forest Word Searches

My 2026-01-04

196 Items: CarBusBedPenBagBoxCupTeaIceSunSkyDogCatCowPigArtRunCrySadRedBigHotNewOldBadFunPearPlumLimeBikeBoatShipRoadHomeRoomDoorLampBookForkFoodRiceMilkSaltCakeSnowRainMoonStarWindLakeSandRockTreeLeafParkBirdFishGoatLionBearFrogDeerMathSongGamePlayWalkJumpSwimReadDrawMakeHelpCalmBabyNameBluePinkFastSlowColdGoodEasyHardAppleGrapeMangoPeachLemonMelonBerryTrain...

Santa Word Search 2025-11-12

188 Items: ElfToyBowIvyBoxHamPieIceLogJoyEveDayMaryGiftMailListWishTreeStarBowsHymnSongTuneCakePlumCaneMealColdCozyFirePineLoveHopeKindWarmMassGoldSantaClausVixenCometCupidSalesHollyBellsTrainAngelSkirtStandHooksCarolChoirMusicPeaceCheerSauceCiderCandyMinceCocoaFeastSpiceFrostChillCrispWhiteWoodsMerryHappyMagicMyrrhDasherDancerDonnerJosephAngelsGivingRibbon...

Latin 10-12 Review 2025-04-14

61 Items: wenogodyouournewyesgiftfirenamecavelikealsohorseflameenemyangernightqueenstormcrueltheredangerforestto sendto moveto killto showso greatto buildto fightsuddenlytogetherright handto consumeto destroygrief, painyour, yoursyour, yoursto do, makeimmediatelykeen, fierceand not, norbrave, strongto put, placeto desire, wantfortunate, happy...

grade 5 revision 2025-05-11

21 Items: Way What galaxy do we live in?What falls during an ice storm?What is the closest star to Earth?What is the North Star also called?What force pulls tectonic plates apart?What phase comes after a crescent moon?What type of front brings stormy weather?What is the outermost layer of Earth called?What is plant and animal matter in soil called?...

Happy Word Search 2025-06-03

190 Items: GoGodDogCatDogOwlFunHopJotFallWestEastSithJediFindTheoRainBoatMoatFrogToadKingWandDashLunaHappyGraceJesusTrustSouthNorthGungeCatchKaylaFaithKittyAmazeSweetRobotMuddyNinjaRobinJokerCobraNiftyZebraLionsBearsBellyRadioQueenFungiMilkyMagicHocusPocusFrondPennySpringWinterSummerKittenFlowerLovelyGoldenTomatoPotatoDazzleToppleFlightRobustFlyingPuddle...

Cabin 2026-02-07

195 Items: axebatfoxowlbeardeerdockduskfrogloonbenchbootsbrookcanoecidercreekgoosekayakbeaverbridgeforestgardenmeadowpaddlepantryquiltsrabbitsunsettimbertinmugantlersblanketbluejaybunkbedcandlesdrawersfirepitflannelhammockicedtealanternloftbedmatchesmudroomraccoonsunrisethermosupnorthbackdeckbarefootbarbecuebootrackcampfirecastironchipmunkfreshairlakeswim...

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

UNITS 1 AND 2 2025-10-21

1 Item: FIELD FOREST LAKE MOUNTAIN PATH RIVER VILLAGE CROWN NECKLACE BRACELET SWORD SHIELD KNIGHT QUEEN BOWANDARROW BELT HELMET

Panda Bears and Zoo Friends 2026-02-04

1 Item: zoo, bamboo, waterfall, carrots, Bing, RubyMei, Jade, tree, stars, sun, moon, hill, friends, bears, plane, forest, moving

Panda Bears and Zoo Friends 2026-02-04

1 Item: zoo, bamboo, waterfall, carrots, Bing, RubyMei, Jade, tree, stars, sun, moon, hill, friends, bears, plane, forest, moving

History & Wildlife Conservation 2024-01-17

27 Items: value to earn moneyfirst national parkfather of soil conservationpublished a book about birdssystem of safe wildlife areaspart of USDA to manage forestsvalue to enjoy wildlife's beautyfather of the conservation movementpopulation is close to becoming extinctthe use of natural resources for profitpopulation is close to being endangered...

