test already ________Something Mr. Kloiber's trying to teach ussomewhere you should head to get some bookssomething the school has every night done to itIf you are ______ you usually like to work aloneyou should have ________ about these words before the test...

Math Word Search 2025-06-21

10 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to stay healthyA subject where you practice letters and words...

Nombres 2025-04-08

14 Items: Always on his ChromebookI love makeup and StarbucksQuiet but knows her SpanishThe Library Spanish teacherI travel on the Fin de SemanaGodzilla,Aliens,Lazers,GremlinsHe's just there..not doing muchKnows everything about dirt bikesAlways has her hair up and is athleticHer name is also the name of a US StateI also love make up and Starbucks...Slay...

UNC (medium) 2026-01-17

25 Items: UNC hoops legacySchool pride vibeSignature UNC colorUNC live ram mascotGraduation ceremonyUNC athletic nicknameMain street near campusAdmin building on campusRare collections libraryStudent housing buildingTown where UNC is locatedBasketball arena nicknameGym and recreation centerFans and alumni communityFootball stadium on campus...

vocab man 4a riley line 2026-05-17

42 Items: togymparkworkhomefromhousebeachalonewhen?afterafterchurchmosquetempleto theto thelibraryat homemountainssynagoguewhere to?free timegenerallyrestaurantwith whom?countrysideon weekendsshopping mallmovie theaterswimming poolto go shoppingI stay at homewith my friendsto watch a moviethe piano lessonwith your friendsfor / in order tocafé / coffee shop...

Pencils, Papers and Puzzles 2025-06-12

12 Items: Assignments done after schoolThe person who leads the classThe class you use a calculator inA place full of books and researchOne of the school's primary colorsThe school's top-level sports teamThe mascot of Wayne Hills High SchoolTime off from school where you can relaxThe ceremony marking the completion of HS...

Observer Word Search 2026-02-16

10 Items: Home of the iconic Telstra TowerThe best student newspaper in the worldANU library bunker of despair and productivityLake you claim you’ll jog around this semesterANU precinct where all roads (and lunch money) leadWar monument every visiting relative insists on seeingNightclub that guarantees at least one regrettable decision...

Cinema Word Search 2025-10-23

2 Items: language monument invisible beginner villagerestaurant museum hospital library gym chimney roof walls shower curtains pillows washbasin wardrobe cupboards fridge coffee

Sana's Word Search! 2026-05-22

19 Items: a lovely catbookish nooka warm lightpoetic citrusbest pasta placea true blue banda flower facing the sunthe best kind of camerayou're not obsessed with ityour biggest fan (besides me)something it's never too cold forsinger dacus and the name of a cara trusty vehicle with many memoriesobligatory mention, queen of all eras...

Prepositions 2026-06-15

18 Items: We read a story ___ recess.Jack's desk is ___ Mia's desk.The monkey climbed ___ the vine.The farm is ___ the busy airport.The butterfly landed ___ a flower.The leaves floated ___ the stream.The kitten crawled ___ the blanket.The swing hangs ___ two tall poles.A ribbon was tied ___ the gift box.The rainbow stretched ___ the river....

Wordly Wise UNIT 12 2025-10-12

9 Items: My body is made up of many ____________.The family decided to ____________ a dog.The dress has a striped ______________ on it.The CREO library is _______________ by reading level.The girl's _____________ is bad so she wears glasses.His interest in space was ______________ by the science museum....

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

Auténtico 1 4A ¿Adónde vas? 2025-08-27

41 Items: togymparkwhenbeachaloneafterchurchmosquetempleto thelibraryto homewith mework,jobwhere towith youfrom, ofmountainssynagogueafterwardfree timegenerallyrestauranton weekendspiano lessonshopping mallmovie theaterswimming poolto go shoppingto see a movieI stay at homeYou don't say!with my friendswith your friendsfield, countrysidecoffee, coffeehouse...

