health and wellness Word Searches

chapter 14 2024-02-13

12 Items: to go backable to walkto bring abouthaving no effectMeasured actionsto casually walkfollowing in orderhappening repeatedlythe way something is doneto move away from a topicone that carries and deliversa passage or speech which introduces another longer passage of speech

Red Light, Green Light, Mama and Me 2013-11-17

15 Items: pieflyshylietrypilemicenightchildrightstyleknightmightyrecognizeskyscraper

Lesson 4: The Essential and Economical Trinity 2021-06-05

15 Items: onelivingspiritchurchessenceeconomyexpresscoinhereconceivedistinctfunctionselectionredemptioneconomicalpredestinated

How Sweet and Aweful Is the Place 2022-11-16

15 Items: lovehomesingsweetplacefeastguestvoicewithinheartsawesomethankfulchurchesredeemingvictorious

PT #4. Food Chain and Food Web 2023-01-29

15 Items: sunfungiplantanimalenergyfoodwebconsumeromnivoreproducercarnivorefoodchainherbivorenutrientsdecomposerphotosynthesis

Voice quality and speech organs - Discovery Unit 2024-03-12

15 Items: jawlungschestpitchnasalgrufflarynxthroatinhalesinusesgratingmuscleshummingwindpipestrained

Engage and Uncage a Word Search Enigma 2024-07-22

15 Items: variedprojectcuriousengagingtailoreddiscoveryadaptablecustomizedgame-basedreal-worldinteractivepersonalizedexpeditionaryinquiry-baseddifferentiated

New Words for the Week of November 6 2023-11-11

17 Items: Our neighbors kept chickens in a _________.What will I _________ if I look in your bag?If you have an itch, you want to _________ it."Please forgive me!" she said with a __________."My car was stolen! Somebody call a __________!"After dinner, Budi had a big _______ on his face.On a warm day, your ice cream cone will _________....

Tigris Word Search 2024-01-24

17 Items: The first Emperor of Rome.The Romans built these to carry water.Huge Chinese wall built for protection.A series of rulers from the same family.The large mountain range where the Inca lived.Ancient sporting event held in Olympia, Greece.The Inca were famous for these connecting paths.A step-like type of temple found in Mesopotamia....

Heaven and Ashlynn's amazing word search! 2014-12-05

11 Items: sunholecoreearthblacksolartestsrocksMineralgogglesscience

PRPERTIES of metals and non-metals 2015-05-09

11 Items: dellsoftshinypointductilemeltingbrittlehardnessstrengthmalleablestiffness

Vocabulary Review Unit 3 and 4 2021-06-13

11 Items: cooknursefathermothersisterdoctorbrothergrandmagrandpastudentteacher

hard and soft C spelling words 2023-04-05

11 Items: icecapcarcowcupcentcitymicefacefencepencil

planets including sun moon and stars 2023-10-19

11 Items: sunmoonmarsearthstarsvenusneptunsaturnuranusjupitermercury

A Taste of Greece and Mexico! 2024-06-12

11 Items: fetabreadtacosolivesnachostamalessouvlakitzatzikimoussakaburritoschilaquiles

education and work vocabulary for IELTS (6) www.atomicielts.com 2024-08-26

19 Items: keyannualreviewcareerlevelsforcedrelatedtrainingemployeeindicatorappraisalvoluntaryevaluationobjectivesredundancydevelopmentperformanceproductivityprofessional

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

It's a 10 truly miracle haircare 2022-10-05

5 Items: Miracle Defining GelMiracle Finishing sprayMiracle Blow dry VolumizerMiracle leave-in-product & Miracle hair maskMiracle leave-in plus keratin, Miracle Shampoo and Conditioner plus keratin