Environment Stewardship 2025-05-06

20 Items: Long-term weather patterns in a regionTo break down naturally by microorganismsA poisonous substance harmful to the environmentA natural or artificial lake used to store waterThe upper layer of a forest formed by tree crownsTo plant trees in areas where forests were removedImproper disposal of trash in public or natural spaces...

Camping 2025-08-20

23 Items: A person who goes campingA portable shelter made of fabricA path used for hiking or walkingA device used to determine directionAustralian version of a sleeping bagThe open air and natural environmentCatching fish, often in lakes or riversA tool for cutting and various other tasksA portable stove used for cooking outdoors...

Level Infinity - Just for fun 2026-02-06

200 Items: KeyFernRainCornMilkAtomMarsMoonStarDeskDoorLampRoofSinkSofaYardEagleGeckoHippoKoalaMooseOceanOtterRiverAppleBaconBagelBasilBreadCreamHoneyJuiceLemonMelonOliveOnionPastaPeachPizzaCometLaserLightOrbitSolarVenusAtticChairCouchFenceFloorGlassPorchRadioShelfTableTowelBadgerBambooBeaverBeetleBreezeCactusCanyonFalconForestHornetJaguarJungleLagoonLizard...

The sight of the beavers 2026-01-08

1 Item: father, notches, Tribet, forest wilderness, battle, characters, friendship, knife, Native American, fish arrow, bow, cabin attean Matt bear beaver

Halloween Word Search 2026-03-03

209 Items: BatBooFogHexIceOrbOwlRatRIPWebBrewCapeFearGlowGrinGustHissHoodHowlJackMaskMazeMoanMoonRainRobeTailToadVineWindYowlAppleAshesAtticBlackBloodBonesBootsCabinCandyCarveCiderCloakClawsCreakCurseDemonDevilDreadEerieEmberFangsFiendFrostGhoulGhostGloomGourdGroanGummyHornsMagicMurkyNightPanicPatchRavenScaryShackShockSkullSmokeSnarlSpellStormSugarTaffyTarot...

North Word Search 2024-10-08

27 Items: Capital of FranceCurrency of ItalyHe discovered zeroPerfume city of IndiaThe cleanest city of IndiaThe Diamond City of GujaratThe longest river in the worldA brand with a tick mark symbolThe largest forest in the worldGates: The founder of MicrosoftThe religious book of ChristiansThe biggest devotee of Lord ShivaThe largest organ in a human body...

blah blah blahah 2025-07-25

200 Items: CRULAXRueBayJetNerdEXAMLAUXGoldSageTofuAloeShipGrayPondOZZILionRockPENSPineTramALANACreekTruckBINGOYuccaBOOSTPeachCOATEOnionTrainOasisMulanMopedDonutEAGLEDANCEEZONERobinBrownWoodySlothWINGSWENTZKhakiPlaneLilacGreenSteakGERMANStitchLizardPurpleGliderBronzeDISTEMCanyonBadgerBurgerUrsulaGrapesMaroonJessieBucketYellowForestCraterDEGREEGENEDSViolet...

lessons 1 & 2 2023-12-18

1 Item: destroy, payattention, natural, instead, future, human, plain, endangered, increase,protect, example, powerful, rocky,liquid, thousand, exercise, defend, carry, healthy, collect

Vocabulary 2025-11-03

12 Items: When someone’s hair is neatly styled or arranged.Something that comes from or relates to the Bible.When someone or something is famous for a bad reason.Doing something in an orderly, careful, step-by-step way.Copies or repeats something so it looks or happens the same way again....

