letters Word Searches

The Inheritance Games 2025-04-22

50 Items: keyNashwillSkyeZaraOrenAveryHarryAlisaLibbychessmoneycodesgamesbribeXanderlawyerwealthdangerfamilyTobiassecretGraysonJamesonheiressbalconycharityriddlespuzzlesfortunetwistedromancemysteryletterscupcakessecuritytreasurethreatenbrothersHawthornepaparazziprivilegeCheckmatepassagewayCalligarisbillionaireinheritancemillionaireexpectationsphilanthropist

I LOVE YOU 2025-05-17

50 Items: HiGymOhhmFijiNateBoldRAWRHugsStephBeachBuenoAussieKachowTempleHellnahRedbullJillianMelindaSunsetsLettersSurfingScrewedCuddlesWarriorsStGeorgeWallDrugImissyouIloveyouSwimmingDecemberIloveyouIloveyouMarriageCrosswordSpidermanSeptemberValentineredcliffsDisneylandBasketballStargazingApplemusicVolunteersSunglassesNoGhostingCaliforniaSouthDakota...

words of love 2023-01-18

51 Items: twogodmiaaribabyninededefourzerokissbabesexylovehokislaughcardssleepgmilfvisitmexicohabibicostcowhinerjeegermonthsvideosfamilywaitingloyaltyjanuaryletterstattoostextinghonestymissingshoppingdecemberbodywasharmenianpicturesphonecallgoodnightblessingssweetgirlchristinesacramentosweetheartdiamondicefriendshipgoodmorningvoretkhaznem

letters c , o 2025-09-17

5 Items: catclockorangeoctopuscomputer

camp 2021-07-05

51 Items: bunkfoodgagagatemoonreadsandbearscanoecardscheerdramaflamegamesgoatskayaklakesmeatsmusicplaysracesslimesmilestarssunnytiredhikinghoorayhotdoghungrynatureorangesoccerspiritsportssprintarcherybonfirecampingfriendsletterstripdaywritingcolorwaricecreammosquitoswimmingpopsicleskangaruachtetherballartsandcrafts

Kittens Word Search 2025-11-01

50 Items: MoonHugsMusicPlaysNishaGiftsStarsChairSleepMoviesBossesFamilyPoetryButtonKiddosTravelDrivesChoresSmilesPagletKittensPuppiesFinanceFriendsBicchooWorkoutFlowersDarlingLettersHampersSalariesFoodgasmScorpionRickshawCutiepieJaanemanDessertsTasklistCleaningBollywoodLifelinesQuestionsNocturnalPlaylistsSoulsisterAlarmclockSweetheartColdcoffeeCheesecake...

Family Fun Forest Of Letters 2020-09-15

9 Items: JEFFLOVENIGHTGAMESFAMILYMOVIESMARIANAALEJANDRAFUNNNNNNNNNNNNNN

The remaining letters (except x!) make an anagram 2025-05-16

43 Items: MazIvyAdaAndCatDogPetHufFunWedJobUniThorLucyTobyTofuNewsBabyMoveRingSteveSimbaChrisBrucePhillJonesBilboBrianDashiDerbyStaceySophieRaynerLarlieHattieSophiaIndianaHarrisonStirlingWheezersSneezersNathanaelAppeasers

Silent Letters and Tricky Vowels (Spanish to English) 2025-10-07

20 Items: musclewhistlekneelingwreckagedoubtfulautumnalheirloomsubtletypsychicsgnashingknowledgeoverwhelmforeignerresigningghostlikerighteouspneumoniaassignmentacknowledgerhythmically

Christmas Word Search 2025-12-01

8 Items: HogfatherDark Is RisingChristmas CarolRedbird ChristmasChristmas MysteryChristmas Chroniclesfrom Father Christmasthe Red Nosed Reindeer

letters to the word, word to the puzzle 2014-03-29

20 Items: redmekojeandeerhawklewisclarkpompecanoejaneyottercorpsborgnebuffalocaptainmoccasinpemmicansacagaweacharbonneauminnetaries

Term 4 - Week 6 - more complex silent letters 2023-11-07

20 Items: tombcomblambnumbdebtclimbthumbcrumbdoubtdougheightknightheightweightboughtplumberalrightfreightthoughtmidnight

The remaining letters (except x!) make an anagram 2025-05-20

43 Items: MazIvyAdaAndCatDogPetHufFunWedJobUniThorLucyIzzyTobyTofuNewsBabyMoveRingSteveSimbaChrisBrucePhillJonesBilboBrianDashiDerbyStaceySophieRaynerLarlieHattieSophiaHarrisonStirlingWheezersSneezersNathanaelAppeasers

