fourth of july Word Searches

HAPA Heritage Month 2025-04-21

12 Items: Hawaii state flowerLast imperial dynasty of ChinaAsian country shaped like an 'S'Ancient trade route that connected Asia and EuropeNumber of countries that make up the Pacific IslandsFirst Asian/Pacific Islander group to settle in the U.SU.S state that has the biggest Asian-American populationAsian country that does not celebrate the Lunar New Year...

Far East of Europe 2025-06-14

12 Items: A Manchu pigtailJapanese dwarf treesA people group from Manchuria, ChinaCatholic missionaries that came to JapanThe first shogun of the Tokugawa dynastyThe son of Ieyasu who became the Tokugawa shogunHidetada's son who became shogun and closed JapanMost Japanese people believed in this kind of religion...

Thanksgiving Word Search 2022-11-12

12 Items: This is the sound a turkey makesThanksgiving falls on this day of the weekFalls from the trees in autumn; changes colorThe spirit of Thanksgiving; an attitude of ___It has green leaves that change colors in the fallIt is made out of breadcrumbs and goes with turkeyThis animal has feathers and is served for Thanksgiving...

Queen Elizabeth II's fifteen prime ministers 2022-12-18

15 Items: Oh yes!Party on!East of ...The milk snatcher...Wordsearch means wordsearchA hot mic and a bigoted womanBringing the country togetherA nice companion for a cast awayWas a minor before the raised thirdTortured shrubland before the cliffTying up the wings and legs of a chickenShares his name with a leading UK charity...

7th peyton 2024-05-17

15 Items: regulate tempaturestorage for the cellthe main artery of the bodyprotein factories for the cellHelps with movement and rotationwhite blood cells to fight infectionpowerhouse of the cell, makes energymakes proteins and lipids for the celltraps sunlight and converts it to sugarJelly-like substance that fills the cell...

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

Word Search: Globalisation 2026-01-11

15 Items: Problems or difficultiesCountries working togetherGoods sent to other countriesSharing information and ideasLearning and gaining knowledgeBuying and selling goods and servicesGoods brought in from other countriesMoney, jobs, and business in a countryTraditions, beliefs, food, and way of lifeMoving people and goods from place to place...

Unit 4 Vocabulary 2026-01-13

6 Items: Made of a single type of atomThe building block of all matterMade of two or more different atomsWhat you end with in a chemical reactionWhat you start with in a chemical reactionFound below a symbol, tells you how many you have of that symbol

Coquette 2024-08-27

18 Items: eventcolourseasonplush toytv serieshairstyledecorationnail stylerunway walkfashion brandtype of felinefacial productmyth in the skyway to style hairgossip girl actorsynonym of prettyfamous designer brandcity that never sleeps

Property of Water 2017-08-29

17 Items: polarsolutesolventmeltingmixtureadhesioncohesionsolutionfreezingdepositionsuspensionevaporationsublimationcondensationdipolemomenthydrogenbondssurfacetension

Family of Us 2020-04-01

17 Items: MomDadLunaEeveePiperGizmoMelodySmoresMakaylaCameronMalachiDominickSnowballSneakersMunchkinMackenzieHeavenpets

Forms of Communication 2020-07-30

17 Items: memoflyervoicephoneemailspeechlettertextingbrochuremagazinepostcardinternetbillboardnewspaperannouncementpresentationbodylanguage

lemons of love 2024-03-26

17 Items: Hjoemeregarytarkkarenpattibrianvickikathychristraceylynneaalbertelainecolleensunshine

Capitals of Coutries 2024-04-23

17 Items: kievlimaquitoparisminsktokyomoscowmadriddublinnassaulondonberlinbeijingbrusselssantiagokingstonamsterdam

School of Rock 2024-05-06

17 Items: nedzachbassmusicdeweyprizebandsmartadrumscellobattlesummerfreddytomikaguitarschneeblysubstitute

Forces of flight 2025-01-08

20 Items: LiftDragSpinPathDiscForceForceCatchSpeedSpeedThrustTorqueMomentumStabilityTechniqueBoomerangBoomerangTrajectoryof ReleaseAerodynamics

Life of Jesus 2025-01-22

17 Items: GodFishMaryJesusBreadBirthHeavenMarthaJosephMangerGabrielDecemberParablesBethelemHolySpiritCrucifixionRiverJordan