The Sand creek massacre 2026-03-24

1 Item: Danger Army Murder Colorado Denver Tribe Sandy Creek Massacre News Attacked TPs Eighteen Hundreds Towns Forest Native Centennial Thirty Eight

MAINE 2023-10-02

1 Item: moose, Moosehead, wharf, beach, island, Portland, Baxter, lighthouse, shipyard, blueberry Pine, spruce, maple, lake, river, forest, mountain, seafood, quahog, wildflower, Timberwolf

Camping Trip 2026-01-19

1 Item: Fire Marshmallow Compass Hiking Map Bear Wood Rope Bug Spray Lake Moon Smores Lantern Sleeping Bag Canteen Trail Canoe Forest Stars

Mountain, Word Search 2025-12-07

4 Items: river, ocean, forest, desert, island, valley, volcano, canyon, waterfall, jungle, beach, prairie, swamp, glacier, planet, galaxy, star, moon, sun, comet, asteroid, nebula, orbit, cosmos....

Nature 2024-10-30

9 Items: What type of area is filled with tall trees, plants, and diverse wildlife?What are the large hills of sand you might see at the beach or in the desert?What is a steep, high rock face that drops down to the ground or water below?What long, flowing body of water can be found on land and often leads to the sea?...

Extraterritoriality Word Search 2024-11-18

17 Items: upper classpayment for losses in warthe destruction of forest landsomeone sent on a religious missionprovincial ruler in the Ottoman empirespecial economic rights given to a foreign powerthe isolation of women in separate living quarterssituation in which a country imports more than it exports...

gemstones 2025-03-24

34 Items: 24karat.Pure white.It’s too red.Cute and teal.Once again. Blue.The gem of December.When lava cools down.The “water sapphire”.A lime green gemstone.The blood red gemstone.The dark blue gemstone.A pretty pink gemstone.The citrus colored gem.Very blue. Very marine.A purple type of quartz.The greenest of them allVery red and very pretty....

Our State October word search 2025-10-02

20 Items: Source of strength for Ashe County beekeepers.Mountain town whose hotel became a post-flood symbol.Natural feature chased along the state’s scenic byway.Nutty partner to dark chocolate in a sweet-salty bark.Thousands of flowers planted in Swannanoa after Helene.New tributary restored in Todd by a pair of waterwomen....

Harry potter 2024-12-21

140 Items: NoxAccioAurorDobbyLumosMoonySeersBezoarCrucioFluffyHealerHedwigHowlerKeeperNaginiSquibsAnimagiBeatersChasersGoblinsImperioLeviosaMad-EyeMugglesProtegoQuaffleRefereeSeekersStupefyBasiliskBludgersBoggartsHogwartsPensieveUnicornsVampiresWormtailAlohomoraChristmasDark-LordDementorsHalloweenHogsmeadeHorcruxesMerpeopleMudbloodsMuffliatoObliviatePhoenixes...

Toa Mata Era 1 2025-08-22

36 Items: the average villagera huge bull-like beasta large wasp-like beasta hero filled with adhdthe great mask of speeda hero filled with angera hero filled with pridethe glacial village of icethe sandy village of stonethe treetop village of aira hero filled with empathythe great mask of strengththe charred village of firea gigantic tiger-like beast...

Cameron Word Search 2025-12-11

1 Item: jacky brent cabin snow woods fear secret memory voices dreams farmhouse silence tracks footsteps night forest hiding escape truth danger mystery whisper shadows blood fence storm scream window

Kids Movies 2025-12-01

1 Item: adventure, magical, funny, brave, hero, heroine, sidekick, villain, quest, journey, friendship, teamwork, imagination, castle, forest, kingdom, treasure, mystery, mission, talking, animals, wizard, fairy, dragon, pirate, robot, superhero, secret, danger,

Apple Word Search 2025-10-30

250 Items: figeggpieoiltearumiceskyseacatdogcowpigratfoxbatantbeedaysunpenartrunflybuscarbedbagboxcuppearplumlimekiwidatecornpeasriceoatsmilkmeatfishporkbeeflambsaltcakesoupherbsodawinebeerfirewindrainsnowrocklaketreeleafrootseedbirdfishgoatwolfbearlionfrogwormsoulmoonstartimeyearweektalemythbookpagewordsongdrumbandstepmovewalkjumpfallswimdiverideroadpathbike...