Possibly Frustrating Word Search (3 letters or less) 2025-05-21

109 Items: agahbabedagigohahehijokilamunuofonowoxoypapepiqisotatiwexixuyozaabsamuarfbaabezburclycorcuzdaedoddzoeeleldermfetfrafubgawgifgorhajhichypideilkiwijeujorjunkaekhikyuleklezlurmigmmmmycnefnixnoyobaortoxophipwnpyxqatqinquarajrewryashhswysyntettsktygufoumuurpveevlyvomwaiweywofxedxisyaeyerygozekzhozzz

COUNTDOWN - 15th AUGUST 2025 - 8 LETTERS OR MORE 2025-08-18

22 Items: blowsiercorbeilsalienistdaintiesdeinstalidealistlandtieslitaniesreposingspongiergriseousstrigosegorsiestadopterspastoredreadoptscurviestincurvesunrivetsventurisdenialistdisentail

Bit of you & I.. 2024-01-09

44 Items: begjencoldjudykodylanelovemiketimedaviddriveericajamesmusicpowerquoterustystacybeastchancecorinabuzzcuzfriendsheatherlessonsletterspassionpatrickpromiseallnightassholeseleventybackseatbreakevennicknamesericaismsfrontseatconnectioneverythingeverywhereto rememberunconditionalrescuerangershair looks nice

Activities 2024-12-17

50 Items: HIKECARDSGAMESGIFTSBAKINGESCAPELIGHTSMARKETMOVIESPHOTOSPUZZLEBONFIRECOOKINGGARLANDLETTERSPAJAMASPOTLUCKREADINGSKATINGSNOWMANYULELOGCALENDARCAROLINGCRAFTINGGIFTWRAPMARATHONPLAYLISTSHOPPINGSLEDDINGSNOWBALLSWEATERSTREEHUNTWRAPPINGCOUNTDOWNMISTLETOEORNAMENTSSCAVENGERSINGALONGSTOCKINGSSTROLLINGDECORATINGPHOTOSHOOTBAKINGCLASSCANDLELIGHTFESTIVITIES...

Bell Word Search 2025-08-03

50 Items: ELFJOYTOYBELLDOLLDRUMLISTMILKNICESACKSNOWTREEBOOTSCOMETCUPIDGIFTSIGLOOMAGICNORTHSANTASCARFTRAINVIXENDANCERDASHERDONNERFROSTYGLOVESJINGLELIGHTSRIBBONSLEIGHBLITZENCHIMNEYCOOKIESHOLIDAYLETTERSNAUGHTYPRANCERPRESENTRUDOLPHSNOWMANREINDEERSTOCKINGWORKSHOPWRAPPINGCANDYCANECHRISTMASNORTHPOLETEDDYBEAR

Find These Words With Cursive Letters 2025-10-29

11 Items: catdogdotgotjogtagactdiggoatcoattaco

HWR Letters A, B, D, H 2025-09-06

11 Items: DukeAveryDerekArcherAustinBrookeBraxtonBennettBraylinBrielleHarriet

Multisyllable Words with the SILENT letters 2025-10-13

12 Items: debrisresignrhythmcondemnwrestleknowledgehonorablepneumoniaexhaustingassignmentpsychologyfascination

KENTUKY WORDSEARCH PUZZLE 2023-10-05

26 Items: lionfarmsbarnsderbylakeshillszebrahippohorsesriverstrailshikingbourbonforestscampingfishingboatingcyclingwalkingelephantbluegrassmountainsbasketballthoroughbredcatMan's best friendis a 20-word bulleted list of single words about Kentucky, with each word between 4 and 8 letters, plus 3 ten letter words:

The remaining letters (except x!) make an anagram 2025-05-20

44 Items: MazIvyAdaAndCatDogPetHufFunWedJobUniThorLucyIzzyTobyTofuNewsBabyMoveRingSteveSimbaChrisBrucePhillJonesBilboBrianDashiDerbyStaceySophieRaynerLarlieHattieSophiaIndianaHarrisonStirlingWheezersSneezersNathanaelAppeasers

Karen Lopez's Books 2025-05-17

20 Items: PoppyPointCluesDreamHeistSecretAutumnAlliesMullenIt WorksIn Memoryfrom Kansasof the SeasonYou Faint NotComes to VisitCookie MiraclesTumble Spin BinWrong Turn Rightpineapple PirateTide Is Against You

NCSAM 2025 Word Search 2025-10-08

10 Items: Social _____ attackBusiness ____ and Disaster RecoveryThis week's theme, "Your ____ Identity"4 letters; exposure to danger, harm, or lossintelligence that is not real, like sweetenervirus that encrypts your files & demands paymentAttempt to get info from a victim, or jam band from Vermont...

