fourth of july Word Searches

Find the Heart word 2025-02-13

17 Items: oftheyouwasforaresaidthattheywithhavewhatcamecomeweresomethere

Multiplication 2025-05-07

17 Items: byofperarearaterowssetstimestwicedoublegroupstripleproductmultiplequadruplemultipliedexponentially

Matthew 11:28 2025-08-03

19 Items: ItomeofallyouwhoandyouandareComegivewillrestheavycarrywearyburdens

English IH Unit 1 Vocabulary 2023-08-16

15 Items: reluctanceouter; marginalfond of arguingsneaky; secretivedestroy completelyextremely poisonousnot fitting; absurdflattery; admirationoverabundance; excessable to see differencesself-satisfaction; smugnesssoak through thoroughly; drenchindifference; casual lack of concernworn through till the threads how; shabby...

English Word Search 2025-10-07

15 Items: plotlooksspeecheffectactionsfictionthoughtsnonfictionType of conflictBig idea of the storythe struggle in the storyplace,time,and mood of a storya diagram that details the story's plotA character that does not change throughout the storywhen an author explicitly tells you details about the character

Elements of Art & Principles of Design 2025-04-08

38 Items: linetintshapespacecolorvalueunityshadepaperrhythmrandompencilmarkererasertexturebalancepatternprimaryneutralorganicregularflowingdrawingpastelsemphasismovementtertiaryceramicspaintingscissorssecondarygeometricproportionbackgroundforegroundprogressivealternatingcomplementary

Global Democracy Challenges 2025-03-05

10 Items: FraudUnrestRegimesCorruptionCensorshipSuppressionInstabilityof Expressionof TransparencyRights Violations

Elements of Art & Principles of Design 2024-09-13

33 Items: HueLineFormShapeDepthWidthColorValueSpaceUnityHeightActualRhythmOrganicShadingTextureImpliedBalancePatternVarietyPositiveNegativeContrastEmphasisMovementGeometricIntensitySaturationHighlightsRepetitionProportionSymmetricalAsymmetrical

Elements of Art & Principles of Design 2025-01-30

33 Items: HueLineFormShapeDepthWidthColorValueSpaceUnityHeightActualRhythmOrganicShadingTextureImpliedBalancePatternVarietyPositiveNegativeContrastEmphasisMovementGeometricIntensitySaturationHighlightsRepetitionProportionSymmetricalAsymmetrical

MONDAY 2014-10-03

15 Items: onsoofallnottheandhoppopcallfallwallballtallwhat

Heart Words 2023-01-23

15 Items: oftoinitisheontheyouandforwashisarethat

Nick the Dragon Slayer 2 2023-10-27

15 Items: oftodomyaredaytheoneanyhavewillwellfromgoodwould

Reyna's Word Search 2024-05-01

15 Items: ofmayhowwayonewhenmorewithmaketimelookyoureachhavethese

List 2 2024-08-26

15 Items: OfRackRakeLickLikeBackBakeKickFakeRockMakeWhatHaveSocksBikes

2nd Week 2 2024-09-06

15 Items: ofbakerackfakerakewhatbacklickrockkickhavelikemakebikessocks

Snap Words Week 3 2024-10-04

15 Items: ofistohishastheandwasyouwillfromsaidtheywantblack

First Group Sight Words 2024-10-29

15 Items: istoofdothewasyouareputhavepullwhatyourtheywere

UNIT 2 HFW 2026-01-26

15 Items: noofnewuseoneeatwhohelplivethenagaintherecouldthreeunder

Kentucky Word Search 2026-01-26

15 Items: ofAliUSAFlagLandKingStateHappyBoxingKentuckytomorrowMuhammedBirthdayGoldenrodPresident

Spelling Test 2026-02-03

15 Items: orohofforouthournorthshorthorsehouseaboutfoundsoutharoundground

Golden Summer 2023-08-10

10 Items: ROYGBIVDihydrogen MonoxideTequila Based CocktailEnclosed Body of WaterWarmest Season of the YearFruit Flavored Frozen TreatBody of Water Surrounded by SandStar at the Center of the Solar SystemFood Consumed During Annual CompetitionAccessory Worn to Protect Eyes from the Sun