Level Infinity - Just for fun 2026-02-06

250 Items: KeyMapFernRainCornMilkAtomMarsMoonStarDeskDoorLampRoofSinkSofaYardCityNilePathRoadEagleGeckoHippoKoalaMooseOceanOtterRiverAppleBaconBagelBasilBreadCreamHoneyJuiceLemonMelonOliveOnionPastaPeachPizzaCometLaserLightOrbitSolarVenusAtticChairCouchFenceFloorGlassPorchRadioShelfTableTowelAndesAtlasBeachCanalCoastGlobeNorthPlaneSouthTrainBadgerBambooBeaver...

Cottage 2026-02-18

250 Items: baybbqbedbughaticelogmapmugnetoakowlpieskysunbaitbarnbearbirdboatbunkcampcorncovedeckdeerdockfarmfirefishfrogheathikelakeleafloftloonovenparkpathpierpinerainraftroadrockropesandshedsnowsofaswimtenttidetoadtowntreetripwalkbeachberrybreadcanoechairchesschipscliffcoastcreekfloatgamesgrassgrillgrovekayaklunchmarshmusicnightporchquietrelaxsaunashade...

Grimm 2025-10-20

181 Items: EveBudNickHankWogeAlpeEricMaulGrimmDianaWesenKellyLeshyMarieMusaiAbathBalamFlailStaffLöwenGeierMonroeCoyotlVerratAswangAnubisScytheViktorSchadeNaiadsLuisonKanaboLabrysHybridAmarokViennaRosaleeGermanyBlutbadAdalindTheresaMeisnerWendigoSchakalKrampusKoschieKitsuneInugamiDiariesTrailerMacheteKennethReapersFuilcréTaweretPortlandFuchsbauJulietteEisbiber...

Hull Word Search 2025-07-01

26 Items: Born in HullHad a Bass voiceHis wife was PatWorked in the AdmiraltyWent to Balliol at OxfordSquire, his daughter KateWent to school in LongdeneSupported Nottingham ForestWas Vice Chair of Age ConcernSkipper, his daughter EleanorUsed to sing in the LSO chorusWas Chair of Fishguard FestivalFluffy, the cat who adopted his lap...

Family Word Search of the Year 2025-09-24

250 Items: tenauntbellboatbowlbullcakecellcrabcubecyandirtexitfallfiregreyhearherehoopkarakelpknowleahleaplevilionnoseopenpinequizrainreadroadroseseedsellstewswimtipstubetunawalkwoodzoosadultafteralphaappleaveryavoidbagelbibleblackboxerbrickbrodybrownbrushcacticanoeclosecobracoralditcheagleemilyenterethanfightfoggygoudagreenhearthellohumidhyenakingskoalalogan...

Mega Word Search 2025-12-19

250 Items: sundogcatfoxowlashicefogredsawpearplummoonlionbearwolfdeerhawkcrowswanducktreebushleafrootseedvinemossroadcityportbookglowfirerainwindsnowmisttimepastmythhopegamebluegoldironrubyopaltoolnailropeshipboatraftapplegrapelemonpeachmelonriveroceanbeachcliffcometorbithorsetigereagleravengrasshousetowerpaperstorymusicversepianodrumslightsparkflamesmoke...

Life Science 2025-03-25

1 Item: Trait, Instinct, learned behavior, Producer, consumer, decomposer, ecosystem, food web, food chain, adaptation, structure, function, desert, savannah, forest, ocean, arctic, apex predator, consume, fungi, sunlight, plants, people, animals, organism, offs

Castles 2025-03-20

20 Items: A big room inside a castle.The son of a king or queen.The daughter of a king or queen.The most important man in a kingdom.The most important woman in a kingdom.A king or queen wears this on their head.There are over 30,000 of these in Ireland!You can look through this to see out of the castle....

Gtgyg 2026-03-27

250 Items: bbqbikedawndeckdeerdockfernhikekitelakeloonparkpierpondalgaebeachcabincanoecliffcreekduneseagleferryfruitgladegrilljerkykayakmaplemoosepatioplumsporchriverrockssaladshadesteakwavesarcadebeaverbreezebugnetcameracampercheesechaletcloudsfamilyforestgardengokartguitarhikinghotdogislandmarinameadowpaddleparadepicnicrapidsrvparkscenicsmoressnackssoccer...

