food Word Searches

Au marché 2025-08-18

44 Items: jameggpearfoodricemealbeefporktunameatfruitpeachapplepastalunchsnailsteaksaladonionbananaorangetomatoyogurtdinnergarliccarrotpotatopepperto cookseafoodchickensausagelettucepie/tartto orderto tastebreakfastvegetablelet's eat!strawberrygreen peassupermarketafternoon snackto go shopping/grocery shopping

Goal 1: No Poverty (100 Words) 2025-11-17

100 Items: UsAidBuyGetJobOwnPayTryBankCareCashCopeCostEarnFairFeedFoodFreeGiveGoodGrowHomeHopeKindLifeLoanLookLoveManyMealNeedPlanRentSafeSaveStayUnitWantWarmWellWorkZeroHopeBasicCheapDreamEqualHappyLearnMoneyPeacePowerPriceProudRaiseReachShareStartTruthWorldValueAssistBetterBorrowBudgetChangeChoiceCreditDinnerDonateFamilyFriendFutureHealthHonestIncomeInvest...

Water Word Search 2026-03-13

101 Items: orushowdidmanwhorancatneweatourtwohasyesdogfoxwayredseaboybedmaysaycarawaygoodwantovertookhomeknowbearlongplaytakewellfindmoreI’lltreefoodbeenstopmustdoornextworklotsneedbabyfishgavelivesoonheadkingtownI’vewatergoingwherewouldthinkcan’tagainafterroundmagicotherrightthesebeganneverfirstmousestillfoundnightsmallthreeeveryUriahschooldidn’tthingswanted...

Fiu Word Search 2024-07-27

8 Items: The bride’s maiden nameThe groom was born hereThis is the bride’s hometownThe groom plays this sport oftenThe bride and groom’s favorite foodThis is where the bride and groom metThe first country the bride and groom visited togetherThe amount of years they dated before moving in together

Emily in Paris: Emily and Alfie 2025-07-31

8 Items: The taste of foodA small meal amountMoved to a new job or locationSomething elegant or expensiveAdvertising and selling productsA phrase meaning “don’t like” (three words, no spaces)A person who shows others around a place (two words, no space)To start liking something more over time (two words, no space)

MAR 2026-03-02

8 Items: SeaA sailorSituated by the seaOf or relating to the sealiving in the sea environmentA small body of water where boats are keptRelating to ships, sailing, and ocean navigationA seasoned liquid or paste to soak food in for extra flavoring (originally meaning pickled in the sea)

Eid Word Search 2026-03-29

8 Items: when does the fast endhow is eid day commenced?What determines when eid is?what do people do after Ramadanwhat is a big feature of Eid day?what do people break their fast with?when does the daily fast in Ramadan commencecelebration to conclude a month of fasting in Ramadan

Jacob's Word Search 2015-02-07

96 Items: AmAsAxBeGoIsItOhTvUpWeAndAntBagBeeBenCanCarCatDadDanDogFanFigFinForFoxHamHatHenLetMadManMomOffPotRugSadTabTheVanWonZooBedsCrowDirtDiveDuckEvenFastFishFlatFoodiPadLegoLionMadeRaceRockSackSandShipShowSledSnowSockThatWereWhenAppleBeastCraneEagleHandyMagicNeedsOceanPowerQuackQuestQuillQuiltSmileStickStingTruckWaterAlwaysBananaBusterElevenHeroesStrong...

Animatic Battle Word Search 2025-03-26

66 Items: DojejPeaTeaAcidRaidShoeSlopDON'TEjectHivesNachoShareTieryShiftyStickyB-BlockBob-ombBouquetNonagonNotepadPopcornPrinterSPAS-12TomaterEucerinCheez-itDioptaseEyepatchMeatballMushroomWeatheryAnimaticDoorframeEggnog.JrJuice-BoxLandscapeMinidiscySchool-IDSeason-17SquirtgunYoshi-EggCane's-CupClay-BrickCrazy-FoodDemon-CoreFlashlightOils-PaintPeppermint...

Cole And Olivia 2025-04-14

20 Items: Cole’ first job?Olivia’s eye color?Olivia’s first job?Chipotle or Moe’s ?Skyline or Goldstar?What breed is Creed?Cole’s mother’s name?Olivia’s mother’s name?Favorite Sandwhich Shop?Olivia’s favorite hobby?Cole’s Football Position?Cole’s favorite TV series?What is Cole’s profession?What was Cole’s cat’s name?Olivia’s favorite TV series?...