Types of Whales 2025-02-16

18 Items: FinBlueOrcaGraySpermSpermSpermRightRightPilotBelugaKillerBaleenBeakedNarwhalBowheadRorqualHumpback

Age of Independence 2025-06-06

17 Items: warhumanriotsregimerightscitizendiseasepovertyconflictGenocidereligionrepubliccommunismresourcesrevolutionstarvationindependence

Vampire of Sacramento 2025-06-16

17 Items: apdbloodknifepistolvampirefrontallobenecrophiliacannibalismdanmeredithjasonmirothlimbicsystemathoritarianteresawallenevelynmirothdavidferriraschizophreniaambrosegriffin

Species of LOTR 2025-09-09

18 Items: MenEntsElvesWargsAinurMaiarOgresMaiarEaglesTrollsHobbitsDwarvesDragonsMumakilGoblinsBalrogsUruk-haiWarewolves

ALL OF 2P!!!!!! 2025-09-22

19 Items: ACAMYWAKEANYICATEMAYAPLESSAIDENNAKSHNICCOBLAIRSONYANAOMISOPHIAVEVERKABRISANABENJAMINALEXANDRA

Names of Reformers 2025-10-13

17 Items: HUSKNOXLASKIBUCERFARELRIDLEYLUTHERDEBRESZWINGLITYNDALELATIMERCRANMERURSINUSWYCLIFFEHAMILTONBULLINGERMELANCHTHON

Attributes of God 2025-10-29

18 Items: Holy,Good,Kind,Proud,Heals,Loving,Healthy,Amazing,Amazing,Parental,Fatherly,Humorous,Friendly,Listener,Righteous,Beautiful,Supportive,Trustworthy,

Districts of Pakistan 2025-11-16

17 Items: DaduOkaraMalirKotliKalatHunzaBannuAttockTangirZiaratPishinNeelumGwaderChagaiMastungTorgharSohbatpur

Miracles of Jesus 2026-02-12

17 Items: HealingDominionProvisionAuthorityCompassionRedemptionRevelationRestorationDeliveranceEmpowermentResurrectionInterventionManifestationGlorificationTransformationMultiplicationTransfiguration

Welcome Word Search 2023-09-26

5 Items: a look aroundto the internetthat brain of your can think of can be foundgot mountains of content some better some worsenone of it's of interest to you youd be the first

Manson Word Search 2025-12-01

5 Items: The subject of this puzzlePart of the phrase "______ Skelter".The state where Charles Manson was born.The second half of the phrase Manson was obsessed with.A group of followers of an unconventional belief system.

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Dusk Word Search 2025-11-14

13 Items: a tiny gaptells the timenot able to movepart of the bodya solid bit of the earth____ tock says the clock!clothing worn over your footan action over moving your lega bird uses their beak for thisa large vehicle for transporting goodsthe action of pushing your hands together to make a soundthis is the time after the sun sets, but before it is dark...

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

judaism 2024-08-12

20 Items: TorahSederRabbiHesedTorahKippahKosherTallitKippurSukkotShabbatMitzvahMenorahMitzvahMitzvahKaddishChanukahTefillinof DavidHashanah

WEDDING 2024-06-16

60 Items: mayBAYidomauilovevowsdogsjulysurftylerbeachoceanbridegroomboatscrabsshellymeadowberlindelmarreggaestjohnorangecheersfamilymuseumtravelcornishgilmorefloridateacherforeveroctoberromancepitnpubcrushesmarylanddelawarelaughtersunshineflamingomarylandiloveyoufishtalesnewjerseyoceancitysalisburysoulmatesbobmarleytheofficehoneymoonseashellsassateague...

O Calendário 2024-12-16

29 Items: MayDayJuneJulyWeekYearDateMarchAprilTodayMonthAfterAugustMondayFridaySundayBeforeJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySaturdayTomorrowSeptemberWednesdayYesterday

Shabbos 2024-07-18

19 Items: fishholysoupwinekugelsevenfamilyparshacandleschallahchickencholentOF RESTkiddushshabboshavdalahspiritualFROM HASHEMNINE MELACHOS

Inaya's Greek word search 2025-11-11

6 Items: CITY STATELEADER OF GODSBIRTHPLACE OF DEMOCRACYON TRIAL FOR DISOBEYINGPUT HIS TEACHINGS IN DIALOGUE FORMAMOUNT OF DAYS THE OLYMPICS LASTED

Web Word Search 2022-10-14

10 Items: Type of search engine?Digital dictionary websiteWhat can you search on for information?What type of program helps us locate items?Mapping site that helps teach geographic concepts.Pages or items listed as results of an internet or database search.Archive that has over 5,000 free videos for math, science, social students and humanities....

