letters Word Searches

Christmas Word Search 2025-12-01

8 Items: HogfatherDark Is RisingChristmas CarolRedbird ChristmasChristmas MysteryChristmas Chroniclesfrom Father Christmasthe Red Nosed Reindeer

Multisyllable Words with the SILENT letters 2025-10-13

12 Items: debrisresignrhythmcondemnwrestleknowledgehonorablepneumoniaexhaustingassignmentpsychologyfascination

Find These Words With Cursive Letters 2025-10-29

11 Items: catdogdotgotjogtagactdiggoatcoattaco

The remaining letters (except x!) make an anagram 2025-05-20

44 Items: MazIvyAdaAndCatDogPetHufFunWedJobUniThorLucyIzzyTobyTofuNewsBabyMoveRingSteveSimbaChrisBrucePhillJonesBilboBrianDashiDerbyStaceySophieRaynerLarlieHattieSophiaIndianaHarrisonStirlingWheezersSneezersNathanaelAppeasers

Common words with irregular pronunciation and silent letters 2026-02-23

20 Items: ofteneverycamerafamilylibraryFebruaryinterestordinarybusinessseparateprobablydifferentchocolatevegetablefavouriteWednesdayeverythingrestaurantcomfortabletemperature

KENTUKY WORDSEARCH PUZZLE 2023-10-05

26 Items: lionfarmsbarnsderbylakeshillszebrahippohorsesriverstrailshikingbourbonforestscampingfishingboatingcyclingwalkingelephantbluegrassmountainsbasketballthoroughbredcatMan's best friendis a 20-word bulleted list of single words about Kentucky, with each word between 4 and 8 letters, plus 3 ten letter words:

Writing Letters on a Quiet Afternoon 2026-03-08

10 Items: PENINKNOTEDESKSTAMPPAPERLETTERDRAWERENVELOPEPOSTCARD

Summer 1 Week 2 Silent letters 2026-04-19

10 Items: halfcalmwriteknifeknockthumbdoubtislandanswerwrapper

hard 2026-05-07

6 Items: hard24------6Mary Poppinsbruh, 100 lettersmy best friend lolthe best teacher ever

Karen Lopez's Books 2025-05-17

20 Items: PoppyPointCluesDreamHeistSecretAutumnAlliesMullenIt WorksIn Memoryfrom Kansasof the SeasonYou Faint NotComes to VisitCookie MiraclesTumble Spin BinWrong Turn Rightpineapple PirateTide Is Against You

NCSAM 2025 Word Search 2025-10-08

10 Items: Social _____ attackBusiness ____ and Disaster RecoveryThis week's theme, "Your ____ Identity"4 letters; exposure to danger, harm, or lossintelligence that is not real, like sweetenervirus that encrypts your files & demands paymentAttempt to get info from a victim, or jam band from Vermont...

3 and 4 Letters - COLORS 2020-07-19

7 Items: redbluegreenblackyellowpurpleorange

Γ Class - Letters up to J Word Search Puzzle 2025-11-10

27 Items: catanthatdogeggjamjarbearballfishharekiteliondoorgateappletigeriglooorangelizardgardenoctopuscomputerfishbowlkangarooelephanttelephone

Multisyllable Words with Silent Letters Part 2 2025-11-04

12 Items: aislegnawedanswerachingalignedmuscleswouldnthandsomesoftenedknucklesthoroughknowledgeable

Love Teachings of the Letters of John 2025-09-08

12 Items: lovelifelightunionsistersinfulforgivebrotheruprightdarknesssacrificecommandment

Love Word Search 2025-07-08

61 Items: HugJoyGodLoveWifeKissMissHomeBondHopePrayFaithBlissUnionGraceTrustPeaceQueenAdoreHeartVibesSweetProudLaughUnityDreamHappySmileSmilesPhotosPrayerCuddleSpouseWarmthSacredGentleSoldierLettersForeverHusbandLoyaltySupportCoveredCherishBelovedComfortRespectPromiseTogetherMarriageFaithfulBlessingGratefulStrengthDevotionThankfulEncourageSacrificeHomefront...