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

5.6B Circuits and Electricty 2018-10-01

6 Items: flowcurrentcircuitelectricconductorinsulator

Searching Tone and Mood 2023-01-31

6 Items: Finding faultBeing cheerfulThe state of being doubtfulHaving the character of SarcasmIt is not being in the company of othersExhibit strong emotion as a result of pain

cell divisoin and cycle 2023-03-03

6 Items: catlionzebrahippoelephantMan's best friend

Climate change and dustbowl 2023-05-25

6 Items: catlionzebrahippoelephantMan's best friend

Climate change and dustbowl 2023-05-25

6 Items: catlionzebrahippoelephantMan's best friend

peter and the wolf 2021-02-17

6 Items: catdoglionzebrahippoelephant

weathering, erosion, and deposition 2017-01-19

6 Items: catdoglionzebrahippoelephant

IH L and T 2021-02-11

6 Items: labtaptenloglipstent

INDUSTRY, INNOVATION AND INFRASTRUCTURE 2023-11-16

6 Items: RESEARCHINNOVATIONTECHNOLOGYINFRASTRUCTURESDIVERSIFICATIONINDUSTRIALIZATION

Letter V and Q 2024-06-07

6 Items: vetvanvatquitquizvest

Heat transfer 2023-11-08

13 Items: hot risingheat energybasicaly hotcold sinkingHEAT THROUGH WAVEShow radiation movesheat through contactNO COLD ENERGY ITS TRUE!this is how conduction worksTHE DIRECTION OF HEAT TRANSFERThe equality of two temperatureswhen heat goes from one thing to anotherwhen heat rises and goes down when it cools

Monsters and Mythical Beasts 2022-06-11

6 Items: fairytrolldragonhobbitmermaidunicorn

Environmental and Consumer Movements 2023-01-13

6 Items: nrcepacleanairactenvironmentcleanwateractnuclearregulatorycommission

adding ing and ed 2023-01-29

6 Items: pattedhummedpattinghummingdroppeddropping

cell divisoin and cycle 2023-03-03

6 Items: catlionzebrahippoelephantMan's best friend

cell divisoin and cycle 2023-03-03

6 Items: catlionzebrahippoelephantMan's best friend

Weather and Climate Vocabulary 2023-05-15

6 Items: catlionzebrahippoelephantMan's best friend

countable and uncountable nouns 2023-07-10

6 Items: ricesoupflourcarrotscissorstrousers

rocket, space and satellites 2023-10-05

6 Items: catlionzebrahippoelephantMan's best friend

weathering, erosion, and deposition 2017-01-19

6 Items: catdoglionzebrahippoelephant

Fruits and Veggies 2 2016-03-19

6 Items: cornappleoniontomatobananabroccoli

NLHS Uniform and Drill 2024-04-11

9 Items: facefacefaceleftholtrightMarchcoveruncover

Search all the plateaus, waterfalls and rivers 2017-01-03

14 Items: FallTapiMalwaBhimaDeccanDassamKaveriCentralKrishnaNarmadaGodavariJonahfallHundrufallChotaNagpur

Rebuilding the Temple and Wall of Jerusalem 2023-02-04

15 Items: an enemy of the Jewsan enemy of the JewsCupbearer to the KingHow long it took to rebuild the wallWrote and taught the people about God's lawsWhere the Jews offered their sacrifices to GodProphet of God that helped to encourage the JewsNehemiah took these with him to help with his journeyJews had to carry these while they worked on the walls...

MCHS Diversity, Equity, and Inclusion Word Search 2023-05-24

14 Items: equityaccesstalentcultureidentitydiversityinclusionacceptancehiddenbiasdifferencesopportunitydisabilitiescommunicationdecisionmaking

Search all the plateaus, waterfalls and Rivers 2017-01-03

14 Items: FallTapiMalwaBhimaDeccanDassamKaveriCentralKrishnaNarmadaGodavariJonahfallHundrufallChotaNagpur

Take My Life and Let It Be 2022-08-23

15 Items: alldayslifevoicehandsmyselfsilvermomentsimpulsemomentstreasuremessagesbeautifulintellectconsecrated

Rebuilding the Temple and Wall of Jerusalem 2023-02-04

15 Items: An enemy of the JewsAn enemy of the JewsCupbearer to the KingHow long it took to rebuild the wallWrote and taught the people about God's lawsWhere the Jews offered their sacrifices to GodProphet of God that helped to encourage the JewsNehemiah took these with him to help with his journeyJews had to carry these while they worked on the walls...