 2026-02-26

12 Items: A bag used to carry school suppliesA snack made from heated corn kernelsAn object used to stay dry in the rainA breakfast food often served with syrupPaper used for writing notes or homeworkA two-wheeled vehicle powered by pedalingDevices used to listen to music privatelyA tower that guides ships away from danger...

EC2 UNIT #3: ¿Te acuerdas? 2025-01-05

44 Items: carcarcityeastnearwestparktrainnorthundersouthstoreplacesavenuemarketmuseumbakerysquarestreetto buyto walklibraryto takebuildingfar fromgeographyto explorecoffee shopin front ofsupermarketbutcher shopmovie theaterto go by footto the left ofto go by metroto the right ofto drink coffeeto ride a bicycleto eat/have lunchto eat/have dinner...

School 2024-01-10

20 Items: wheelyou move quicklythe head of a schoolwhere books are keptsomeone who has childto say hello to someonea bag you take to schoola place you park your bikechair with wheel for peoplea large ball you kick a roundto move things with your feeta container you keep water ina bus that takes you to schoolsomething you wear on your head...

130 2026-04-14

130 Items: UserChefDockOceanZebraOrbitQuestRiverIglooJewelOasisYachtBakerGuideJudgeNursePilotUsherHotelGalaxyQuartzDesertEngineForestIslandJungleMeadowNaturePlanetSummitValleyCanyonFalconGardenHarborKnightLagoonMirrorNectarPirateQuarryRocketSafariTempleZephyrArtistFarmerHunterKeeperLeaderWriterDancerEditorHealerLawyerRangerSailorTailorVendorWorkerAnchorBridge...

Community Helpers 2025-05-30

10 Items: A person who flies an airplane.A person who makes or repairs clothes.A person who takes care of people's teeth.A person who helps others learn in schools.A person who fights fires to keep people safe.A person who sells food and other everyday items.A person who fixes and repairs machines or vehicles....

Review 4 2025-03-10

12 Items: A specific place on a map.A place that is not water.Tells you which way to go.A place where Muslims pray.A high rock with a steep drop.Something that grabs your attention!A huge piece of land with many countries.Place where you come to read or borrow books.Where things are made or services are provided....

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

Elementary School Life 2025-06-28

2 Items: ChatGPTpencil recess teacher library desk eraser lunchbox playground crayons math reading music glue scissors chalk notebook science hallway principal friends swings giggles stickers fieldtrip

Vocabulary puzzle - M4 2025-09-08

15 Items: Something very tasty.The opposite of “boring.”Feeling happy and excited.Something very big or huge.A person who designs buildings.A place where people can borrow books.Extremely funny or causing a lot of laughter.A person who writes news reports or articles.Something that is necessary or very important....

Carr 2026-05-20

7 Items: ?�;�� ?� � � � ��� � x � � ?� � � <� � � � � � ?� � <� � � �¬oßo↓o_n♦ÜWÆF⌂µW'§-²2 IU"u-▲ñtAd‼|`Ö y•a^eYµw}4b▌}_:⌂5[gemmAM↔_µ}Y^a¬+Acheter pour 14,99 $...

one tree hill (season 5) 2023-07-04

140 Items: bandclubhateheropooltricangieangstbeachclowncoachcometdramagraveguiltjerrylyingmilanmusicnaleynovelomahapagersoberauthordebleeeditorfamilyleytonmodelsparoleprisonravensairportcaptivecollegefashiongrandpahistorykissinglibrarynewyorkrunoversingingsurgeryteachertherapytrappedweddingadoptionalicedayarrestedbarfightbreakupsbrotherscarcrashcemetery...

¿Adonde Vas? 2025-09-08

42 Items: gymcaféparkworkbeachalonewhen?afterchurchmosquelibraryat homefrom/ofmountainsresturantsinagogueto (prep)(to) homewith whomfree timegenerally(to) whereafterwardscountrysidehome, houseon weekendspiano lessonshopping mallmovie theatreswimming poolyou dont say!to go shoppingto see a movieI stay at homewith my friendsto (fem,singular)with your friends...