Γ Class - Letters up to J Word Search Puzzle 2025-11-10

27 Items: catanthatdogeggjamjarbearballfishharekiteliondoorgateappletigeriglooorangelizardgardenoctopuscomputerfishbowlkangarooelephanttelephone

Multisyllable Words with Silent Letters Part 2 2025-11-04

12 Items: aislegnawedanswerachingalignedmuscleswouldnthandsomesoftenedknucklesthoroughknowledgeable

Love Word Search 2025-07-08

61 Items: HugJoyGodLoveWifeKissMissHomeBondHopePrayFaithBlissUnionGraceTrustPeaceQueenAdoreHeartVibesSweetProudLaughUnityDreamHappySmileSmilesPhotosPrayerCuddleSpouseWarmthSacredGentleSoldierLettersForeverHusbandLoyaltySupportCoveredCherishBelovedComfortRespectPromiseTogetherMarriageFaithfulBlessingGratefulStrengthDevotionThankfulEncourageSacrificeHomefront...

Love Teachings of the Letters of John 2025-09-08

12 Items: lovelifelightunionsistersinfulforgivebrotheruprightdarknesssacrificecommandment

3 and 4 Letters - COLORS 2020-07-19

7 Items: redbluegreenblackyellowpurpleorange

Winter Word Search 2025-11-27

15 Items: unabandseasonGhiblipigmentdog breedgood grieftrader joesدجاج مع أرزdessert shopmacronutrientlove languagebroccoli cheddar soupwhat I began to write for youwhat you're doing as I rest on your shoulder

Arts and Letters, Module 1, Lessons #1-8 2025-09-18

14 Items: devourtreatyCoyotesustainfluencycultureMonsterNezPercetraditionsurrendergenerationreservationoraltraditionLincolnLetter

Letters P, Q, R, S, T, U, V 2022-12-06

14 Items: uppensofasockvasepandaqueenquietrivertowelturtleviolinrainbowumbrella

Base Word Search 2025-07-08

63 Items: IDAITBaseMailFortArmyCookPlanKeysMoveWeekTimeRentHackSnapBlissMarchStyleDecorClockGoalsFavorSmartDuplexBudgetHustleTrailsDesignVisionSchoolPicnicPhotosBundleStampsSundayFridayDreamsFutureChoiceJacksonMissionLettersMinimalCapsuleNeutralTraineePackageBlessedJourneyInteriorWardrobeMortgageLocationHomebaseChecklistApartmentCertifiedEnvelopesWednesday...

Christmas Word Search 2025-12-09

51 Items: nogBoyTreeColeNoelNicePoleBowscakenoseSantaClausElvesAloneBrownplacePartyCareyBellsplumsPaperdovesringsTinselLightsAngelsGrinchSleighCandleFamilyBakingRudolphSnowmanGarlandGlitterChimneyCookiesNaughtyParadesLettersDecemberOrnamentPresentsCarolersholidaysChristmasReindeersMistletoeStockingsPartridgeDecorating

PEOPLE WHO HELP US 2024-12-23

8 Items: I teachI fix teethI help animalsI bring lettersI put out firesI help sick peopleI drive a police carI drive children to school