Plankton vocab 2024-01-22

22 Items: respirationother organismsLargersized plankton visible under a microscopeSmall crustaceans that are a common type of zooplanktonExtremely smallsized plankton smaller than microplanktonSmall animals that feed on phytoplankton or other zooplanktonOrganisms that obtain their energy by consuming other organisms...

Jesus, Thy Blood and Righteousness 2023-04-28

8 Items: boldmercypleadoceanbeautyransomflamingabsolved

Muscular System: Joints and Muscles 2023-11-28

8 Items: jointtendoncardiacmusclesflexibleligamentcartilageinvoluntary

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

Human Demand on Natural Resources 2024-03-10

17 Items: study of human populationsthree basic needs of humansarea outside a town or cityarea relating to a town or citypeople who study human populationsnumber of organisms in a given areadata collected about the human populationmeasurement of population per unit land areausing a natural resource without reducing its supply...

Minecraft Youtubers And A Pig 2016-11-07

8 Items: pigDantdmWonderQuestSqaishyQuackStampylongnosetherealstampyjriballisticsquidStampylongheadJr

Favorite TV Shows and Characters 2021-08-01

8 Items: JanStanDeanSouthParkBradyBunchSupernaturalMyLittlePonyTwilightSparkle

4.6BC Electricity, Conductors, and Insulators 2022-09-26

9 Items: openclosedenergyenergycircuitcurrentconductorinsulatorelectricity

Hitler and WWII Word Search 2023-05-11

8 Items: d-dayhitlereukoalmorellpaintertreasonswastikaantisemitism

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

DOK 2023-08-09

33 Items: What is the last step to properly lockout a conveyor?What is the first step to properly lockout a conveyor?What is the third step to properly lockout a conveyor?What is the second step to properly lockout a conveyor?What is the fourth step to properly lockout a conveyor?How do you properly secure a conveyor belt: Stop, Latch, ___....

Reconstruction 2024-02-20

8 Items: Lincoln's successorThis is what happened to Lincolnperiod of reunifying the country between 1865-1877The amendment the ended slavery except as penalty for a crime.The 15th Amendment protected the right to this regardless of race.prohibited Black people from owning property, firearms, occupying certain places, and testifying in court...

Vocab. 2024-04-26

13 Items: It's a state in the USSomething that lasts long.It's a kind of grilled chickena way of expressing,or your sorrowIt to do something before thinkingIt's another species for marine fish.It's a small narrow ditch in the groundIt is a japanese female name that means “Beautiful Bloom”Its a hole that's in the ground and it blows out hot steam...

Vocabulary Review Unit 3 and 4 2021-06-13

11 Items: cooknursefathermothersisterdoctorbrothergrandmagrandpastudentteacher

CPP WORDSEARCH KEYS TO SUCCESS AND GOOD DECISIONS 2024-08-27

19 Items: SafeJustCleanCivilHonestCertainWorkHardHarmfreeStayFocusCommitmentAskForHelpProductivePersistentRespectfulPurposefulNeverGiveUpAccountableResponsibleMakeGoodChoices

Spelling and Vocabulary, Week of April 9, 2018 2018-04-09

18 Items: menauntmineyourthawunclewomenfamilysisterteacherbrotherfeatureharnessuntamedunnaturallumberjacksannouncementrequirements