Choice Board 2023-05-09

10 Items: Feeling of pride and loyalty towards a nation.Led an expedition to the Rocky Mountains in May 1842.Settled all border disputes between Spain and the U.S.TRaveled into Spanish-helds lands until they arrested him.This was one reason Americans had a feeling of nationalism.The first to explore the Rocky Mountains and the lands west of them....

Character Word Search 2025-10-08

20 Items: PlotMoodStealThemeGenretraitsClimaxactionactionsSettingpurposeof ViewFictionmountainConflictCharacterExpositionNonfictionCharacterizationCharacterization

6A 2024-10-16

22 Items: rugbedlampwalluglysamelargesmallmirrorprettybedroomcurtainspaintingimportanttelevision setown, one’s ownnight/end tableshelf, bookshelfto the right (of)closet or wardrobeclock (alarm clock)dresser or chest of drawers

Spanish Vocab 6 2024-11-12

25 Items: TheFlagDeskDoorhereMouseClockTableChairtherePosterScreenWindowBehindComputerBackpackKeyboardTrash CanOn top ofSome, fewUnderneathIn front ofNext to, BesidePencil Sharpenerthere is, there are

List 13 2026-01-20

30 Items: meantlaunchcareervariousathletelaundryorchardpicturenoticedvisibleIndianadevelopgenuinecautiousdisguiseassemblywastefulqualifiedautographlibrariangreatnessvegetableauditoriumattendancesignificanta diffficult choicehelpful; producing gooda person who one knows only slightlythe layer of air surrounding the earth...

Card Connections Summer 2024 Recap WORD SEARCH! 2024-09-20

40 Items: Julypizzapizzaaugustbakingcostco___ fraud___ amountdispute ___extra creditextra creditexpialadociousCard Specialist ___they moved to MilwaukeeAngela's favorite hobbiesour project team is pretty ___.who's basket are you bidding on?Card programs' newest team member!the card specialists are pretty ___.the dispute specialists are pretty ___....

Dia de Los Muertos 2025-11-03

10 Items: The flower usedWho is rememberedThe pan dulce eatenAlso who is rememberedThe month of the festivalThe part of the skeleton usedThe flowers are symbols of thisSomething to light the ofrenda.Where your loved one's picture goesSometimes skulls are made with this

Energy For Exercise 2025-06-30

7 Items: What does ATP stand for?What enzyme controls the breakdown of phosphocreatine?What type of reaction absorbs energy from the surroundings?What type of reaction releases energy into the surroundings?Which enzyme catalyses the breakdown of ATP, releasing energy?Which compound quickly donates a phosphate to resynthesise ATP?...

Victorian Architecture 2024-02-03

17 Items: BENABBEYBARRYpugingothicrealismmillaisopheliamedievalrossettivictorianpartheneonneoclassicalannunciationwatercoloursOF PARLIAMENTpre-raphaelites

David Berkowitz 2025-12-14

17 Items: YorkArmyLupaMediaTrialQueensof SamLauriaPoliceVictimsCaliberLettersAdoptedViolanteEvidenceBrooklynSurvivors

ROUND 3 2022-09-15

8 Items: / A CUTE NICKNAME/ FOOD OF THE GODS/ A GENTLEMEN'S SPORT/ A CHILDREN'S CARTOON/ AYUSHI SHARMA'S VIDEO GAME/ STUFF WE LIKE TO 'TALK' ABOUT/ A FOOTBALL CHANT YOU CAN'T NOT DO/ A SORT OF CONNECTED NETWORK OF COMPUTERS

Rishi's Word Search 2025-06-15

8 Items: To askTo get biggerUnusual, strangeAnother name for a ladyTo divide something by 4Superheroes have lots of thisSomething of great importance, value or meaningAn adverb relating to the likelihood of something

Vocab anything 2 owen smith 2024-02-09

10 Items: a disappointing end to an exciting or impressive series of events.The repeating unit here is one unstressed syllable and one stressed syllable.an allusive or oblique remark or hint, typically a suggestive or disparaging one.the most intense, exciting, or important point of something; a culmination or apex....