Super-Duper Ultimate Word Search 2024-12-18

140 Items: RapGodAbtWhoFoxEliDogHanArtLoveRockBookCornTreeBluePinkTealLiloStopViewDashLawsLionYodaLukeSoloStarWarsJediLeiaRemyLakePeteGroguRulesAvaniRykerBowesRouffHenryJesusDeweyCandyPizzaBrothDonutStartPennyJaxonCasonKittyCholeClassMusicEdallVickiJakariAshtynPadresAngelsMarvinVarleyMartinMclainArianaRanchoSchoolPrayerHorrorSystemTurtlePurpleStitchYellow...

Word Search grade 6 2024-12-06

20 Items: When the sun goes downA large stream of waterA place with many booksA stick of wax for lightA tool that attracts metalA game to solve or assembleA loud sound during a stormSomeone who helps you learnA fabric that covers windowsA large area with many treesA bag you carry on your backA structure over water or landA surface that reflects images...

¿Adonde Vas? 2025-09-08

42 Items: gymcaféparkworkbeachalonewhen?afterchurchmosquelibraryat homefrom/ofmountainsresturantsinagogueto (prep)(to) homewith whomfree timegenerally(to) whereafterwardscountrysidehome, houseon weekendspiano lessonshopping mallmovie theatreswimming poolyou dont say!to go shoppingto see a movieI stay at homewith my friendsto (fem,singular)with your friends...

Math Word Search 2025-06-22

12 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to spell wordsA subject where you use a keyboard and mouse...

The Final Countdown Word Search 2026-05-14

12 Items: The dictionary definition of a wordThe season after spring and before fallplace many people visit to swim and relaxA character who changes throughout a storyA reference to another text, person, or eventThe sequence in which events happen in a storyWords or phrases that appeal to the senses in writing...

Qu & Kn Words 2024-01-15

14 Items: Earth_____ .Counterpart to the King.Don't ____ ! Never give up!Turn the door____ to the left.Another name for a "small" test.The elephant got stuck in the _____sand.A shape whose 4 sides are of equal length.His mother ____ him a sweater out of wool.She sliced the bread with a sharp _____ .You go to school to learn and get this. What is it?...

GGS 2026-05-29

16 Items: Where worship happensThe holy book includes...Name of the Sikh holy bookThe holy book sits on thisGuru number for the holy bookThe holy book is treated with ...Where people can learn about SikhiThe original name for the holy bookThe name of a Sikh place of worshipThe flag outside the place of worshipThe language the holy book is written in...

Community Helpers 2025-04-14

10 Items: PILOT : A person who flies an airplane.TAILOR : A person who makes or repairs clothes.DENTIST : A person who takes care of people's teeth.TEACHER : A person who helps others learn in schools.GROCER : A person who sells food and other everyday items.FIREFIGHTER : A person who fights fires to keep people safe....

city boi 2026-05-05

59 Items: oldcarparkeastwestnearhousebeachriverhotellargesmallclearNorthsouthrelaxstreetmarketcinemaschoolbakerymuseumprettyby busto buyto eatlibrarytheaterbetweenon footto walkto wantto swimto readto havebuildingdowntownlocationfar fromby planeby trainto thinkto visitto drinkthere iscity/townby subwayto travelrestaurantde to leftde next toinhabitants...

Neighbors, Word Search 2025-05-23

1 Item: City Hall, Schools, Library, SeniorCenter, Organizing, NonProfits

OPL Accessibility Scavenger Hunt 2026-04-16

16 Items: Tactile textAn alternative to stairsA book format with bigger fontSpecially Trained support animalMust be at least 36 inches apartAllows patrons to check out booksAllows patrons to search for booksAllows patrons to do work in the libraryA book format that lets you listen to storiesA piece of technology that reads books to you...