EARTHQUAKE AND FAULTS 2017-08-14

14 Items: OFRINGFIREEARTHSPACEFAULTSCALEPACIFICTSUNAMIRICHTEREPICENTERMAGNITUDEINTENSITYEARTHQUAKES

TRICKY WORDS 2023-09-17

14 Items: ofistoonearetwowassaidsayswerehavesomeoncefrom

Heart Word Review - Schwa!! 2024-03-27

14 Items: aofonewasthefromcomesomenonewhatotheraboutnothinganother

Samuel's Instant Words 2025-04-02

14 Items: oftoinisitheontheandyouwasforarethat

Psalm 119:160 (Micah) 2025-05-14

16 Items: ofisofThesumandoneYourwordyourtrutheveryrulesenduresforeverrighteous

And Word Search 2025-09-15

14 Items: isastodoofbemeandseearesaidfromlookbook

And Word Search 2025-09-15

14 Items: isastodoofbemeandseearesaidfromlookbook

John 20:31 2025-10-15

16 Items: ISOFAREYOUMAYTHETHESONGODTHATTHATTHESEJESUSCHRISTWRITTENBELIEVE

Sight words 2025-10-22

14 Items: Iaisontogoofthewasandforgetlikewill

Green Word Search 2025-12-02

16 Items: oftoofdayfoxnowpieplaycakekitegreenapplegreencostumecarnivalcelebration

i love you always in all always💋🍥 2026-01-10

16 Items: ofmyofyouaretheonethelovethatknowProudpeoplebecauseeverydaystrongest

Landmark History 2023-09-13

21 Items: Landmarks first namelandmarks ____ # is 401043In 2013 ____ was appointed CEOLCU serves 2 counties in _____Landmarks saying is Youre_____ hereHow many members did we have by 1973?What position did Joseph Woelfel have?Who was the first PAID employee for us?How many times do we check Night drop a day?we have three of these machines at our branch...

Unit One Review 2024-09-22

23 Items: Example of an ArgumentVocabulary word meaning homeLists sources of informationA statement that can be provedInformation about the main ideaA statement that cannot be provedVocabulary word meaning to pull inThe most important idea about a topicThe controlling idea of an entire textVocabulary word meaning unable to move...

Skyler, Miley, Cherish 2024-10-28

30 Items: A skin growthRed flaky skinExposure to sunSkin inflammationterm for blackheadsContagious red soresReddening of the skinThe blocking of poresInfected hair follicletag Growth on the skinRaised scar after injuryTiny white bumps on faceBecoming highly sensitiveDamaged tissue in the bodyA flat, rough, white growthResult from injury overtime...

Cell Organelles and Cell Transport 2025-09-22

22 Items: basic unit of all organismscell rupture in a hypotonic solutioncell collapse in a hypertonic solutionthe movement of water across a membraneclear fluid that supports cell organellesorganelle that contains digestive enzymesthe movement of solutes across a membraneorganelle that converts energy in the cellsolution with more solutes outside the cell...

Review Word Search for Ch. 2: Classifying Organisms 2025-10-21

24 Items: what fish use to breathwhat dinosaur translates toan animal without a backbonethe phylum that worms belong toto put living things into groupsa mushroom is an example of thisthe gas plants need to make foodthe largest group of invertebrateswhere an amphibian starts its lifethese cover most fish and reptilesthe process plants use to make food...

ERIKA AND CHRISTINA CHRISTMAS 2025-11-15

28 Items: YOUR LAST NAMEYOUR SISTERS NAMEERIKA'S MOMS NAMEERIKA'S DADS NAMEERIKA'S MIDDLE NAMETHE NAME OF YOUR CATCHRISTINA'S MOMS NAMECHRISTINA'S DOGS NAMEERIKA'S BIRTHDAY MONTHNAME OF CHRISTINA'S DADCHRISTINA'S MIDDLE NAMECHRISTINA'S MIDDLE NAMETHE 11TH MONTH OF THE YEARCHRISTINA'S BIRTHDAY MONTHERIKA IS CURRENTLY THIS AGECHERISTINA'S FAVORITE MLB TEAM...

Social Studies Vocabularies 2025-11-27

20 Items: Part of a forest or park.The direction to the left.The direction to the rightThe direction that shows up.North is at the __ of the map.The direction that shows down.West is on this side of the map.East is on this side of the map.A long line of water shown in blue.What a road is represented by on a map.A picture that shows us where things are....