english words 2014-09-28

63 Items: NOMYYESREDDAYYOUHOWOLDBOYONETWOSIXTENMAYBLUEGREYGREYWEEKYEARNAMEWHATGIRLFOURFIVENINEJUNEJULYFOULGOALTEAMBLACKBROWNWHITEGREENMONTHTHREESEVENEIGHTMARCHAPRILMATCHTODAYYELLOWPURPLEAUTUMNSPRINGSUMMERWINTERELEVENTWELVEAUGUSTMONDAYSUNDAYCOLOURSSEASONSJANUARYOCTOBERTUESDAYFEBRUARYNOVEMBERDECEMBERFOOTBALLSEPTEMBER

spanish vocab 2025-04-29

30 Items: hoyDiamesanomayoayereneromarzoabriljuniojuliolunesfechaagostomartesjuevessabadomananaSemanafebrerooctubrevuernesdomingonoviembrediciembremiercolesseptiembrecalendarioantesde(l)despuesde(l)

All about the astrology 2025-07-03

61 Items: LEOMAYSUNRAMAIRJUNEJULYMARSMOONBULLCRABLIONGOATFISHFIREFIREARIESVIRGOLIBRAMARCHAPRILVENUSPLUTOTWINSFIXEDEARTHTAURUSGEMINICANCERPISCESAUGUSTSATURNURANUSMAIDENSCALESARCHERRISINGSPRINGSUMMERAUTUMNWINTERSCORPIOJANUARYOCTOBERMERCURYJUPITERNEPTUNEMUTABLEAQUARIUSFEBRUARYNOVEMBERDECEMBERSCORPIONNEGATIVEPOSITIVECARDINALCAPRICORNSEPTEMBERZODIACSIGNS...

Sopa de letras - Vocabulario 2025-11-03

25 Items: dayartredgumJulyblueneverso-sojuicewatercandyclassesTuesdayto singto drawto readscienceslikewisegood byeexcuse mewhat's upit's windyit's sunnysoft drinksee you later

Calendar Vocabulary 2025-11-21

30 Items: MayDayJuneJulyWeekYearDateMarchApriltodayMonthAugustMondayFridaySundayJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySaturdaytomorrowCalendarSeptemberWednesdayYesterdayDel AfterDel Before

Ekonomi Makro 2023-09-06

11 Items: fiskalhazardinflasimoneterdeflasiNasionalof moneygovernmentkemiskinanunemploymentpengangguran

Hagrids Crazy Creatures 2025-11-14

11 Items: HutFangFluffyHagridkeeperNorbertExpelledUmbrellaHogwartsGryffindorof the keys

Imperalism 2015-05-19

25 Items: ofrawnewtheTsavowealthmedicalmilitaryimperialtransferretardedmaterialsconflictsinvestmentman-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsphilosificalopportunitiesjustificationtransportationinterdependence

Mr & Mrs Hopkins 2024-08-02

24 Items: lovecakeleonjackbibleringsconorchurchushersfamilyweddingbestmansydwellhopkinsfriendshusbandmarriagemarriagenewlywedshappinessof honourflowergirlringbearerbridesmaids

Charity Word Search 2024-11-14

20 Items: RacismchangeaccessCharityPovertyDonationEqualityviolenceAwarenessInjusticeNonprofitVolunteerAddictioninequalityEmpowermentFundraisingHomelessnessUnemploymentof educationRehabilitation

Act Word Search 2025-03-31

26 Items: OfActSealHolySorryMortalVenialExamenResolveServiceHealingSeparatedConfessorEucharistContritionTemptationSacramentsInitiationConscienceAbsolutionBeatitudesGoodShepardForgivenessConfessionalCommandmentsReconciliation

owl 2025-06-13

21 Items: beakdischootowletraptorvisionhalluxpellettalonsof preycallingmandiblemandiblefledglingnocturnalprecocialaltricialfiloplumescarnivorousregurgitateproventriculus

Danielle & Ron's Baby Shower 2025-08-11

24 Items: RonLoveCribToysCrawlGiftsWipesBirthFamilyOnesieof JoyBottlePampersBlanketCuddlesDanielleBabyGirlPacifierTeethingPreggersLaughterBassinetBabyShowerSleeplessnights

Culture Word Search 2025-09-15

20 Items: toolartistcultureillegalfreedomsupportdenouncecreationcriticizeauthoritysymbolizemainstreampropagandabe-allowedsoft-powercontroversywork-of-artindependentcounter-powersocial-justice

Stranger Things 2026-01-20

21 Items: toWilldownGateEleventhingsHorrorFranticHawkinsNarrowlyAssuredlyAstoundedVanishingDeductionspursuit ofcompellingDemogorgonLaboratoryCompasses.BlockbusterAnticipated