Brian's Word Search By Debbie 2026-03-21

60 Items: janleoobiJyndouggenehugskisslovemissreumryanmailcoltbrentbrucebriandavidsheepkarlylarrylauramusicreesepizzatartsmilestrustcoffeeheartsdreamsmarcusdonairmaxinefamilycaringdebbieshereemorningmelanietextingwalkingletterspicklesgenesischarmingharrisonsunshinepaintingkindnesssnickershotpoolschevroletvancouveraffectionroadtripsbirthdaysmoodrings...

hardest 2026-04-26

63 Items: gomeascatdogyoucanillnewwinhatdadmomsonsunantgodbabyevilmeankidalovelilybankkisspoolhardyourfindcantmademakewesteastfoodfishlowaneckladystarohiocasenoontwinsfunnyfunnynorthsouthmexiotexasrabbitturdlecanadapurpleobjecthawaiisundaygeorgialettersfloridacaroinaladybugsaterday

Arts and Letters, Module 1, Lessons #1-8 2025-09-18

14 Items: devourtreatyCoyotesustainfluencycultureMonsterNezPercetraditionsurrendergenerationreservationoraltraditionLincolnLetter

Letters P, Q, R, S, T, U, V 2022-12-06

14 Items: uppensofasockvasepandaqueenquietrivertowelturtleviolinrainbowumbrella

words ending with s and es 2026-06-18

64 Items: boysdayspaysasksrunssitspartsrocksgirlsbusesnamespagesboxeslampsdesksrocksgrowsplayscallshearsmakesmeetsneedssellsmixeslivesjumpssendsfindsfeelsopenslooksshowsfixesbushestableshousesplacesapplesdishessashespassesspeaksrushesspendsstartsofferspushesrushesmarkersbunchesmuffinsbenchesclassesnumbersdressesmarkerspillowslettersreportsmatchesreaches...

Winter Word Search 2025-11-27

15 Items: unabandseasonGhiblipigmentdog breedgood grieftrader joesدجاج مع أرزdessert shopmacronutrientlove languagebroccoli cheddar soupwhat I began to write for youwhat you're doing as I rest on your shoulder

Ancient World History | David 2026-04-21

10 Items: Pilate was a ______the Jews _____ the RomansJesus fulfilled the laws of MosesJoseph was from the line of this manChristianity was made ________ in 313 ADThe dynasty that Judea was under Roman RuleHe blamed the Christians for the fire in 64 ADHe wrote 7 letters to the churches of Asia MinorThe councils of Hippo and Carthage were at this location...

Base Word Search 2025-07-08

63 Items: IDAITBaseMailFortArmyCookPlanKeysMoveWeekTimeRentHackSnapBlissMarchStyleDecorClockGoalsFavorSmartDuplexBudgetHustleTrailsDesignVisionSchoolPicnicPhotosBundleStampsSundayFridayDreamsFutureChoiceJacksonMissionLettersMinimalCapsuleNeutralTraineePackageBlessedJourneyInteriorWardrobeMortgageLocationHomebaseChecklistApartmentCertifiedEnvelopesWednesday...

Christmas Word Search 2025-12-09

51 Items: nogBoyTreeColeNoelNicePoleBowscakenoseSantaClausElvesAloneBrownplacePartyCareyBellsplumsPaperdovesringsTinselLightsAngelsGrinchSleighCandleFamilyBakingRudolphSnowmanGarlandGlitterChimneyCookiesNaughtyParadesLettersDecemberOrnamentPresentsCarolersholidaysChristmasReindeersMistletoeStockingsPartridgeDecorating

The Greatest Showman 2026-05-30

66 Items: firelovetentmusicdogboyhorsestophatballetuniquecircusinjuryabsentzendayatrapezebritainnewyorkscandaldancingletterstragedythisismezacefronstunningbetrayalprotestsfightingwdwheelertattoomanjennylindcomealivetightropefromnowonelephantsmomentaryplaywritehomeagainlettielutzthegeneralringmasterheartbreakinequalityhelenbarnumannewheelerneverenough...