English IH Vocabulary Unit 1 2024-01-11

15 Items: reluctanceouter; marginalfond of arguingsneaky; secretivedestroy completelyextremely poisonousnot fitting; absurdflattery; admirationoverabundance; excessable to see differencesself-satisfaction; smugnesssoak through thoroughly; drenchindifference; casual lack of concernworn through till the threads show; shabby...

Sparkles from the Wheel 2017-04-21

17 Items: InoofNoWaltHearGrasspoetrythingsstrokeLeavesrealismWhitmanStreetsAmericaSingingsimplest

Gold M100W 2018-02-15

16 Items: itinoftobetheandwasthatMondayFridaySundayTuesdayThursdaySaturdayWednesday

My Room 2022-03-12

16 Items: ofBedRugLamptableChestShelfChairPosterPillowCarpetClothesBedsidedrawersCurtainsWardrobe

Word Search Large Print for Adults: 4000+ 2025-04-02

18 Items: ofonofandtheandCalmEasyEyesFullEnjoyHoursBrainGamesMentalVarietyRelaxingStimulation

My Word Search 2025-07-27

18 Items: IamyismyisofatandlotbestnamehavefriendFarizaschoolFarishafriends

Wedding Word Search 2024-03-27

50 Items: amydeanlevilovevowsrsvpwifejulypeterbridegroomgirardsummitcheerssmorestrailsfamilyweddingforeverbestmanflowersdancinghusbandpartnerpatspeakicecreamceremonyhennikeroutdoorsadventuremountainshoneymoongroomsmenchairliftcelebratereceptionguestbooknewlywedsdonutcakehappinessmanofhonorsleighroomsweetheartrhodeislandconnecticutbridesmaidsflowergirls...

Strawberry Word Search 2025-07-31

50 Items: leopenjunejulyroserubylilydeskmemobeachpearlpoppyvirgomouseboardphoneinboxmeteorsummeraugustcicadageminicopierofficeperseidsunburnperidotstaplerprintermeetingnotepadfireworksunshinevacationheatwavelemonadebarbecuelarkspurkeyboardcomputerenvelopecalendarsunscreenhydrangeamoonstonegladiolusstrawberryalexandritehoneysuckleindependence

SUMMER WORD SEARCH 2025-08-08

51 Items: AIRDRYFANHATHOTBIKEBLUEBOATDECKFIREGOLFJUNEJULYKITELAKELAZYPARKPLAYPOOLBEACHDAISYGRILLGRASSGAMESHUMIDOCEANRELAXAUGUSTBIKINIDIVINGDRINKSENERGYFAMILYPICNICCYCLINGFISHINGFRIENDSSANDALSBACKYARDBARBECUEDAYLIGHTHOLIDAYSLEMONADEPOPSICLEADVENTUREAMUSEMENTGARDENINGLIFEGUARDEXCITEMENTFIREWORKDSHAMBURGERS

Julia Word Search 2025-12-18

50 Items: GUSLILOGOLFJOHNLOVERINGJULYPACTJULIAPEACHBRIANBRIDEGROOMOHANASTITCHDISNEYJACLYNANDREWWAXHAWTRAVELANTONIOKRISTENBLESSEDFOREVERROMANCEJACKSONWEDDINGORLANDOFISCHERNICHOLASMARRIOTTBASEBALLJONATHANISABELLATOGETHERSOULMATESAVANNAHLAUGHTERSATURDAYCOPALOCALUCCHESEHAPPINESSMANASQUANENGAGEMENTMANCHESTERGRANDEVISTACELEBRATIONSEVENTEENTHTWENTYSEVEN...

CDs and Money Markets Savings Accounts 2025-07-01

20 Items: Length of time a CD lastsCD ______ can change at anytimeCD stands for ______ of depositNothing _____ people more than peopleNew money to DuTrac = money market ______A money market is a type of ______ accountHow often is money market interest compoundedFrequency in which dividends are posted to a CD...

Types of Technology 2023-08-01

8 Items: A type of technology that includes video assistant referees and flying drones?A type of technology that finds its applications in space flight and airplane design?A type of technology used by farmers who handle large scale production and management.A type of technology that encompasses digital marketing, data management and E-commerce?...