Abel Word Search 2025-08-16

101 Items: OXAWEDAYGODNEWSIXABELBENTCITYDAYSEVILFEARFIREFOODHOLYLORDLUKERIDERISEYOKEZIONAMONGBLOODBONESBOUNDCROWDCUREDGLOOMDEATHEARTHOFFERGLOOMGUIDEJACOBJESUSJUDGELIGHTMOSESMOUNTNEEDSORDERRUINSSATANSHAMESTOODUNTIEWOMANYEARSANGELSANIMALBREACHDONKEYENDUREENTIREESCAPEFESTALFINGERGARDENHUNGRYISAIAHLEADERLIVINGMANGERPHRASEPLACESREJECTREMAINABRAHAMAFFAIRSAILMENT...

Isabela Ch 7-8 Vocab 2025-09-25

27 Items: ourfoodI runwe eatfamilyI walkstreetbakeryto buyofficewe walkI thinkto talknormallyice creamsweet breadthey prepareveterinarianice cream shopWe go to churchI take picturesI go to the marketI walk in the parkwe enter the storeHe/she goes to the parka la tienda They go to he storeYou (familiar) go to the shoe store

Vocab Word Search 2025-10-14

25 Items: I amI haveI laughyou areYou sellYou sleephe/she readshe/she holdshe/she leavesdog, accusative pluralgirl, accusative pluraldog, nominative singulargirl, nominative singularslaves, accusative pluralfood, accusative singularliar, nominative singularfriends, nominative pluralcrowd, accusative singularslave, accusative singular...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Leprechaun Word Search 2026-01-11

100 Items: AweJigHatPubJoyCOINGoldKnotHarpMYTHFOODIslekissPipeBeefLuckGreenBrawlIrishDanceMusicMarchpinchBaconLuckyMagicPartyCharmBishopCloverCloaksSNAKESDublinCelticGaelicParadeFiddleLegendCHURCHPotatoOrangePotPieSpringBagpipeHOLIDAYAlcoholEmeraldBaileysSTPADDYTrinityIrelandBlarneyCabbageFortuneHolidayRainbowShamrockcornbeefPIPEBANDCatholicDrinkingHOOLIGAN...

Levi Word Search 2026-05-27

100 Items: uphowwhoallseebigpetbeddogsittheeggbusgetoutyengymhasboxLeviMonaSenahighdoorherenearhandtallforknamesongshiplikepoolbathcampfallworkmathfoodsofabusygirlTaigatablefloorapplechairscorerivertheseclosestoreflutesleepgreenyoursbreadchildhappyplanemetertrainnightYutaroHirotoKanataHarukiTakumaMikotoJotaroHirokocameraletterbananabridgepocketsingerdoctor...

Guilford County Reentry Resources 2026-05-30

100 Items: WayOurNewDayOneFitADSHopeOpenDoorArmyStepWardHighFoodGCCNSeedStopTeenHireGTCCKnowTriadUrbanEPassPointParksAdultHouseLearnFamilyUnitedExpertAlmondChanceChangeFencedStreetClinicMentalHealthRisingBudgetOxfordGrowthSkillsActiveResumeCopingCareerEthicsEmployPurposeProjectJourneyReentryFurtherFreedomMustardMindsetSuccessAwesomeEducateServicesPiedmont...

S4: Unit 6 2022-11-23

20 Items: painrejectgeneralunlikelyimminentenergeticsearch fornot seriousamazing, shockinga way out of a problempeas, beans, lentils, etc.chicken, duck, turkey meathave difficulty doing sth.help you digest faster and betteryoughurt, cream, cheese, milk, etc.food that remained from a previous dayfruit and vegetables are rich in those...

Language Cafe Word Search 2024-07-18

80 Items: 你好再见谢谢是的nono食物帮助朋友家庭房子汽车学校早上夜晚youyesouieauamicarcatdogholaneinaguafoodcibohelpaidelovecasaautobookgatochathundcanehellofavordankewateressenayudaliebeamoreamigohouselibrolivrematinnightnachtnottepleasegraziefriendfamilymaisonschoolschulescuolamañanabonjourgoodbyefamiliemorningfamigliamacchinavous plaîtWiedersehenarrivederci

Abiotic Word Search 2024-07-31

100 Items: dnagpsboabdatadensfirefoodpupsalgaeclamscoralcrabsdingodunesfangsfungijoeyskoalanestsoceanriversharktoxictrapstreeswateralpinebioticdesertdronesdugongforestmagpiemarinenumbatplantspossumpythonspiderspinestaipanwattlewhaleswombatabioticanimalsbanksiaburrowsestuaryflowershabitatoctopuspugglessensorsshelterviruseswallabychemistseucalyptkangaroo...