COUNTDOWN - 15th August 2025 - 8 LETTERS OR MORE - ALL ROUNDS 2025-08-18

22 Items: BLOWSIERCORBEILSALIENISTDAINTIESDEINSTALIDEALISTLANDTIESLITANIESREPOSINGSPONGIERGRISEOUSSTRIGOSEGORSIESTADOPTERSPASTOREDREADOPTSCURVIESTINCURVESUNRIVETSVENTURISDENIALISTDISENTAIL

P 6 Spelling words 2nd February Rule 11 – silent letters 2026-02-01

26 Items: gnaw​knee​knit​knot​wrap​gnarl​gnome​knife​knock​sword​wreck​write​wrong​GalaxyLizardknight​knuckle​wrestle​wriggle​TerrifiedBeautifulDifferentAstronautPeacefullyApproachedInteresting

PEOPLE WHO HELP US 2024-12-23

8 Items: I teachI fix teethI help animalsI bring lettersI put out firesI help sick peopleI drive a police carI drive children to school

Letters of the Week - H and G 2024-05-15

10 Items: hathandgoathousehorseheartgrapesglovesguitargiraffe

Some Letters, Some Love — Just for You 2025-07-16

10 Items: SAFECALMCAREWILLWISHSTEPSSPACEFAITHYEARNFOREVER

letters in the slime 2021-04-15

5 Items: gluebowlbeadsslimemagicliquid

Red Word Search 2026-03-02

2 Items: REDLetters

more random stuff 2026-03-10

8 Items: ____you had funshort root plantand then goodbyehe would love firstwhat would jesus do?my fav mountain dew flavornow you know your alphabet!random letters-your welcome!-

Databases intro 2025-12-17

29 Items: tulpridavälitähedkirjetäpnevanusvalemlisamaotsimavalimaandmedteenusedsümbolidarvutamastruktuursisaldamatööriistadsorteerimajärjestamaandmebaasidsalvestatudpilt, kujutissobituma, mahtumatõusev (järjestus)laskuv (järjestus)talletama, salvestamavormindus, vormindamakümnendmurd, kümnendarv

FRANKENSTEIN 2024-12-20

70 Items: LabCarMomIceManSadDayEndFireHopeFearGutsPunkShipTombTreeAlpsDarkLostTripLoveRainCellGuiltGriefShameNovelBonesFleshSteamDeathCrimeRouteDiaryTrialSpellAloneVictorGenevaWaltonNatureArcticGothicGrimlyPrisonAsylumScienceWilliamMonsterShelleyRevengeClervalLettersGraphicBeakersWeddingCreatureJudgmentAmbitionCemeteryElizabethGalvanismLightningBlackmail...

Medical terminology roots, suffixs and prefixs 2026-05-15

21 Items: slowskinfastpainheartbloodnervejointdiseasestomachdiseasediffucltstudy ofsurgicalexcessivedecreasedinflmationcutting intoGives the basic meaning of a terma group of letteres or a letter before a worda letter or a group of letters at the end of a word

Mi estatus y roles de hijo(a). 2025-01-14

23 Items: sonlovecardsto fixto helpto talklettersadvicesto cooksupportto showto giveparentsmistakesdaughterto appreciatepleasant, niceto do, to makeargument, discussionto be (descriptions)to know people, placesto know information, factsto be (location, feelings)

Nonfiction 2023-10-13

17 Items: topicessaysjournalsnonfictionstatementscommunicationA small eventCan be proved true.Written by that person.Records of daily eventsWritten by someone else.From one person to another.Order or sequence of events.One asks the other questionsPersonal beliefs; cannot be proved.Meant to explain, persuade, or informDiagrams, maps, charts, and photographs.

Coles word search 2024-02-22

10 Items: relativesyou can readopen and closeto put togetherstuff that is ediblehigh body temperaturenot knowing where you aremonsters that will hunt youa system of letters/numbersa puzzle that moves in the ground

Welcome Back Year 3/4 2026-04-18

70 Items: MiaArtEllaEricSeanSethTygaZaraHASSglueodinhuttriseChloeClaraDylanJacobSonammathsmusiclunchwordsbooksrulernovelAmeliaBiancaJoshuaPeytonhealthRecesstextaseraserstriveAavishiDevanshDominicRiyanshreadingwritingviewingscienceItaliannumbersletterspencilslibrarywaltersanswersrespectincludeexploreShivanshswimmingspellinghomeworkassemblyAnnabelleComputers...