Vocabulary Treasure Hunt. 2013-12-13

19 Items: ofLawwaveOpaquePigmentSpectrumRadiationReflectionReflectionAbsorptionScatteringRefractionDiffractionTransparentTranslucentInterferenceTransmissionElectromagneticElectromagnetic

The Presidency 2017-05-23

17 Items: ofvetooathleaderofficecitizenprimarypopularideologyelectionpresidentincumbentdemocracyconventionnominationsovereigntyconstitution

World History-Chapter 1 Terms 2021-08-15

18 Items: oferaviewbiaspointfossilsourcesourcespeciesprimaryartifactevidencesecondaryscholarlyconclusionarchaeologypaleontologyanthropology

Enkelvoudige en samengestelde zinnen 2025-05-25

17 Items: EnOfAlsPuntOmdatKommaBijzinHoofdzinZinsdeelOnderwerpVoegwoordWerkwoordEnkelvoudigPersoonsvormSamengesteldWerkwoordelijkNaamwoordelijk

Luke 2:11 NIrV 2025-12-04

19 Items: ainoftoHeisthehasyouthethetownbeenbornLordTodayDavidSaviorMessiah

Grade 7-8 MegaFun Word Search 2025-01-14

10 Items: science or logicid, ego and superegoBig fish in a small ......any person who buys a productWilliam..., wrote Lord of the Fliesa town where people lived very longa promise of quality or length of use.symbol of Jesus Christ in Lord of the Fliessystem where the most talented have the powerMalcolm...., wrote David and Goliath and Outliers

History Chapter 14 Word Search Puzzle 2024-03-23

11 Items: the right to votethe use of little or no alcoholic drinkthe teaching of male and female students togethera person who strongly favors doing away with slaverya two-year school for training high school graduates as teachersa community based on a vision of a perfect society sought by reformers...

Unit 19 2024-03-19

12 Items: Married womanThe murder of a fatherHaving to do with a sonChildren or descendantsA founder of a line or raceHaving the qualities of a fatherOne related to or associated withThe study of families and descendantsHaving the qualities of a mother, MotherlyA person living outside his or her native country...

Word Search 2024-04-26

12 Items: AfterwardAn act of rebellion or revengeRecovery of a sickness or injuryA decrease in amount, size, or strengthTo steal, usually something of low valueGood enough for consideration or reasoningPlays or dances that a performer memorizesExcessively; to go over limits or reasoningPast tense of deposit; to drop something off...

Aerodynamics - EXTREME DIFFICULTY - Guess n’ Find Ahaan Rao 2025-04-03

12 Items: The force pushing upMostly causes thrustThe force pushing downAir (1st part of topic)The force pushing forwardsMoving (2nd part of topic)The force pushing backwardsMostly causes drag (two words)People relate this to aerodynamicsAirfoils that generate lift to hold the plane in the air.The study of the motion of air while it interacts with a solid...

Poetry 2025-05-15

12 Items: the name of the poemthe composer of the poemthe T in TEEL stands forthe L in TEEL stands forrepetition of vowel soundsrepetition of consonant soundsPOP is an example of this techniquecomparing two things using like or asgiving inanimate objects human qualities'showing little eyes where to look is an example...

Examples of Euphenisms 2024-05-04

5 Items: instead of died...instead of lied...instead of rich...instead of fired...instead of short...

Bullying IS... 2017-03-02

20 Items: OfOrBeToItIsYouFunForMayMayNotMakeTheyAbleAnytimeSomeoneControlPatheticSomething

Narrative Word Search 2019-05-31

20 Items: ofplotviewtimepointthemeclimaxactionrisingactionperiodfallingsettingconflictelementsnarrativecharacterexpositionresolutioncharacterization

2020 LD PR 1&2 2020-09-09

19 Items: ofBedRugTopBunkDoorFlexNailChairChestCoverFrameTableBottomDrawerdrawersCushionFootboardHeadboard

serije i filmovi 2022-03-18

20 Items: dofusonmy13allareallgamdeadtallgirlthatblockshe'ssquiefridaydinastyeuphoria

chicago word search 2023-05-10

19 Items: ofandbeancubscoldcitybearshotdogmuseumchicagomidwestsciencewhitesoxillinoisindustrywindycitysearstowerlakemichiganmccormickplace