Year 9 English 2026-02-06

23 Items: PlotGenreThemeMotifIronyClimaxSimileSettingof viewImageryMetaphorNarrativeStructureSymbolismNon-linearExpositionResolutionPerspectiveAlliterationChronologicalForeshadowingPersonificationCharacterisation

NewTestament4 2026-02-16

20 Items: ONROBEPAULJOHNMARYLIFEWATERLIGHTPETERALTARSWORDTRUTHOLIVESOF GODPEARLSLAZARUSEPHESUSPHILIPPITEMPTATIONTHESSALONICA

The Great Depression 2014-03-11

26 Items: ofOzFDRtheSoupGonewithwindKingKongPoorDustBowlStockGreatBlackCaponeWizardMarketFarmerTuesdayShirleyTemplesMonopolyDepressionHooverville

Imperialism causes and effects 2015-05-19

25 Items: ofrawNewtheTsavoWealthMedicalMilitaryImperialtransferRetardedmaterialsconflictsInvestmentMan-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsopportunitiesPhilosophicaljustificationTransportationInterdependence

Imperialism causes and effects  2015-05-20

25 Items: ofRawNewtheTsavoWealthMedicalMilitaryImperialtransfermaterialsconflictsRestartedInvestmentMan-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsopportunitiesPhilosophicaljustificationTransportationInterdependence

POC 2020-12-23

26 Items: isoftipcostpartwholemarkupdivideexpensepercentretailermarkdownmultiplydiscountsalestaxnetincomegrossincomesellingpricecrossmultiplyamountofchangeoriginalamountpercentequationpercentofchangeinverseoperationonehundredpercentproportionequation

Explore 5 - Chpt 3 - Our Mysterious World 2022-10-09

23 Items: ofinuglypaleghostalienthinkgiantmagicaloneawfulwickedscaredmysterycuriousmonsterstrangethroughcarefulimaginehorribledangerousfrightened

Federal Rules of Evidence 2024-09-12

20 Items: NoticeHearsayWitnessWitnessEvidenceof ProofRelevanceObjectionTestimonyPrivilegeFoundationExaminationImpeachmentMaterialityExclusionaryInadmissibleAdmissibilityPreponderanceAuthenticationCross-Examination

List 11 Words 2025-10-26

24 Items: leveeleavenlevityIsaiahhaplessrestlesselevatorleverageantivenomantiviralceaselesscountlessfaithlessfruitlessmercilesselevationAntarcticaantisocialspeechlesscantileverof Solomonantibioticsantigravityantiseptic,

Feb 14/2026 2026-01-09

24 Items: ToOfBeMyTheYouPinkNavySuitRyanWillDressBreadBrunoBananaKissesWitzkeFlowersCuddlesDancingEmperorMake OutStettlerValentine?

HI 2023-03-20

11 Items: cooling systemread only memorypermanent memoryrandom access memorybrains of a computerloses data when power offkeeps data when power offphysical components of computera numbering system with base 16stores frequently used instructionsgenerates a feed of graphics output to a display device such as a monitor

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

fetertre 2023-08-24

7 Items: Legally recognised partnersAny transaction or occurrence that results in a tax consequence.It is specifically excluded from the definitions of ‘goods’ and ‘services’.Permanent transfer or disposal of business assets where input tax credit has been availed on such assets....

Vocabulary Set 4 Word Search 2024-10-28

13 Items: to angerwearinessto recall the pastto arouse to actionto one side or crookedto wear away or become worn awaymood, feeling, or general atmospherean expert in matters of style or tastea circle of close associates or friendsa small opening as in a wall or rock facethe distance around something or to circle...

r controlled vowels 2025-08-27

13 Items: a fancy hotelto change shape or formto burn something slightlythe middle part of an appleto help or hold something upa whirling mass of air or waterthe earth moving around the sunto bring goods into a country for salea person who owns and rents out propertythe way something is arranged or set outa special set of clothes worn by a school...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Frequency adverbial espressions English to Spanish 2025-01-19

16 Items: dailyseldomweeklymonthlyhardly evertwice a weekonce a monthdía every-dayonce in a whilemost of the timefrequently, oftenfrom time to timeevery-now-and-thennever 0% of the timeocassionaly, sometimesalways 100% of the time

1NW Vocabulary Wordsearch 2025-10-06

80 Items: tendenciesForced or sentencednot liked or populartreat as unimportantBalance or stabilityDeeply sad and gloomyPull back or withdrawMix or blend togetherSuffering and anxietyImprovement or easingintolerance; prejudiceRandom or unreasonablesecretive; underminingunconventional; unusualBeing unable to breatheact as an impediment to...