Good Luck 101 2025-02-16

101 Items: catdogpienewcantrygumredlionthatcaketaperingcardfirelifelarptarptechmakewordfullfoodfreewithtearcokeleerbitebluegraygreygoldironrustreadsoupdarezebrahippoaboutstarsprintvitalpantscrestshiftgravenurseeventfirstpepsicodesgreenblackwhitesteelwritejellysaucelightssearchjacketlingerupdateshowerchargesolvedspritechangeorangeyellowsilverpowderarcaneviable...

sip and cross 2025-09-24

20 Items: bestman's nametheir cats namebrides middle namebrides brothers namemaid of honor's namebrides favorite foodgrooms birthday monthgrooms favorite hobbybrides birthday monthgrooms favorite colordrink served at weddingwhere couple got engagedparty after the ceremonypromise made during ceremonyvacation taken after weddingflowers carried by thr bride...

Thanksgiving / Holiday 2025-11-04

98 Items: funpieyumzapbakecorndishfoodhomemealovensaltwishyamszestacornbastebeansbreadcarveciderclothcreamcrowdfeastgravypartypecanrelaxrollsroastsauceserveslicesmilesnackspoontabletastetoasttreatautumnbutterdinnerfamilygathermashedparaderecipespicessquashturkeywarmthAmericacookingdessertflavorsfriendsharvestholidaykitchennapkinspilgrimplatterpumpkinreunion...

Party Vibes 2025-11-11

100 Items: glamfoodcakemoodpartygiftsdjsetgamesnailstoasttowerthemeguestglosssecretfavorssnacksoutfitmakeupdinnerselfieregiftpopperbrunchcheerslashespajamassweatersparklebestiesfirepitkaraokeinvitesglitterbarcartviplistsequinsstationgiftbagcandlesgroupierecipesmimosasdjboothplaylistconfettimocktailplaylistlipstickballoonslightingcabernetglamteammistletoe...

Thanksgiving 2025-11-16

100 Items: EatNapPieBakeCornDishFarmFastFoodGoodHomeHopeLoveMealNutsOvenSideAcornAppleBeansBreadBrownCheerCiderFeastGourdGravyGreenHonorLoyalMaizeMercyPartyPeacePecanPlateQuietRoastRollsShareSpiceSweetTableAutumnBasketBountyButterChurchColonyDinnerDonateFamilyFellowFlavorFriendGatherGivingGobbleHealthHumbleLessonMemoryNativeOrangeParadePeoplePrayerRecipe...

Goal 1: No Poverty (100 Words) 2025-11-17

100 Items: UsAidBuyGetJobOwnPayTryBankCareCashCopeCostEarnFairFeedFoodFreeGiveGoodGrowHomeHopeKindLifeLoanLookLoveManyMealNeedPlanRentSafeSaveStayUnitWantWarmWellWorkZeroHopeBasicCheapDreamEqualHappyLearnMoneyPeacePowerPriceProudRaiseReachShareStartTruthWorldValueAssistBetterBorrowBudgetChangeChoiceCreditDinnerDonateFamilyFriendFutureHealthHonestIncomeInvest...

2025 in review 2025-12-28

24 Items: ILOVEYOU!riverday onefirst datefirst book seriescheer we eat a tonHow i fell for you firsthow long i will love youbackpacking trip Activatewhat you want to chop downthe month we started datingthe VM’s only breakfast foodwhat we spent half the summer onfirst tv show we watched togetheryou went to your first one last break...

Flower Word Search 2025-12-30

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

100 Word Word Search 2026-05-13

100 Items: unitgeneroadfoodfeardirtmealmoodcitylakeunionunclehoneyhotelowneractorpapernightvideoentrymotifbasinhonorprideacutescoredressdraftclerktruckleaderdealerwriterfarmeragencywealthcountypersonpeoplememberfeelingabsencedrawingpredictcharterlighterexploitovereatpopulareconomydiscussionmanagementpopulationreputationperceptioncomparisonconclusionemployment...

BIG CHRISTMAS WORD SEARCH 2022-12-09

100 Items: bowboxelfevefirlogcanecardcoalfoodgoldtreexmasangelberrybirthcandycheercidercometelvesfaithgracejesusmerrymyrrhsantavixenadventbakingcandlecarolschurchdancereggnogfamilyfrostygloriagrinchiciclejoyfulmangermittenparaderibbonsleighspirittinselturkeywreathblitzencharitychimneycookiesfestiveholidaymiraclenewyearpopcornreceiverudolphscroogesnowman...

Fun Jumps Superbowl LIX Word Search 2025-01-27

100 Items: LIXFANSFLAGFOODPASSPUNTTIEDTURFFINALPARTYPYLONSCORESNEAKTENTSWATCHCHAIRSCHIEFSEAGLESHELMETJERSEYMADDENNACHOSPOINTSRECORDREPLAYSEASONSNACKSSUNDAYTABLESCONCERTDEFENSEENDZONEFRIENDSHANDOFFHOLDINGHOTDOGSKICKOFFLINEMANOFFENSEPENALTYPICKSIXPLAYERSQUARTERREDZONEREFEREETIMEOUTWHISTLECOINTOSSCONFETTIFACEMASKFEBRUARYFUNJUMPSHAILMARYHALFTIMEMIDFIELDSIDELINE...