Alphabet Word Search 2025-09-14

6 Items: Igloo inhabitantSnickers or Milky WayThe one you like bestOne with very hot breathSource of bread and cookiesLetters the mailman doesn't deliver

Welcome Back Year 3/4 2026-04-18

70 Items: MiaArtEllaEricSeanSethTygaZaraHASSglueodinhuttriseChloeClaraDylanJacobSonammathsmusiclunchwordsbooksrulernovelAmeliaBiancaJoshuaPeytonhealthRecesstextaseraserstriveAavishiDevanshDominicRiyanshreadingwritingviewingscienceItaliannumbersletterspencilslibrarywaltersanswersrespectincludeexploreShivanshswimmingspellinghomeworkassemblyAnnabelleComputers...

Basic Level Tuhfatul Atfaal Wordsearch 2025-02-28

11 Items: a noon without a vowel is called noon__The author calls the letters ع and ح with no dots_______without ghunnah, only happens with the letters ل and رthe______of idgham in the mushaf is a noon without any marks or a staggered tanween.means to be clear. It means to say every letter clearly without an extra nasal sound....

February Word Search 2026-01-22

75 Items: JoyRedLoveCozySnowColdGiftPinkKindHopeCalmHeartSmileCheerUnityPeaceTrustSweetFrostScarfCocoaCandyTreatNotesFocusCaringHonestGivingWarmthWinterGrowthValuesRespectSharingSupportHelpfulMittensSweaterLettersMessageServiceEmpathyBalanceFebruaryKindnessThankfulPositiveTogetherTeamworkPatienceLearningValentineHappinessCommunityFireplaceChocolateHeartfelt...

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

MARCUS 2024-12-31

80 Items: WARDSEXYWEEDPROMFOODSARALOVEWIFENIKELAKEBALDTALLSNOWDADABEASTTRAINCOACHINLOVEBARBIEFAMILYCOMICSSPORTSMARCUSSOPHIAAMTRAKUMPIREVAPINGEMINEMHIKINGFATHERDRILLSBIGAIRMOVIESDRILLSVISIONSGEORGIAWEDDINGRUNNINGHUSBANDSMOKINGRAPPINGHOODRATCHICAGOFLORIDAUNIFORMLETTERSHANDSOMEBASEBALLOUTGOINGBEEFSTEWMARRIAGECONVERSEDAUGHTERROADTRIPMARCHINGILLINOISMARCHING...

Know your Keyboard 2025-05-26

6 Items: longest keyto go to a new linekey used to type numberskey used to type letterskeys perform special functionkeys key to move up, down, right and left

April Word Search (how many letters in parentheses) 2023-10-19

10 Items: Take ____ to document damage.(11)Pivot, do not ____ if you need to turn.(5)Repetitive motion can exhaust ____ quickly.(7)Report incidents of physical damage through ____.(13)Sustained postures can cause muscle ____ over time.(7)What room is the main water shut off valve located?(11)Do not lift more than ____ pounds without assistance.(5)...

slayyyter 2026-02-03

79 Items: bffmineeboyiconalonecandydevilurmanvenompurrrcranktommytattoocloudsmybodymakeupimhighhiccupitgirldaddyafghostttcowboysvillainlettersplasticnocommamachinestloserchachingdoghouseoverthisdramaticoperatorslayyytercelebrityoutoftimejamesdeanstupidboydolcevitabodycountdifficultemotionalglamorouslovemenotmanenoughnovacancypinkrosesoldflingsmotorcycle...

Find All NATO Phonetic Alphabet Numbers and Letters for Candy :) - From S.S. 2024-12-11

36 Items: WunTooSixAitAlfaEchoGolfKiloLimaMikePapaXrayZuluTreeFifeBravoDeltaHotelIndiaOscarRomeoTangoFowerSevenNinerZeeroQuebecSierraVictorYankeeCharlieFoxtrotJuliettUniformWhiskeyNovember

SERIES 92 : RNCTIAEOG : GAME 026 RND 5: 7 and 8 LETTERS ONLY 2025-08-09

46 Items: ACONITEACROGENANERGICARGOTICCAROTINCARTINGCERTAINCIGARETCOATINGCOGNATECOINAGECRATINGCREATINERGOTICEROTICAGENITORGRANITEINGRATENEGATORNOTICERORATINGORGANICTANGIERTEARINGTRACINGANOETICCORNAGECORTINACOTINGAGOATIERNACRITEOCTRAINOTARINERECTIONTRIGONEANORETICARGENTICCATERINGCREATINGCREATIONGERONTICREACTINGREACTIONACTIONERCITRANGERECOATING

phon-tastic words 2026-01-13

8 Items: speech sounds (phonetics)elaborate blend of music (symphony)connects sounds to letters (phonics)the transmission of voices (telephone)device to make sound louder (megaphone)harsh discordant mix of sound (cacophony)converting sound to electricity (microphone)words sound the same but spelled different (homophone)