Hospital, Word Search 2023-08-30

1 Item: hotel, petstore, bookstore, museum, library, gasstation, bank, supermarket, school, grocerystore, giftshop, library, bakery, beautyshop, musicstore, restaurant, trafficlights, trafficjam, sidewalk, crossroads, crosswalk, roadsign, pedestrian, streetlights

Places Around Town Word Search 2026-02-12

16 Items: The place where journalists workThe place where you can exerciseThe place that has mass every sundayThe place where football players playThe place where you see dinosaur bonesThe place where you can buy fresh breadThe place that has shops and restaurantsThe place where you fill your car's tankThe place where you can read lots of books...

Back to School 2025-08-03

20 Items: The adult who teaches the class.Schoolwork you take home to finish.The room where you learn at school.A tool used for writing or drawing.A book with blank pages for writing.A table where students sit and work.A child or person who goes to school.The solution or response to a question.Looking at words and understanding them....

School 2026-01-29

159 Items: gymmathdesksexamslogicbinderdebatedrillseraserethicsmemoryrecessrulersguidesalgebrabiologybluepencrayonsfoldersgradinghistorylabcoatlecturelibrarylockersmarkerssolvingrespectsciencesurveysartclassassemblybackpackgymclasshallwayshandoutshomeworkidentityjournalsmidtermsplannersscissorsseminarssyllabustheoriescafeteriacasefileschemistryclassroom...

POSTIES 0519 COVER 2025-04-17

6 Items: A _____ novel is long story told in comic book format.In Lam's culture, sharing food is how people show ____.a person or thing that is the reason why somebody creates somethingLam moved from Hong Kong to the United States when she was _____ years old.a type of literature that describes imaginary people and events, not real ones...

Spelling 2026-04-07

165 Items: offlogoMarsbaseaislebuyeradvicelawfullizardautumnmethodmiddlebewaremuseumblazernativeboringbreachbruiseclosetGoliathharvestacquireacrobatimmenseagainstammoniaamplifyancientjealousanxietyanxiouslibrarylikablelobsterathleteloyaltyaudiblemannersmassivebalconybarrierbiscuitneglectnervouscapableoffensecapitalorganiccentralchannelpelicanperfumephonics...

Kinder 2026-02-12

153 Items: bincuppenrugtoyballcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersnumbersreadingshelvesteacherwritingabcchartbackpackbooklistclasspetdaysweekexercisefloormathomeworkmealtimescissorstricycleworkbookartcenterclasslistclassroomeducation...

Trinity University History Wordsearch 2026-04-08

20 Items: Trinity's birthday month.What is the oldest sorority?The city Trinity moved to in 1902.The city Trinity moved to in 1942.Location of Trinity's first campus.Trinity's president from 1951-1970.Call letters for our radio station.Trinity's longest serving president.The campus used to have a ___ garden.Building that used to be the Library....

Oriole Word Search 2026-05-28

36 Items: Lunch time!Mr.ShockleyAct it out!Pottery classTake a pictureFresh cookies!See ya seniors!Time off schoolSinging studentsThe school paperString musiciansBig spring danceJump in the pool!Classes you choseAfter school sportsOur largest hallwayWhat you are taughtDance after the gameShow me your projectWatch or perform hereWhere most books live...

campus word search 2025-02-17

21 Items: pride of collegeThe outline or plan for a course.The primary subject area of study.Optional courses chosen by students.A formal test of students' knowledge.The secondary field of academic focus.The college eatery for meals and snacks.A practical work experience for students.The units that measure academic progress....

Rhiannon & Dan are leaving us: The Wordsearch 2026-03-23

24 Items: Shared hobbyRhiannon’s catIce cream thiefDan’s other catDivine dessertsOne of Dan’s catsName of Dan’s carDan’s fluffy obsessionWhen the best team worksGive a book, take a bookFirst step to owning a homeOne half of today’s send-offWhat brought us all togetherLocal magazine Rhiannon editsThe other half of today’s send-off...

chase's word search 2026-05-05

61 Items: oldcityparkeastwestnearhousebeachriverhotellargesmallclearNorthsouthrelaxstreetmarketcinemaschoolbakerymuseumprettyby busby carto buyto eatlibrarytheaterto leftbetweennext toon footto walkto wantto swimto readto havebuildingdowntownlocationfar fromto rightby planeby trainto thinkto visitto drinkthere isto carryresturantby subwayto travelinhabitants...