Woordsoektog: Skool en Alledaagse Lewe 2025-10-01

18 Items: Iemand wat jou iets leerWaar die onderrig plaasvindReëls en hoe dit toegepas wordWanneer mense met mekaar praatLiggaamlike aktiwiteit of speletjieWerk wat jy by die huis moet voltooiOm nuwe en oorspronklike idees te hê’n Jong persoon wat in die skool leerDie tyd tussen klasse om te rus of eet’n Groep wat saam sport of ’n taak doen...

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

ELC 4 wordsearch 2023-09-25

15 Items: only one type of atomused to separate solids and liquidsname for water that is safe to drinkused to seperate solutes from the liquidused to separate smaller particles from watertwo or more substances not chemically combinedmolecule made of only hydrogen and carbon atomslarge particles settling to the bottom of water...

One Word Search 2024-03-15

18 Items: What is her favourite food to eat?What is Stacey’s favourite colour?What is her favourite sport to watch?What is her favourite alcoholic drink?How many car accidents has she been in?On what day of the week was Stacey born?What is Stacey’s favourite sport to play?What beverage will she not willingly drink?...

Review activity - vocabulary 2025-05-26

18 Items: Not used a lot or enoughA set of ideas you have about someoneSomething you own that has value if soldTo move money from one account to anotherControlling someone to your own advantageSomething that can make you a lot of moneyLearn about the writers, novels and poetryI need to ____ some cash from the the ATM....

Root Word Week 8 2025-10-30

18 Items: - Inborn; existing from birth- relating to a newborn infant- having knowledge or being aware of- a female auditor or one who listens- of or relating to a person's birthday- an instrument designed to aid hearing- he act or result of misconstruing something- a painting done with transparent watercolors...

Juanita - classes 1 and 2 2023-07-27

10 Items: benefitobjectivewithout lucksynonym of fightto notice somethingwith a lot of noiseto care for a child or young animalsynonym of finish (but it's not the same)a formal arrangement to meet or visit somebody at a particular time, for example a doctor.a small piece of metal or plastic, with a design or words on it, that a person wears on their t-shirt.

Vocab Review Word Search 2026-01-07

42 Items: BiasKhanyearTorahkarmaShi'aSunniCartaGhanatradesteleglyphPresssourcesourceQur’anDharmacaliphplaguebridgeof viewnirvanaEvidenceal-Islamhumanismof HeavenYears' WarpictographProtestantRevolutionaristocracyMeritocracyRenaissanceReformationCivilizationAfro-EurasiaChristianityTrephinationDomesticationConstantinoplehunter-gathererservice examination

Wardrobe Word Search 2025-04-30

15 Items: planweekStyleRunwayBeautyOutfitTailorFashionwardrobeevaluateTrendinginventoryaccessoriesof priorityand match wardrobe

Affirmation Word Search 2025-06-26

13 Items: CowRedGreenYellowActionTrafficReleaseTimeoutOf OceanMiraclesSelf-HelpAffirmationExternal-Help

Humanities this Year! 2025-07-16

13 Items: cellsEthicsPyramidCitizenPovertyof lifeWindrushAbortionVolcanoesAbolitionengineeringUrbanisationUtilitarianism

LFW- HR POLICY WORD SEARCH 2023-05-18

10 Items: one of the value of LFWExpenses expenses that cannot be reimbursedMandatory three month every new hire has to serveWhat needs to be checked for accurate paid days dataMonth Tenure of notice period an employee has to serveOff leave that has to be utilised within 1 month’s spanMinimum no. of hours an employee has to give to call it a half day...

Higgins Weekly -Guess The Words! 2023-05-01

18 Items: EggJazzFlat fishShake a cowLot of keysIt's a TriangleThe BEST cookieA Cheesy delight!The Hardest Math ClassA great breakfast foodA two fish constellationGreat for making potteryAn evolved form of shearsBig disk that hit with hammerStupidly hard to spell instrumentAn american-version of buttercreamAnother Stupidly hard to spell instrument...

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

Revolutions, Nationalism, and Unification Extra Credit 2022-12-08

22 Items: peruitalychilegermayargentinaPride in ones countryCommanded the Red Shirts"Brains" of Italian Unificationcountry named after Simon BolivarLiberated: Argentina, Chile & Perucolonizer country of Latin AmericaRegion colonized by Spain and PortugalItaly and Germany were created throughUsing war or military force to unit Germany...