One Year Anniversary Search 2025-12-04

23 Items: LoveKoreaTexasKamrynOneyearLettersAirportSungjoonage we metInternationalMost made dishAnniversary datewhere we first metfirst official datemy nickname for himmost used app to callFirst holiday together200 day anniversary spotwhere we had our first kissFirst place traveled togetheranimal of keychain he gifted meeachothers favorite physical feature...

Broadcast Journalism Busywork 2025-03-19

12 Items: Highest paid YouTuber during 2021:What news anchors use to read off the news:Also known as a "talking head"; think of an interview:When interviewing, you should ask ________-ended questions."Montana is the most beautiful U.S. state" is a(n)__________.Name of organization that measures TV and Netflix show ratings:...

God Exists as Creator - Design #3 2025-11-12

12 Items: ________ 19:1.____________ 1:20.____________ 1:1-3.Six feet long in a cell.Every _________ has a designer.Every design has a ____________.Information comes from a _______.DNA is the recipe for p_ _ _ _ _ _.DNA is an alphabet of _____ letters.Proteins build ___________ in the body.We are fearfully and ____________________ made....

Medicine Word Search 2026-01-12

85 Items: NapWrapDozeYawnHeatDiceSignPageCartChewPeelSaltSoupRestTreatRelaxBrothSteamGamesCardsChalkWheelLatchLabelTasteHerbsAppleJellyNurseCarpetJacketHoodieComicsDominoTokensMarkerBinderSupplyHandlePepperBananaOrangeYogurtPeanutSnoopyPencilPillowCheckupBandageBreatheStretchVeggiesIcepackCurtainDividerButtonsReadingDrawingLettersRestingSippingOatmealCottage...

stabby's spooky word search!!! 2024-10-20

5 Items: the "G" in MMORPGthe opposite of "me"Lady Gaga song "____Dance"three letters at the beginning of clue 3the group of boys in Neverland were called the ____ boys

Nate 2026-04-21

10 Items: made religionRome blamed theFather Son Holy SpiritThe region of Jesus's birthCompleted a lot of propheciesWrote Seven letters to Asia MinerUnwilling to ______ multiple godsOne of the three characteristics of GodWon war after seeing a cross in the skyJesus spent two years of his life in _____

Angel Word Search 2025-12-06

80 Items: BOWLOUICEJOYMAXREDBELLCANECOZYYEARNICENOELPOLESUITSNOWSTARTOYSTREEANGELCOMETCUPIDELVESGREENHEARTHO HOHOLLYBELLSMERRYCLAUSPEACECLAUSVIXENPAPERBRIGHTCAROLSDANCERDASHERDONNEREGGNOGFAMILYFROSTYGRINCHSKATESICICLELIGHTSSPIRITTINSELWINTERBLITZENCHIMNEYCOOKIESFRIENDSGARLANDHOLIDAYLETTERSMIRACLENAUGHTYPRANCERRUDOLPHSCROOGESNOWMANSWEATERCHESTNUTCHILDREN...

Friendship, Word Search 2025-02-04

2 Items: surprises,affection, priest, couples, marriages, letters, soldiers

CAMP 2025-08-05

87 Items: MapTagBunkCupsFernRopeTentBirchBootsCabinCanoeCardsCreekDanceDiaryGamesKayakLodgeMuddyPaintRiverSongsTicksTrailTreesCanopyChoresCraftsForestHikingLeavesNatureRangerScoutsSmoresTieDyeArcheryBandanaBerriesBlanketBoatingBonfireCaptureCompassExploreFishingFlannelGigglesHammockInsectsJournalLanyardLanternLettersNeedlesNoodlesPatchesPioneerRaftingWhistle...

FIND THAT DFO 2025-09-17

23 Items: VMDLEGALPOWERLEVELRETURN15118649ACUUMOTIVESPHEREMENITTOLL/CUSTOMSNON-PROCESSINGBANK GUARANTEEDUNNING LETTERSCRUCIAL SUPPLIERCLAIM FOR DAMAGAESUnable to be foundINTERNAL ESCALATIONHALT OF DISTRIBUTIONPayment for customerPARTNER OR ASSOCIATEDACCOUNT RECONCILIATIONINVOICE TYPE 5(D) AND 7(D)To settle a debt or obligation with money...