Dbdbe 2026-03-15

250 Items: BayBugFanHotNetSeaSkySunTagTanBallCornDeckDockDuskHeatKiteLakePoolSandSwimTentWaveBeachBerryCabinCanoeCatchChalkGrillKayakLoonsMangoPeachPorchSaladSharkShellTowelTrailArcadeBikiniBikingCoolerForestGardenGrapesHikingHotdogIslandLagoonPaddlePapayaPicnicResortRowingSoccerSunhatSunsetTomatoTubingBicycleBoatingBonfireBubblesCampingCoconutCottageFirepit...

Mystery, Word Search 2022-10-28

1 Item: Animal, Earth, Water, Plant, Weather, Mountains, Valley, Forest, Science, Tracks, Scat, Structure, Function, Hike, Observation, Nature, Outside, Friendship, Owl, Squirrel, Deer, Coyote, Hawk, Raccoon, Nocturnal, Respect, Willow, Community, Stars, Frog, Co

Teenager Word Search 2024-09-23

1 Item: compete overcome trailer tvhost forest advert lookfor apply skills reliable nimble cunning silly outgoing weak strong selfish resistant coward slightly quite pretty smart competitive contender contestant which introduce wasborn keenon fondof crazyabout ca

TERRESTRIAL BIOMES 2025-10-02

20 Items: It is the most arid terrestrial biomeIt protects the Earth from the harmful UVA permanently frozen area of tundra and taigaGrasslands caters for the feeding habit of these animalsIt refers to the amount of water vapor present in the airIt describes the daily climatic condition in an specific area...

Maximilian Word Search 2023-05-14

1 Item: PoppyMc PoppyF Louis Cayden Fletcher Sophie India Libby Grace MrsStedman MrsPeer MrStrong Buddies Regis Barrington Forest Mrs Owen StMarys Devere Happy Memories Leavers YearSix Primary Leavers Playtime MrsBaugh Owls Wrens Woodpeckers Funtimes Maths Englis

Glamping 2026 2026-01-06

1 Item: Sur, Road trip, Beanie, Gloves, Puffer, Tent, Adventure, Camping, Campfire, Sleeping bag, Hot dog, Hot cocoa, Coffee, Fun, Cuddle, Redwood, Trail, forest, stars, hiking, s'mores, wildlife, outdoors, serenity, map, canteen, lantern, creek, mountain, Ocean,

Terrestrial Biome 2025-10-02

19 Items: A permanently frozen area of tundra and taigaIt is considered as the most arid terrestrial biomeGrasslands caters for the feeding habit of these animalsIt refers to the amount of water vapor present in the airIt describes the daily climatic condition in an specific areaThe type of trees that are specifically found in tropical forest...

Snowy Destination 2025-11-07

1 Item: sky, big, gray, clouds, freezing, wind, birds, tall, mountains, snow, cold, ducks, smoke, neighborhood, homes, houses, restaurant, stores, deer, trees, sidewalk, bare, forest, woods, kids, students, class, school, bus, car, white, little, rabbit, bunny, g

grade 5 2026-01-28

1 Item: volcano island lake river jungle forest desert cave waterfall whale dolphin shark turtle octopus jellyfish seal crab starfish jaguar lizard hippo cheetah chimpanzee bat dangerous heavy intelligent beautiful strong light fast slow tall small interesting fr

Ben 2025-07-03

1 Item: sketch, drawing, pencil, color, shade, pastel, canvas, line, brush, art, create, imagine, museum, poster, picture, design, doodle, frame, gallery, owl, bird, wings, feather, fly, beak, nest, eggs, forest, sky, chirp, hunt, snow, white, Arctic, cold, wild,

SUPER ULTRA HALLY LABS WORD SEARCH PROVIDED BY NLBOY AKA LOLGOD AKA LOL DEVIL AKA LOLGOD PHASE 2 AKA LGGP2(LOLDEVIL),,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, RAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 2024-05-04

159 Items: rqhyiekofønjaqlnekomr.rspurflawink1tāzīblotfuzzura.kettusigmaaaltotranqminusdariuseugeneklippamayhemrenard4-eyesadraenazraelhecatemantismosaicmarrowsporesesteemnegarenoopartsrotteentruxtonreslardarcregnconcernburningaurastysbandettodownloademoticonkitsune²rqlaji-2d-mode-dlollipopmgd-crewpavilionoverviewperfect7gossamermayfrostazrael-iidetergent...