Letters of the Week - H and G 2024-05-15

10 Items: hathandgoathousehorseheartgrapesglovesguitargiraffe

Some Letters, Some Love — Just for You 2025-07-16

10 Items: SAFECALMCAREWILLWISHSTEPSSPACEFAITHYEARNFOREVER

COUNTDOWN - 15th August 2025 - 8 LETTERS OR MORE - ALL ROUNDS 2025-08-18

22 Items: BLOWSIERCORBEILSALIENISTDAINTIESDEINSTALIDEALISTLANDTIESLITANIESREPOSINGSPONGIERGRISEOUSSTRIGOSEGORSIESTADOPTERSPASTOREDREADOPTSCURVIESTINCURVESUNRIVETSVENTURISDENIALISTDISENTAIL

letters in the slime 2021-04-15

5 Items: gluebowlbeadsslimemagicliquid

FRANKENSTEIN 2024-12-20

70 Items: LabCarMomIceManSadDayEndFireHopeFearGutsPunkShipTombTreeAlpsDarkLostTripLoveRainCellGuiltGriefShameNovelBonesFleshSteamDeathCrimeRouteDiaryTrialSpellAloneVictorGenevaWaltonNatureArcticGothicGrimlyPrisonAsylumScienceWilliamMonsterShelleyRevengeClervalLettersGraphicBeakersWeddingCreatureJudgmentAmbitionCemeteryElizabethGalvanismLightningBlackmail...

Mi estatus y roles de hijo(a). 2025-01-14

23 Items: sonlovecardsto fixto helpto talklettersadvicesto cooksupportto showto giveparentsmistakesdaughterto appreciatepleasant, niceto do, to makeargument, discussionto be (descriptions)to know people, placesto know information, factsto be (location, feelings)

Coles word search 2024-02-22

10 Items: relativesyou can readopen and closeto put togetherstuff that is ediblehigh body temperaturenot knowing where you aremonsters that will hunt youa system of letters/numbersa puzzle that moves in the ground

Nonfiction 2023-10-13

17 Items: topicessaysjournalsnonfictionstatementscommunicationA small eventCan be proved true.Written by that person.Records of daily eventsWritten by someone else.From one person to another.Order or sequence of events.One asks the other questionsPersonal beliefs; cannot be proved.Meant to explain, persuade, or informDiagrams, maps, charts, and photographs.

Alphabet Word Search 2025-09-14

6 Items: Igloo inhabitantSnickers or Milky WayThe one you like bestOne with very hot breathSource of bread and cookiesLetters the mailman doesn't deliver

Basic Level Tuhfatul Atfaal Wordsearch 2025-02-28

11 Items: a noon without a vowel is called noon__The author calls the letters ع and ح with no dots_______without ghunnah, only happens with the letters ل and رthe______of idgham in the mushaf is a noon without any marks or a staggered tanween.means to be clear. It means to say every letter clearly without an extra nasal sound....

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

MARCUS 2024-12-31

80 Items: WARDSEXYWEEDPROMFOODSARALOVEWIFENIKELAKEBALDTALLSNOWDADABEASTTRAINCOACHINLOVEBARBIEFAMILYCOMICSSPORTSMARCUSSOPHIAAMTRAKUMPIREVAPINGEMINEMHIKINGFATHERDRILLSBIGAIRMOVIESDRILLSVISIONSGEORGIAWEDDINGRUNNINGHUSBANDSMOKINGRAPPINGHOODRATCHICAGOFLORIDAUNIFORMLETTERSHANDSOMEBASEBALLOUTGOINGBEEFSTEWMARRIAGECONVERSEDAUGHTERROADTRIPMARCHINGILLINOISMARCHING...

Know your Keyboard 2025-05-26

6 Items: longest keyto go to a new linekey used to type numberskey used to type letterskeys perform special functionkeys key to move up, down, right and left

April Word Search (how many letters in parentheses) 2023-10-19

10 Items: Take ____ to document damage.(11)Pivot, do not ____ if you need to turn.(5)Repetitive motion can exhaust ____ quickly.(7)Report incidents of physical damage through ____.(13)Sustained postures can cause muscle ____ over time.(7)What room is the main water shut off valve located?(11)Do not lift more than ____ pounds without assistance.(5)...

Find All NATO Phonetic Alphabet Numbers and Letters for Candy :) - From S.S. 2024-12-11

36 Items: WunTooSixAitAlfaEchoGolfKiloLimaMikePapaXrayZuluTreeFifeBravoDeltaHotelIndiaOscarRomeoTangoFowerSevenNinerZeeroQuebecSierraVictorYankeeCharlieFoxtrotJuliettUniformWhiskeyNovember