BLUE MOON - All the words contain either the letters of BLUE or MOON 2025-08-12

50 Items: ALBUMENBAUBLESBIOFUELBLUBBERBLUEFINBLUESKYBLUNDERBLURBEDBLURTEDBLUSTERBUBBLEDBUGLERSBULKIERBULLIEDBUMBLEDBUNGLEDBURGLEDBUSHELSBUTLERSCLUBBEDCUBICLECURABLEDOUBLETEQUABLEGLOBULEHUMBLEDJUMBLEDLUMBERSNEBULARPLUMBERREBUILDRUBELLASLUMBERSTUBBLESUBLIMETABLEAUTUBEFULUSEABLEBOOKMANCOMMONSDOMINOSDOORMANEMOTIONGOODMANHOMONYMHORMONEMANHOODMONOPODMOONERSMORONIC

Disney 2024-10-07

6 Items: owner is meghan Peytonis a cucumber in veggie talesare nine letters in miss piggymouses girlfriend is Minnie mouseworking for the weekday is ihops jingle.is where Mary Margaret lives in once upon a time.

CODE OSCILLATOR CIRCUIT 2024-12-11

10 Items: The letter S is made up of ____________ dots.The letter A is made up of a Dot and a ______________ .What pin on the 555 Integrated Circuit emits the pulses?The ______________ is the device that emits the audio tones.This circuit is an audio _______________ circuit used to emit tones....

INTRO and UNIT 1 OCTOBER 2025-10-08

20 Items: ViajeCollarEsquinaPulseraNubladoRotonda.PendientesParque infantilHacer ejercicioEn el extranjero.Plaza mayor (two words).A place where money is kept.You use it to cross a river.Hacer turismo / ver monumentosA place where products are made.The room where you have a shower.Patinaje sobre hielo (two words).To go for a walk in the mountains....

Im Word Search 2026-01-02

5 Items: the reason this puzzle existsthe moment everything subtly changedthe smallest word that still means everythingthe quiet smile you don’t realize you’re wearingtwo letters that begin a feeling before it’s spoken

d&l anniversary 2026-05-20

14 Items: <3mwahhyou meaniea nickname for youa place where i wonour anniversary monthsomething i send you oftensomething we do every nightwhere we take printed picturesthe platform with our playlistthe first flowers you bought methe name of our pinterest boarda dish i cooked for you and your brotherthe character of the figurine you gave me

Golden Egg hunt 2025-04-14

11 Items: - "XXX LOTR"- Chicken lays an..- Colour like blonde- Another word for within- Another word for souvenir- Another word for concealed- Another word for without risk- Mix blue and yellow to get ???- A verb and two letters like "if"- We should take take of XXX environment...

Invent Word Search 2026-04-30

20 Items: tiebinfoldshakycraneswingstringrecycleprojectmaterialsewww so nasty!someone who can't hearshort clips selling thingsthe first letters of your nameformed into round a round shapeto tell a group of people important newsto create or make something new and usefulsomeone who tells on other people to an adult...

Computer Definitions 2023-11-09

12 Items: Phishing - A type of email/message sent by scammersMouse- A small device that allows us to point and clickBackspace - the key used to delete letters to the left.Email - A electronic message sent through the internet.Attachments - Files or photos that are added to a email.Printer - A device used to print paper copies of a document....

Amanda House 2026-05-15

20 Items: What does Scla have?Name of our Team Leader?What is the ONCALL Number?How many does Nkel have each day?What is another name for sevelamer?What is Nkel's daily fluid allowance?What does Sevelamer bind to in the gut?Which participant self administers Medication?What time do you leave the house for dialysis?...

Index Laws 1 to 5 2023-08-29

15 Items: The simplest way to write a number.Writing a number using a base and an exponent.Any number (except zero) to this power is always 1.Letters that stand in for numbers we don't know yet.A diagram used to find the prime factors of a number.Writing a number out as a product of all its factors.Making a math expression as easy to read as possible....