The Boy Who Harnessed the Wind Vocab #1-3 2025-10-02

33 Items: very thinto mock or insultto produce or makeconfusion or disorderunstable or unbalancedto set up or to establishto control in order to usean extreme shortage of foodluck or chance in the futurean honor or a special benefitto be kept active or energizedto let loose or set into motionhaving a sweet or pleasant smellto figure out, solve, or plan ahead...

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Latitude Word Search 2025-01-11

30 Items: A group or chain of islandsWhere the land meets the oceanA body of water surrounded by landA large area covered mainly with treesA cold, treeless region with frozen groundA large area of flat or gently rolling landA nation with its own government and bordersA low area of land between hills or mountainsA piece of land completely surrounded by water...

1313 2026-01-13

47 Items: cat[nek] n.脖子[weɪl] n.鲸[sneɪk] n.蛇[ʃɑːk] n.鲨鱼[pɪk] v.捡;摘[trʌŋk] n.象鼻[ˈæfrɪkə] 非洲[ˈiːɡl] n.雕;鹰[ɡes] v.猜测;估计[lʌk] n.幸运,运气[ˈkæri] v.拿;提[kɪl] v.杀死;弄死[ˈfɒrɪst] n.森林[ˈaɪvəri] n.象牙[ˈpeŋɡwɪn] n.企鹅[dʒəˈrɑːf] n.长颈鹿[ˈsænwɪtʃ] n.三明治[seɪv] v.救;储蓄;保存up [pɪk ʌp] 拿起;举起[ˈswɪmə(r)] n.游泳者[kwaɪt] adv.相当;完全a [kwaɪt ə] 相当;非常[ˈhɪərɪŋ] n.听力;听觉[ænˈtɑːktɪkə] 南极洲...

Rach Fault 2023-09-13

40 Items: A long trip or voyage.An insect with colorful wings.A high landform with steep sides.An exciting and daring experience.Valuable objects hidden or buried.A musical instrument with strings.A highly intelligent marine mammal.A dense forest with heavy rainfall.A pleasing arrangement of elements.A sea creature with eight tentacles....

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Herculesandthetwelvelabors Word Search 2022-08-09

10 Items: A young Greek king needs to retrieve the Golden Fleece to retrieve his throne, and many adventures arise.The Greek hero of the Trojan War endured multiple challenges and adventures on his ten year voyage home to Ithaca.A Greek demigod is forced to complete a list of challenges as a punishment for something he did while under a spell....

Military and Civil Leaders 2025-03-24

25 Items: Commander of American forces in Europe during WWIsocial reformer who campaigned for women's rightsreceived the Congressional Medal of Honor for bravery during WWIIsoldier whose action in the Argonne Forest made him an American heroAmerican general, who commanded allied troops in the Pacific during World War II...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Marine Science 2 Word Search 2024-11-18

42 Items: To dry out.Slow sinking.A forest of mangrove trees.Being out of air and submerged.Water of intermediate salinity.A gas-filled bladder in seaweeds.Animals that burrow in the substrate.A current that is generated by tides.Being out of water and exposed to air.The intensity of the impact of a wave.A fleshy plant that accumulates water....

4B 0617 2023-06-16

24 Items: The beach ball is floating on the ________ of the sea.When you go to the zoo, you can see a ________ of animals.After drinking too much ice cream, Emily had a terrible ________.The more you exercise, the faster and stronger your ________ are.Dolphins are very smart animals. They can __________ with each other....

Herculesandthetwelvelabors Word Search 2022-08-09

15 Items: A young Greek king needs to retrieve the Golden Fleece to retrieve his throne, and many adventures arise.The Greek hero of the Trojan War endured multiple challenges and adventures on his ten year voyage home to Ithaca.A Greek demigod is forced to conquer a list of challenges as a punishment for something he did while under a spell....