SERIES 92 : RNCTIAEOG : GAME 026 RND 5: 7 and 8 LETTERS ONLY 2025-08-09

46 Items: ACONITEACROGENANERGICARGOTICCAROTINCARTINGCERTAINCIGARETCOATINGCOGNATECOINAGECRATINGCREATINERGOTICEROTICAGENITORGRANITEINGRATENEGATORNOTICERORATINGORGANICTANGIERTEARINGTRACINGANOETICCORNAGECORTINACOTINGAGOATIERNACRITEOCTRAINOTARINERECTIONTRIGONEANORETICARGENTICCATERINGCREATINGCREATIONGERONTICREACTINGREACTIONACTIONERCITRANGERECOATING

One Year Anniversary Search 2025-12-04

23 Items: LoveKoreaTexasKamrynOneyearLettersAirportSungjoonage we metInternationalMost made dishAnniversary datewhere we first metfirst official datemy nickname for himmost used app to callFirst holiday together200 day anniversary spotwhere we had our first kissFirst place traveled togetheranimal of keychain he gifted meeachothers favorite physical feature...

Broadcast Journalism Busywork 2025-03-19

12 Items: Highest paid YouTuber during 2021:What news anchors use to read off the news:Also known as a "talking head"; think of an interview:When interviewing, you should ask ________-ended questions."Montana is the most beautiful U.S. state" is a(n)__________.Name of organization that measures TV and Netflix show ratings:...

God Exists as Creator - Design #3 2025-11-12

12 Items: ________ 19:1.____________ 1:20.____________ 1:1-3.Six feet long in a cell.Every _________ has a designer.Every design has a ____________.Information comes from a _______.DNA is the recipe for p_ _ _ _ _ _.DNA is an alphabet of _____ letters.Proteins build ___________ in the body.We are fearfully and ____________________ made....

stabby's spooky word search!!! 2024-10-20

5 Items: the "G" in MMORPGthe opposite of "me"Lady Gaga song "____Dance"three letters at the beginning of clue 3the group of boys in Neverland were called the ____ boys

Friendship, Word Search 2025-02-04

2 Items: surprises,affection, priest, couples, marriages, letters, soldiers

Angel Word Search 2025-12-06

80 Items: BOWLOUICEJOYMAXREDBELLCANECOZYYEARNICENOELPOLESUITSNOWSTARTOYSTREEANGELCOMETCUPIDELVESGREENHEARTHO HOHOLLYBELLSMERRYCLAUSPEACECLAUSVIXENPAPERBRIGHTCAROLSDANCERDASHERDONNEREGGNOGFAMILYFROSTYGRINCHSKATESICICLELIGHTSSPIRITTINSELWINTERBLITZENCHIMNEYCOOKIESFRIENDSGARLANDHOLIDAYLETTERSMIRACLENAUGHTYPRANCERRUDOLPHSCROOGESNOWMANSWEATERCHESTNUTCHILDREN...

CAMP 2025-08-05

87 Items: MapTagBunkCupsFernRopeTentBirchBootsCabinCanoeCardsCreekDanceDiaryGamesKayakLodgeMuddyPaintRiverSongsTicksTrailTreesCanopyChoresCraftsForestHikingLeavesNatureRangerScoutsSmoresTieDyeArcheryBandanaBerriesBlanketBoatingBonfireCaptureCompassExploreFishingFlannelGigglesHammockInsectsJournalLanyardLanternLettersNeedlesNoodlesPatchesPioneerRaftingWhistle...

FIND THAT DFO 2025-09-17

23 Items: VMDLEGALPOWERLEVELRETURN15118649ACUUMOTIVESPHEREMENITTOLL/CUSTOMSNON-PROCESSINGBANK GUARANTEEDUNNING LETTERSCRUCIAL SUPPLIERCLAIM FOR DAMAGAESUnable to be foundINTERNAL ESCALATIONHALT OF DISTRIBUTIONPayment for customerPARTNER OR ASSOCIATEDACCOUNT RECONCILIATIONINVOICE TYPE 5(D) AND 7(D)To settle a debt or obligation with money...

Disney 2024-10-07

6 Items: owner is meghan Peytonis a cucumber in veggie talesare nine letters in miss piggymouses girlfriend is Minnie mouseworking for the weekday is ihops jingle.is where Mary Margaret lives in once upon a time.