Welcome to Mrs. Webber's and Ms. Foster's Class 2022-08-10

19 Items: elievanmarkcaraperijoshlylachloechloeblairbellaalaynabrookemakaryscottylincolnzacharyharrisoncharlotte

Aladdin and the Wonderful Lamp pgs. 46-51 2023-10-16

18 Items: What did Aladdin buy in town?Where did the magician fall dead?What was the King doing back home?Where did Aladdin magically appear?Where did Aladdin go to buy something?Who does the princess open the door for?What does Aladdin ask the genie to return?What did the princess do with the magic lamp?What does Aladdin take out from the magician?...

grasshopper and the ants 2014-07-28

6 Items: antsinglazyworkdancegrasshopper

ABC's and 123's 2015-08-09

6 Items: OneTwoThreeNumbersLettersAlphabet

Animal and plant cells 2022-11-15

6 Items: catlionzebrahippoelephantMan's best friend

space and seasonal terms 2024-07-30

6 Items: rainorbitsummerwinterspringgalaxy

find and describe 3 animals in this crosswords 2020-12-28

18 Items: catdogbatantlionwormbirddovezebrahippotigersnakecamelmouseeaglemonkeyspider.elephant

Introduction to Justice 2023-11-16

7 Items: type of justice that focuses on how to punish crimetreating someone in an honest and free-of-judgment waytype of justice that focuses on ways of helping victimstype of justice that focuses on giving people a fair amount of resourceswhen people behave in a way that is fair, equal, and balanced for everyone...

Happy Birthday Bri! 2024-06-25

10 Items: Bri's favorite cake.Bri's favorite holiday.- Bri's favorite season- Bri's favorite color.Bri's favorite food - mmm crispy.Bri's favorite animal - think pink!Bri's favorite movie genre - amour.- Bri's favorite summer activity - not running!Bri's dream vacation destination - known for pasta....

Unit 6 Review: Atmosphere and Cyclonic Storms 2020-01-13

14 Items: ozonefrontstornadocyclonehumidityradiationexospherepollutionhurricanetroposphereevaporationstratospherecondensationprecipitation

Kaya,Felicity,Nicki and Saige 2022-01-20

8 Items: KayaNickiSaigeHorsesFlemingFelicityMerrimanCopeland

All Glory, Laud, and Honor 2023-02-24

8 Items: laudkinggloryhonorpalmshymnschoruspraise

Student workshop- media and violence 2023-06-02

8 Items: isthelastedwinmondaystudentworkshopcongratulations

Ratios Tables And Graphs Activity 2016-05-23

8 Items: TimeHoursMilesSpeedRatiosTablesGraphsDistance

EVIE AND LILLIS WORD SEARCH 2017-08-04

8 Items: southgrowththunderBirthdaythankfulfaithfulthinnestthoughtful

armed forces and emergency services 2023-11-09

8 Items: pilotguardsailorsoldierlifeguardpolicemanfirefighterpolicewoman

Promoting Safety 2023-09-04

8 Items: harmful microbes that cause diseasesurface or object has been soiled with pathogensany device that inhibits a person’s freedom of movementthe correct positioning of body parts relative to each othera chemical solution used to kill microbes on an object or surfacea situation that arises suddenly and requires immediate action to keep a person safe...

weathering, erosion, and deposition 2017-01-19

6 Items: catdoglionzebrahippoelephant

MINERALS and IGNEOUS ROCKS 2022-10-13

6 Items: catlionzebrahippoelephantMan's best friend

Weather and Climate Vocabulary 2023-05-22

6 Items: catlionzebrahippoelephantMan's best friend

Find hopscotch and slide 2019-04-25

8 Items: slideslideswingtulipcirclesquarehopscotchhopscotch

Climate change and geese 2023-11-29

6 Items: geesebreedingmigrationecosystemanseranserclimatechange

violence and the media 2024-03-15

6 Items: wacomediaoklahomaviolencecolumbineinfluence

Pure Subtance and Mixture 2024-09-07

6 Items: MatterMixtureCompoundSubstanceHomogeneousHeterogeneous

Rebuilding the Temple and Wall of Jerusalem 2023-02-04

15 Items: An enemy of the JewsAn enemy of the JewsCupbearer to the KingHow long it took to rebuild the wallWrote and taught the people about God's lawsWhere the Jews offered their sacrifices to GodProphet of God that helped to encourage the JewsNehemiah took these with him to help with his journeyJews had to carry these while they worked on the walls...