Elements and Compounds 2024-12-16

14 Items: Form when two or more different elements combineIt is a substance that is dissolved in a solventIt is the result of dissolving a solute in a solventIt is a substance which can dissolve other substancesA mixture in which the composition is uniform throughoutIt is the act of decreasing the concentration of a solution...

vocab 2026-01-22

10 Items: poorwind-blown(bonus2) big black birda farmer that shares landanother word for lonelinessword with over 189,000 lettersin the state of producing something(bonus) mars helicopter made by nasapresent in large quantities or amounts...

Precede Word Search 2025-12-06

97 Items: artdownrainfearhopehomeglowneonfatelovehurtbyersgirlsheartangstphonedanddtrustpartyguiltstormlinescrazyorbittruthmemorysummerarcadeclosetrescuesafetyunsaidnightswarmthhawkinswheelerknowingsubtextreunionlongingletterstensionsecretscourageshelterwalkmanmixtapeemotionreunionpromisedoorwayepicenehonestyhealingbraveryhellfirepaintingvansceneelectric...

100 Days! 2026-02-26

100 Items: GymArtMassWetuLentMusicNounsVerbsForceChoirSantaireadGamesStreamProperRecessFunrunSaintsVirtueReflexRosaryTagdayAdventReadingWritingGrammarScienceHistorySpanishSpanishWeatherLettersFluencyBuddiesKineticReflectSnowmanMartinaReligionPronounsSpellingPrudencePatienceFrictionBlizzardPilgrimsDivisionAdditionNativityPeprallyAssemblyKindnessReindeer...

Random stuff 2021-02-17

97 Items: meInRedLOLdayGymBadOutCarPenHatJobBluePinkNameTimeFoodMathGoodNiceYellTalkBallForkBowlCoatFallDoneRaceGoodAdoptGreenDrinkStuffCleanMessyFixedDanceShoutKnifeSpoonSporkPlateStoreGloveScarfBootsShoesWordsStartOrangeYellowPurpleCheeseEasterSocialRandomBrokenGoogleSoccerCerealMeijerTargetCostcoChilisPencilMarkerSummerWinterSpringAutumnSearchGiraffe...

100-Words! 2025-05-11

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

Boralandic Slang 2024-11-03

16 Items: badheroicforeverSomething that is a messa euphemism for the end.an unexpected delay or problem.the medieval name for Boraland.Boralandic for truth (tre-sla).Boralandic for hello (saw-veck).the Boralndic version of minutescoffee. Some pronounce it “nee-tro.”a nickname for a soldier that’s lucky.a nickname for a fresh soldier/recruit...

Ian Clifton 2026-04-23

10 Items: Jesus grew up in ___the place of Jesus' birththe Christians - blame themCouncils of Hippo and _____Joseph and Mary didn't ___ alonewas born a few months before Jesusmeant a guestroom in someone's homethe Romans replaced Herod's sons with awrote 7 letters to the churches of AsiaMade the people curious about Christianity through death

Silas AWH Word search 2026-04-21

10 Items: The Lineage of JosephLove_____ and Love OthersWhen the Church was LaunchedThis was actually a guest roomThe Father, Son, and Holy SpiritThe amount of prophecies Jesus fulfilled___________ Wrote 7 Letters to Asia MinorThe Emperor that converted to ChristianityThe Messiah would be born to a ______________...

Letters and Numbers search:- Find the letter and number combinations hidden in the grid below 2025-01-23

20 Items: Z0G5S4UYBC740G9ND7Q3DAH9DY1P5SB64IBRE7LDG5ZAUJPTQB8F0OO18ZO2H96GX9JA42UF2B0GPM10

Mandatory Counselor De-Stress Time 2026-05-13

16 Items: GVS or ___Our Pink QueenEllie's shadowLeslie loves ____Naviance successorLeslie hates _____Inbound senior parentsKeeper of GVS registrationsThe website being held for ransomWill you send my final _________?How many wakeups left until MDW?!Who are we missing at this meeting?Who else are we missing at this meeting?...

Enlace 3rd 2025-04-08

27 Items: principalLibrariansecurity duoschool mascotraul wears a?one counselorenlace teacherDoms last nameopposite of #4jaydens nicknamewon world seriessecond counselorsuperbowl champsboys championshipgirls championshippopular chip snackHer name 3 lettersother security duo3rd planet from sunfemale college champs"the soup" in spanishkendric yells word (m)...