BLUE MOON - All the words contain either the letters of BLUE or MOON 2025-08-12

50 Items: ALBUMENBAUBLESBIOFUELBLUBBERBLUEFINBLUESKYBLUNDERBLURBEDBLURTEDBLUSTERBUBBLEDBUGLERSBULKIERBULLIEDBUMBLEDBUNGLEDBURGLEDBUSHELSBUTLERSCLUBBEDCUBICLECURABLEDOUBLETEQUABLEGLOBULEHUMBLEDJUMBLEDLUMBERSNEBULARPLUMBERREBUILDRUBELLASLUMBERSTUBBLESUBLIMETABLEAUTUBEFULUSEABLEBOOKMANCOMMONSDOMINOSDOORMANEMOTIONGOODMANHOMONYMHORMONEMANHOODMONOPODMOONERSMORONIC

CODE OSCILLATOR CIRCUIT 2024-12-11

10 Items: The letter S is made up of ____________ dots.The letter A is made up of a Dot and a ______________ .What pin on the 555 Integrated Circuit emits the pulses?The ______________ is the device that emits the audio tones.This circuit is an audio _______________ circuit used to emit tones....

INTRO and UNIT 1 OCTOBER 2025-10-08

20 Items: ViajeCollarEsquinaPulseraNubladoRotonda.PendientesParque infantilHacer ejercicioEn el extranjero.Plaza mayor (two words).A place where money is kept.You use it to cross a river.Hacer turismo / ver monumentosA place where products are made.The room where you have a shower.Patinaje sobre hielo (two words).To go for a walk in the mountains....

Golden Egg hunt 2025-04-14

11 Items: - "XXX LOTR"- Chicken lays an..- Colour like blonde- Another word for within- Another word for souvenir- Another word for concealed- Another word for without risk- Mix blue and yellow to get ???- A verb and two letters like "if"- We should take take of XXX environment...

Computer Definitions 2023-11-09

12 Items: Phishing - A type of email/message sent by scammersMouse- A small device that allows us to point and clickBackspace - the key used to delete letters to the left.Email - A electronic message sent through the internet.Attachments - Files or photos that are added to a email.Printer - A device used to print paper copies of a document....

Index Laws 1 to 5 2023-08-29

15 Items: The simplest way to write a number.Writing a number using a base and an exponent.Any number (except zero) to this power is always 1.Letters that stand in for numbers we don't know yet.A diagram used to find the prime factors of a number.Writing a number out as a product of all its factors.Making a math expression as easy to read as possible....

Elements and Compounds 2024-12-16

14 Items: Form when two or more different elements combineIt is a substance that is dissolved in a solventIt is the result of dissolving a solute in a solventIt is a substance which can dissolve other substancesA mixture in which the composition is uniform throughoutIt is the act of decreasing the concentration of a solution...

Precede Word Search 2025-12-06

97 Items: artdownrainfearhopehomeglowneonfatelovehurtbyersgirlsheartangstphonedanddtrustpartyguiltstormlinescrazyorbittruthmemorysummerarcadeclosetrescuesafetyunsaidnightswarmthhawkinswheelerknowingsubtextreunionlongingletterstensionsecretscourageshelterwalkmanmixtapeemotionreunionpromisedoorwayepicenehonestyhealingbraveryhellfirepaintingvansceneelectric...

Boralandic Slang 2024-11-03

16 Items: badheroicforeverSomething that is a messa euphemism for the end.an unexpected delay or problem.the medieval name for Boraland.Boralandic for truth (tre-sla).Boralandic for hello (saw-veck).the Boralndic version of minutescoffee. Some pronounce it “nee-tro.”a nickname for a soldier that’s lucky.a nickname for a fresh soldier/recruit...

Random stuff 2021-02-17

97 Items: meInRedLOLdayGymBadOutCarPenHatJobBluePinkNameTimeFoodMathGoodNiceYellTalkBallForkBowlCoatFallDoneRaceGoodAdoptGreenDrinkStuffCleanMessyFixedDanceShoutKnifeSpoonSporkPlateStoreGloveScarfBootsShoesWordsStartOrangeYellowPurpleCheeseEasterSocialRandomBrokenGoogleSoccerCerealMeijerTargetCostcoChilisPencilMarkerSummerWinterSpringAutumnSearchGiraffe...

100-Words! 2025-05-11

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

LANGUAGE BUILDER 2024-04-07

19 Items: Toà nhàVăn phòngQuầy lễ tânNhà vệ sinhOpposite to nearOpposite to leftOpposite to openOpposite to fullOpposite to earlyOpposite to largeYou buy medicine hereWhere you play sportsYou park your car hereYour money is safe hereYou can buy anything hereATM is another term for thisYou send letters, parcels here.You can read or borrow books here...