God IS With Us 2024-12-05

19 Items: ofGodMaryLukeMarkJohnsavesinspeaceJesusmightyprinceangelsJosephpeopleMatthewImmanuelwonderfulcounselor

The Word Search 2025-03-21

19 Items: HeAtOnItInIsAsToOfTheAndSheForAreWasYouHisThatWith

Sight Words 2025-09-15

20 Items: ofnoisforallandthewassawtoofromsaidbothcallintowashintoneverwaterright

Heart Word Search Lesson 35-41 2025-10-07

19 Items: Iatodoofhebemetheseearewasyousaidfromlookbookwhathave

ami and akshay search 2023-06-01

50 Items: amijulywifelovepatelringshaldibridegroomgiftsaislepartyfamilyakshayganeshbaraatpherasmandapmehndicheersguestssweetscoupleforeverhusbandkeyportweddingdancingbestmanflowersmaharajsangeetlehengasindoorbouquetceremonymemoriesnewlywedmarriagespeechestogethergroomsmensaptapadireceptionblessingstraditionsphotographbridesmaidsmangalsutracelebration

Teenager 1 2023-06-30

50 Items: mayfurfinflyruncanbadjunejulyfallbirdlionduckheadeyesarmslegsfeetnosebeakswimjumptailcantgoodmarchapriltigermouthclimbaugustsummerwinterspringmonkeystrongjanuaryoctobergiraffedolphinfingersbirthdayfebruarynovemberdecemberkangarooseptembercrocodiledangerouscelebration

Family Reunion 2024-06-06

51 Items: momdadfunsunhuglakesandsnowjulylovekidstahoeauntsgamesboatspartytowelbearsdenimwaterkayakskitspoemslaughbeachbookscabinsfamilyzephyrunclesskiingjetskitennispicnicsmoresreunioncousinshistoryfrisbeesunburnfishingsiblingsbarbecueicecreammemoriesswimmingmountainssunscreenflipflopssunglassesshakespeare

Blue Word Search 2025-06-16

50 Items: ginbluecakegoldhugsjulykonalovenavyoaksroseveilvowswinebridecigargroomloganrockysarahfamilykissesscotchbouquetdancingflowersforeverfriendspromiseromanceweddingcocktailcoloradolovinglymarriagenuptialsproposalsoulmatechampagneguestbookhoneymoonmatrimonynewlywedsflowergirlgreenhousemclaughlinringbearersweetheartcelebrationeverlasting

Tlas Word Search 2025-07-08

50 Items: beercakegoldhugsjulylovenickrosevowswineatlasbridegroomscoutbuffetcalliefamilykissesmonicatahitibellinidancingdessertdiamondflowersforeverfriendsnurserypromiseromancevintageweddingcocktaildecemberlovinglymarriagenuptialsproposalsoulmatetimelesschampagneguestbookhoneymoonmatrimonynewlywedsgreenhouseringbearersweetheartcelebrationeverlasting

El calendario 2025-08-26

23 Items: MayJuneJulyMarchAprilAugustMondayFridaySundayWinterSpringSummerJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySeptemberAutumn (no ~)Saturday (no tilde)Wednesday (no tilde)

days months seasons 2025-10-14

25 Items: MayJuneJulyFallweekMarchAprilMondayFridaySundayAugustWinterSpringSummerTuesdayJanuaryOctoberseasonsThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

CH2 - Waves and the EMS 2022-12-19

27 Items: The lowest point on a transverse wave.________________________The highest point in a transverse wave.________________________The interaction between waves that meet.________________________The material through which a wave travels.________________________A wave that requires a medium through which to travel.________________________...

Topography Word Search 2025-01-11

36 Items: The atmospheric layer above the troposphereA ring-shaped coral reef encircling a lagoonGround or soil that remains frozen year-roundA piece of land completely surrounded by waterA chain or group of islands clustered togetherA vast, treeless grassland in semi-arid regionsA fertile spot in a desert fed by water sources...