Anime 2023-12-04

20 Items: ...RAIDBaldGojoQuirkyGuildsnichirinStretchy manLord of deathDeath by deathNature's BeautyIts big brain timeLets try this again3 superhumans and a dogwalls, walls everywhereFighting fire with fireI don't remember a lie tbhNot as scary as it could have beenitsumo hitori de aruiteta furikaeruMan this teacher is a little too nice

Christmas Family Wordsearch 2023-10-10

20 Items: Day DCountyDJ GordonHome TownThe MammyMammy's bossSenior DaddyMiddle madzerDaydee schoolChristmas SongsHome in WestmeathBrandon's ice creamNice but dim and furrylavish it with whiskeyDaisy's addiction screenAmy's favourite card gameWe don't play for this GAATriona's favourite fruit babyMost wonderful time of the year...

Our Nonprofits 2024-07-08

83 Items: beandbigmenredteethewayboyscampclubfairfirekeeppinkrapeshowwestadultbasinbreadcrimecrossfaithfirstgirlsgrouppixelsharetexastribeyouthchangecrisisdesertfamilyhavensjuniorscoutssharedsoccerspacesunitedcenterskitchenlibrarymidlandnetworkprogrampromisesisterssupportwritingallianceamericanbreakingbrotherschildrenfamiliesfestivalliteracypreserveservices...

Vocabulary Lesson 11 2023-01-31

8 Items: Emily was _____ if her support of the proposal.Elizabeth Cady Stanton was an ____ for women's suffrage.Smelling mint can _____ a sense of tranquility or freshness.The mountain air was redolent with the scent of pine needles.Organs, such as your nose and the nasal cavities, are part of the _____ system....

The lion and the mouse 2022-08-29

8 Items: pawawakerepaylaughasleepbothercaughtnibble

The One and Only Ruby 2023-06-13

8 Items: bobnyarubyivantuskyjaboriauntakiellokatherineapplegate

Things that keep you and the animals warm 2018-01-12

18 Items: hatcoatfireshedcoopscarfstovebootssocksglovessweatermittensbeddingshelterheatlamplongjohnssnowpantswindblock

producing and detecting sound lesson 1 page 528 2017-04-19

20 Items: earwavewavelosssoundsoundspeedhumananvilcanalmediumhammereardrumcochleastirrupvibrationdetectingcompressionrarefactionlongitudinal

family and relationships vocabulary for IELTS (7) www.atomicielts.com 2024-08-19

18 Items: renthomehouseownerfamilyrentertenantladdernuclearblendedshelterextendedpropertymortgagehomelesshouseholdgenerationmultigenerational

science and innovation vocabulary for IELTS (6) www.atomicielts.com 2024-08-30

18 Items: edgecleansmartsolarpowerenergydevicecuttingversionquantumemergingstartingprintinginternetprototypecomputingrenewabletechnology

technology and innovation vocabulary for IELTS (2) www.atomicielts.com 2024-09-01

18 Items: datauserbasedstudytrialsdrivendesignminingethicalcentredresearchclinicalevidencepioneeringvalidationmethodologyfeasibilityconsideration

Vocabulary Detective 2023-11-07

6 Items: thermalequilibriumheat transfer by touchHeat traveling through waves (no medium required)Heat Rises and Cold Sinks (Fluids) - Involves convection currentsPattern A repeated design/sequence that is able to be guessed or known in advance.