Time Spent Together (Father's Day 2026) 2026-06-21

162 Items: bbqfunhugnbrtrywiiwinzoobikecampcarsdivefirefishhelpjokejumplakeleadlickloveraceraftreadsingskllsledswimtimeweedworkbooksbrushcardscarrycheercleancoachcrabsdancedrivefortsfuegogameskayakkittylaughmovieninjaoceanpaintpedropianoridesriverscareservesillyteachteasetrackwaterarrestbostonchurchcrouchcruisecuddledonutsgardenkaratepoliceredsoxrescueschool...

Adjectives 2026-05-13

1 Item: CLASSROOM LIBRARY CAFETERIA GYM SCHOOL CLEAN SMALL BIG QUIET

MY SCHOOL 2022-07-22

1 Item: computer room, corridor, dining room, gym, library, playground, toilet.

Absence Word Search 2026-04-19

1 Item: believe library neighbor quite scissors vacuum quiet knowledge foreign

Public Places 2026-04-03

10 Items: The place where you can find many booksThe place where you can deposit and take money.The place where the policemen and policewomen work.The place where you can buy some bread and pastries.The place where you find the Thalys and the Eurostar.The place where you can buy stamples, send letters and packages....

Puzzle Word Search 2025-11-13

22 Items: The gas we breatheA vast body of salt water.A mountain that erupts lava.An event with music and food.Often called man's best friendA person who travels in space.A colorful arc seen after rain.A place where you can find art.A sea creature with eight arms.The largest animal living on landA place full of books for reading....

Black History Month Word Search 2026-03-02

20 Items: Invented the gas maskAn activist and film makerFirst African-American airmenSaid the speech "I have a dream"First person to use a synthesizerCalculated the path for Apollo 11Wrote her first poem at 14 years oldMade the Chicago Defender news paperSecond black women hired by Naval BaseFirst African-American Secretary of State...

Christmas Tree 2025 2025-12-08

37 Items: tall shoeour planetour countrya tall bushlong reptileshouse of bookshome of a crabprecious stonethe fifth monthmakes you drunkwhere you learndo it two timesJesus's birthdayopposite of eastblack/white bearhouse of envelopesopposite of darknessliquid precipitationgood dirt for plantssit in this at schoolwear them during COVIDwhat boxes are made of...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

En La Escuela 2025-12-19

61 Items: mappenfungymdeskdoorbusycalmwhenpaperchairchalkundertiredhappyangrywhen?eraserpencilwindowbehindboringofficepencilsnext toexcitednervouslibraryhallwayproblemnotebookbackpackfar frombathroominside ofon top ofdepressedcafeteriaprincipalcalculator(to)where?in front ofinterestingclock, watchI am (health)near, close toyou are (origin)board, chalkboard...

Unit 7 Word Search 2026-05-04

63 Items: bigparkpooleastwestnearhousebeachriverhotelsmallnorthsouthstreetmarketschoolbakerymuseumprettyby busby carto buyto eatshouldlibrarytheaterancientlocatedbetweennext toon footto swimto readto wearresidentbuildingdowntownfar fromby metroby trainby planeto visitto relaxto drinkcity/townto travelrestaurantclean/neatto walk(1)to walk(2)in front of...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Classrooms 2025-03-12

1 Item: Music Science Computer Restroom Cooking Playground Principal Nurse School Class Arts Craft Gym

Backpack, Word Search 2025-08-21

1 Item: Classroom, Homework, Teacher, Friends, Recess, Lunchbox, Pencil, Notebook, Library, Bus, Playground, ThirdGrade,LyonsFarm, Durham

Language, Word Search 2026-04-09

1 Item: SCHOOL, ENGLISH, TEACHER, LESSON, KOKSHETAU, ADVENTURE, WATERMELON, ANIMAL, HELPFUL, BOOK, CROCODILE, MONTH, DAY, LIBRARY