Christmas Word Search 2025-11-18

99 Items: ElfBowTreeNiceSnowToysBellListCoalStarMarvNoelPineSledSnowCoalCometDonerVixenCupidGiftsSyrupCandyBuddyHarryAngelJollyLightsDasherDancerSleighWreathEggNogFamilyIcicleCarolsTinselAdventRibbonFrostyGrinchAngelsRudolphBlitzenPrancerNaughtyBelieveGarlandCookiesYuleLogCandlesSnowmanChimneyRedNoseCarrotsVillageRedSuitScroogeTinyTimLettersReindeerPresents...

Flower Word Search 2025-12-30

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

V-DAY WORD SEARCH 2026-01-22

18 Items: my babygo-to soupdream purseour dream cari collect these3 words 8 lettersmy signature cocktailyour dream vintage carour favorite restauranta baby who loves lambiesour old hollywood vacationour first vacation togetherone of your favorite brandsmy dream hotel in californiamy nickname for my other babythe bar that has your favorite margaritas...

7x7, 4 words, 5 letters each 2026-02-23

4 Items: greenbrownblackwhite

LANGUAGE BUILDER 2024-04-07

19 Items: Toà nhàVăn phòngQuầy lễ tânNhà vệ sinhOpposite to nearOpposite to leftOpposite to openOpposite to fullOpposite to earlyOpposite to largeYou buy medicine hereWhere you play sportsYou park your car hereYour money is safe hereYou can buy anything hereATM is another term for thisYou send letters, parcels here.You can read or borrow books here...

Input and Output Devices 2025-05-16

7 Items: I am used to type lettersI am used in playing gamesI am used to get the printsI am also called Visual Display UnitI am used to display over a big screenI am used to select anything on the monitorI am used to convert printed doc into electronic formats

English Terms 2025-02-04

9 Items: Being over the top.A short personal story.Giving an object a human feature.A comparison using 'like' or 'as'.Words that have an audible effect.Same letters used at the start of words.Words used to create an image in the reader's mind.A comparison that states one thing is something else.Repetition of a word or phrase at the start of a line.

Winter/Christmas Wordearch 2024-11-22

110 Items: hatpieicebadredfuntreesnowsledcoatstarcoalparkcakemilksaltconelistgoodgoldbowsjudeigloohappyjollysantascarfbootspartybellsmusicgreenmagicjamesshovellightscarroteggnogsleighbeanieturkeymovieswinterauroraglovesbasketcandleskiingangelsgamilygrinchsilveryellowspiritfamilyjackieameliasnowmanpopcorncookiespenguinskatingchimneybrowniemarketslettersanimals...

MATH VOCAB 2025-10-08

9 Items: algebraic terms that have the exact same variable(s)figures have the same shape but not necessarily the same sizean equation that is true for all values of the variables involveda way to express a fraction or ratio of a part compared to a whole or out of one hundred...

Who Was Louis Braille? 2023-12-12

20 Items: Louis cried out in terrible ____!Louis was a bright and _______ boy.His father carved him a wooden ____.Louis _____d the letters with his fingers.It would be hard to be ________d from their son.Simon-René spent most of the time at his _________.By the time he was four, Louis was __________ blind.Louis was __________ with all the tools on the bench....

School Word Search 2025-07-30

8 Items: a place where you can buy thingsa place where children go to learna quiet place to read and borrow booksstation a place where firefighters worka place where sick or hurt people get helpstation a place where police officers worka place where people play and relax outsideoffice a place where you send letters and packages

My Baby's Word Search 2026-02-02

14 Items: 3 words, 8 letterscrash out kali songthe mischievous kittyyour twin in dog formtruth serum (alc bev)prime tacobell menu itemconcert of doom + despairartist of our first kiss songcondition jazzy gives chelseapisces-coded movie by kid cudione of our first date restaurants"she my ____" song/fav celsius flavorwhere i called you baby for the first time...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Vocab for Projekt 1065 by Alan Gratz 2024-04-26

12 Items: A wild uproarA strong backpackTo travel quickly.To greatly desire somethingSomeone who is corrupt or troubledAnger that is from unfair treatmentWriting and receiving letters back and forthTo have a strong smell of taste that isn't goodA place that has been set for military equipmentTo make lots of noise when you cry uncontrollably...