Literary Wordsearch 2014-09-04

21 Items: 12ofmoodplottoneviewasidemajorpointthemesimilesymbolpersonpersonsettingmetaphorflashbackcharactercharactercharacter

Trick Words September # 1 2024-09-05

18 Items: Iofiswehemeorthewasandhishassheforyoulookintoyour

Find The Words! 2025-10-15

18 Items: meofinthewasoffyouseeandforputhasgetlikewillwithwantsaid

k sight words 2025-11-19

18 Items: AItpisofdoasforaretheyouwasallputdoesfromyoursaid

common prepositions 2026-02-11

18 Items: tobyofonupoffdownwithontolikenearsinceunderafterbelowuntillwithoutbetween

Answers of place of the city 2018-12-05

20 Items: GYMPUBHOTELCOURTBAKERYCHURCHMOVIESMUSEUMAIRPORTGALLERYLIBRARYBUTCHERHOSPITALBOOKSTORECAFETERIADRUGSTORELAUNDROMATRESTAURANTHAIRDRESSERSUPERMARKET

49_Prophecies of the Fall of Jerusalem 2025-05-15

20 Items: CALFFASTFAMINELAMENTSCRIBESCROLLCISTERNDICTATEINQUIREJEHUKALIMPERIALPROFANEDTREASURYABHORRENTCOURTYARDOFFICIALSWITHDRAWNATTENDANTSPROCLAIMEDDISCOURAGING

Signers of the Declaration of Independence 2025-09-04

55 Items: LeeLeeHartRushRossReadPacaPennHallAdamsPaineGerryFloydLewisClarkSmithChaseStoneWytheHewesLynchElleryMorrisMorrisMortonClymerTaylorWilsonRodneyMcKeanNelsonHooperWaltonHancockWhippleHopkinsShermanWolcottCarrollBraxtonHeywardBartlettThorntonWilliamsStocktonFranklinHarrisonRutledgeGwinnettHopkinsonJeffersonMiddletonHuntingtonLivingstonWitherspoon

Diencephalon 2023-11-29

9 Items: What does the diencephalon release?What happens when the diencephalon is damaged?Where the diencephalon is located within the brain.What segment of the diencephalon produces hormones?What segment of the diencephalon produces melatonin?What ventricle of the brain contains the diencephalon?The diencephalon is superior to what part of the brain?...

civil rights movement 2025-04-09

10 Items: Rosa's last nameDiscrimination against racesThurgood Marshall´s professionFirst name of the leader of the NOIMalcolm's last name before being changedLast name of the 35th president of the USAAction of separating black and white peopleWhat was the most important political role John F. Kennedy held?...

Reformation - Henrique 2025-04-23

10 Items: knwon for being a mystica method of dealing with heresiesTrity that ended the Thirty Years'Warsummoned a council to clarify Catholic teachingsIgnatious of Loyola started this a group of missionariestranslated Bible to English; shaped much of the KJV Bible3 Main Protestan denominations: Lutheranism, Calvinism, _____...

Preeclampsia-May 1 Name: ________________________ 2025-05-06

15 Items: Severe headache may signal worsening preeclampsia.Ongoing assessment of blood pressure, urine, and symptoms.Includes preterm birth, maternal stroke, and fetal distress.Swelling in the hands, face, or feet caused by fluid retention.Presence of protein in the urine, indicating kidney involvement....

JUDAISM 2026-02-04

15 Items: Early oral Jewish lawsWhere Jews go to worshipAncient descendants of JewsSupport of a Jewish homelandBased directly on the MishnahPlace where god spoke to MosesJews living outside their homelandThe coming of age for a Jewish girlArose in 18th century eastern EuropeI am the holiest Jewish day of the yearI celebrate freedom from slavery in Egypt...

MONDAY 2014-10-03

15 Items: onsoofallnottheandhoppopcallfallwallballtallwhat

Spelling Lesson 13 ~ Puzzle 4 2017-01-02

15 Items: ofoffpaidenemyreferaroundimaginefamiliarparallelreligionshepherdeverybodyimmediatecompletelyconscience

Search 47 - Shakespearean Quotations 2019-05-09

16 Items: OfTheDidRunActOneOneTrueLoveNeverNightDreamSceneCourseSmoothMidsummers

Merry Word Search 2023-12-24

15 Items: abeofcanforthismerrythreecoursedinnervoucherqualityredeemedchristmasquestionable

HFW 2024-09-15

15 Items: togoofandwasthearecatratmatmugjugzapzigzag

Unit 14 Word Search 2024-12-03

15 Items: ofwaswhosaidsomeworldearthagainpeopleschoolcountryAmericabecauselibraryordinary