Enlace 3rd 2025-04-08

27 Items: principalLibrariansecurity duoschool mascotraul wears a?one counselorenlace teacherDoms last nameopposite of #4jaydens nicknamewon world seriessecond counselorsuperbowl champsboys championshipgirls championshippopular chip snackHer name 3 lettersother security duo3rd planet from sunfemale college champs"the soup" in spanishkendric yells word (m)...

Christmas Word Search 2025-11-18

99 Items: ElfBowTreeNiceSnowToysBellListCoalStarMarvNoelPineSledSnowCoalCometDonerVixenCupidGiftsSyrupCandyBuddyHarryAngelJollyLightsDasherDancerSleighWreathEggNogFamilyIcicleCarolsTinselAdventRibbonFrostyGrinchAngelsRudolphBlitzenPrancerNaughtyBelieveGarlandCookiesYuleLogCandlesSnowmanChimneyRedNoseCarrotsVillageRedSuitScroogeTinyTimLettersReindeerPresents...

Letters and Numbers search:- Find the letter and number combinations hidden in the grid below 2025-01-23

20 Items: Z0G5S4UYBC740G9ND7Q3DAH9DY1P5SB64IBRE7LDG5ZAUJPTQB8F0OO18ZO2H96GX9JA42UF2B0GPM10

Input and Output Devices 2025-05-16

7 Items: I am used to type lettersI am used in playing gamesI am used to get the printsI am also called Visual Display UnitI am used to display over a big screenI am used to select anything on the monitorI am used to convert printed doc into electronic formats

Winter/Christmas Wordearch 2024-11-22

110 Items: hatpieicebadredfuntreesnowsledcoatstarcoalparkcakemilksaltconelistgoodgoldbowsjudeigloohappyjollysantascarfbootspartybellsmusicgreenmagicjamesshovellightscarroteggnogsleighbeanieturkeymovieswinterauroraglovesbasketcandleskiingangelsgamilygrinchsilveryellowspiritfamilyjackieameliasnowmanpopcorncookiespenguinskatingchimneybrowniemarketslettersanimals...

School Word Search 2025-07-30

8 Items: a place where you can buy thingsa place where children go to learna quiet place to read and borrow booksstation a place where firefighters worka place where sick or hurt people get helpstation a place where police officers worka place where people play and relax outsideoffice a place where you send letters and packages

Who Was Louis Braille? 2023-12-12

20 Items: Louis cried out in terrible ____!Louis was a bright and _______ boy.His father carved him a wooden ____.Louis _____d the letters with his fingers.It would be hard to be ________d from their son.Simon-René spent most of the time at his _________.By the time he was four, Louis was __________ blind.Louis was __________ with all the tools on the bench....

English Terms 2025-02-04

9 Items: Being over the top.A short personal story.Giving an object a human feature.A comparison using 'like' or 'as'.Words that have an audible effect.Same letters used at the start of words.Words used to create an image in the reader's mind.A comparison that states one thing is something else.Repetition of a word or phrase at the start of a line.

MATH VOCAB 2025-10-08

9 Items: algebraic terms that have the exact same variable(s)figures have the same shape but not necessarily the same sizean equation that is true for all values of the variables involveda way to express a fraction or ratio of a part compared to a whole or out of one hundred...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Vocab for Projekt 1065 by Alan Gratz 2024-04-26

12 Items: A wild uproarA strong backpackTo travel quickly.To greatly desire somethingSomeone who is corrupt or troubledAnger that is from unfair treatmentWriting and receiving letters back and forthTo have a strong smell of taste that isn't goodA place that has been set for military equipmentTo make lots of noise when you cry uncontrollably...

Chayei Sarah 2024-11-17

18 Items: אָבִינוּחַיַּי שָׂרָהRebekkah’s fatherAbraham’s servantRebekkah’s brotherThe first matriarchSarai means ________“to boast about G-d”Abraham’s other wife.King David’s personal prophet.This son of Abraham lived to 137The city in which Sarah is buried.These 2 Hebrew letters spell “father”This Hebrew letter represents revelation....

LETTER A.3-4 LETTERS WORDS STARTING LETTER A 2022-12-04

6 Items: aceactarkarmantaxe

David Berkowitz Word Search 2025-01-09

10 Items: Target of his attacks.Gun used in his shooting sprees.His reason for targeting young women.What he sent during his killing sprees.Type of bullet found at his crime scenes.The supposed motifortion of his killings.Where he served for part of his sentence.Person who inspired his alias "Son of Sam."Alias David Berkowitz used during his killings....

The Gift of Magi pgs. 12-16 2023-09-15

14 Items: Where did Della live?Where was Della sitting?What was Della counting?What day is it tomorrow?How much is James's salary?How many cents did Della have?What did Della do for so long?Who is James Dillingham Young?What was too small for letters?What is the main character's name?What did Della ask for at the grocery?...

Technology vocabulary 2024-07-11

7 Items: Very popular on the internetYour online opinion about somethingA picture of yourself with your smartphoneA piece of equipment to make your voice louderInformation about about yourself on a social media siteTo transfer data or files from a computer to the internetInput gadget to enter letters, numbers, and other symbols into a computer

Word Search 2025-04-26

5 Items: To __ or not to __Call it what you __What I've been meaning to ask youA pronoun used to refer to the person or people that the speaker is addressing.Of or relating to me or myself especially as possessor, agent, object of an action, or familiar person (2 letters)

Unit 5: Spelling Lesson 1 2023-01-12

25 Items: composed of onefoolish or sillyan eating establishmentcomposed of more than onea shortened form of a wordslanted cursive or type characterscomprising everything; comprehensiveconsisting of diverse things or membershappening as a minor result or by chancethat which had being before something elseuninfluenced by emotion; based on the factual...

Paragraphs and Essay Writing 2025-11-05

16 Items: finishinga big lettera small letterwhat it is aboutto make a letter bigfirst, _________, third5 paragraph writing assignmentthe world's best baseball teama book with words and synonymsa book with words and definitionsa group of sentences with a related topica phrase that you write at the top centerthere are 26 of these in the English alphabet...

Kitsunebi 2025-04-12

115 Items: JoyRawAcheDeepFearHopeHuntHurtLossLoveNamiOpenPainSoulVoidAgonyAngerEmberEmptyFearsGriefGuideGuiltJapanLightQuietRishuStormTearsTrustCommitForestGentlyHealedHonestMemoryMissedNatureScaredSobbedSolaceSorrowStrokeTraumaWarmthWeaklyWolvesWorthyAnxietyAshamedBoulderCherishComfortConcernDullingEmpathyEnduredForgiveGaspingHealingImmenseLettersLonging...

Jobs 2025-11-25

7 Items: the safety of citizens and enforces the lawstudents in school and provides them with knowledgetreat sick patients and prescribes medicine for themcarries letters and parcels between people and placesresponsible for taking care of the family and the homeuse tools likea plow and scythe to grow crops and feeds us...

Monday's not coming by Tiffany D. Jackson 2024-11-29

16 Items: Name of the highschool?What happened to Monday?Name of Monday's sister?Name of Claudia's church?What sound haunted Claudia?What is Monday's moms name?Name of the housing complex?What is Claudia's dads name?Monday's favorite color was?Name of Claudia's boyfriend?Where did everyone think Monday went?What color was the house they spent time in?...

35 2025-08-17

15 Items: Independent biker.Riding across the U.S.Central U.S. biker route.Non-member showing loyalty.Ride through desert states.Strong biker culture region.Banner featuring the motor club’s emblemEssential gear for motor club bike upkeepLarge flag representing the motorcycle clubBasic set of letters used for communication...

Math Word Search 2025-06-21

10 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to stay healthyA subject where you practice letters and words...

Week 3 Review by Sharli Syed 2023-11-05

11 Items: Makes proteinsBreaks down food into energyInformation for making proteinsPackages and sends proteins out of the cellContains and protects genetic material (DNA)Breaks down and recycles worn out animal cellsCellular package containing products such as proteinHolds everything inside the cell, enclosed by the cell membrane...

SOF final project 2024-06-05

15 Items: Putting values where the letters area polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic sectiona quantity that may be changed according to the mathematical problem...

Patti's Word Search 2023-01-20

24 Items: Involved animalCommitted animalPredicting effortTemporal limitationA weird water carafeAKA Leonardo of PisaPenultimate ceremonyDelta x over delta tShort consistent cycleBefuddled interrogativeHow much can we completeBreaks down into storiesEvery morning, with a rockPrioritized work to be doneWe do this with the backlogSlows or hinders productivity...