E2C10 2025-05-05

29 Items: trashsaladhobbyMe tooto cookalreadydog foodto cleanOf coursespaghettinot reallyfrequentlyby the waysupermarketgrass, lawnto do dishesoccasionallythings to doto wash, wipeto throw awayto walk a dogto run errandsto help someoneto mow (the lawn)to do the laundryto do household choresto clean up, to removeto help someone (humble)...

Firehouse Word Search 2025-05-05

100 Items: dogcathubFIVBreSOAPpainspayfoodTPLOFELVexamMasspackspuppyyeastcoccimitesbloodurinefecalNSAIDparvodrugsscaletumorrabiesMonteskennelsamplekittenglovesclinickennellitterglandsneuterscrubsmurmurPupcupseniorfluidsdentalarcadepolishvaccinesurgeryMendozaHensleebandagesyringeneedlescereniaStanleyApoquelBurrowspetdesklibrelarimadylwellnessschedulecleaning...

My city 2025-06-10

46 Items: carbusseazoocafeparkbanktaxitramboatshiplakehotelplanetrainbeachriverschoolmuseumdesertforestislandcinemalibraryairportstadiumbicyclevolcanotheatrehospitaltoy shopmountainice rinkaquariummotorbikewaterfallhelicopterskate parksupermarketpost officesports centreswimming poolpolice stationshopping centreunderground trainfast food restaurant

The bear search 2025-11-17

100 Items: AirIceGodOutTenSixTwoOneAcidLavaDarkVoidHolyBearMythZeusBearWolfJediDoomEpicWordEverLoudDeerFoodKhanMarsNineFiveFourAgonyLaserLightEarthWaterAlphaSigmaAnimeBeastHorseGreenIslamLaughHoneyVenusEarthEightSevenThreeNatureDivineDivineDragonLegendAnimalSearchRabbitCaesarHitlerSaturnUranusTwelveElevenPhantomEpsilonWarriorGriffinPegasusPhoenixDolphin...

Jobs - Network 2 2026-01-21

20 Items: Cut hair.Write booksSing songs.Repair cars.Sell products.Help students.Travel to space.Fly an aeroplane.Perform in films.Create companies.Play an instrument.Show places to people.Wash the floor and walls.Cook food at a restaurant.Make paintings, statues, etc.Take care of people in hospital.Serve customers at a restaurant....

Bride Word Search 2026-03-04

96 Items: LamMayHanReyFarPoeOneLoveVowsRingGownVeilCakeSandKissFoodHomeYodaLukeLeiaSoloKyloAwayHopeDarkSideLunaFinnBobaFettBrideGroomToastUnionNabooForceVaderPadmeAndorRogueEwoksTuxedoHawaiiAlwaysMathewJosephFamilyDinnerChewieOrganaDroidsGalaxyFalconObiWanKenobiAnakinAhsokaBouquetFlowersWeddingRomanceVanessaKaparicFriendsChurrosMexicanItalianWookieeTijuana...

Spanish 2026-04-21

39 Items: hamteaeggsmilktoastbaconlunchsaladapplepizzadrinkbananayogurtcookieorangecheeseto eatsausagehot doglemonadeiced teato drinkto sharebreakfastpan breadfor lunchhamburgerfood,mealsoft drinkfruit saladapple juicecereal ceralstrawberriesfrench friesorange juicefor breakfastvegetable soupwater El cafe coffeeham and cheese sandwitch

Dog Word Search 2024-10-17

10 Items: A soft and independent pet that enjoys lounging and purring.An aquatic animal that lives in water, typically kept in an aquarium.food Special food made for pets like dogs, cats, and other domestic animals.A legless reptile that slithers, sometimes kept as a unique pet in terrariums....

Nutrition Word Search 2026-05-14

20 Items: Units that measure the energy in foodTissues that contract to help you moveThe study of how food affects your bodyDrinking enough water throughout the dayThe 206 bones that give your body its structureThe feeling of being overwhelmed or under pressureThe overall state of being healthy in body and mind...

PLACES IN THE CITY 2024-09-10

24 Items: A place that provides higher education.A place where people put or take out money.A place where you can buy books and magazines.A place that sells fresh meat such as steak and sausages.A place where you can buy medicine and other health items.A place where you can buy fresh bread, sandwiches and cakes....

Unit 16 2025-01-20

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modification.not able to be taken away.symbolic rather than literal.change in form, transformation.to conceal the truth, to deceive.a name that is not one’s true name.to go back and forth, change from one thing to another....

UNIT 16 2024-02-01

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modificationnot able to be taken away.symbolic rather than literalchange in form, transformation.to conceal the truth, to deceive.a name that is not one’s true nameto go back and forth, change from one thing to another....

Unit 16 Greek and Latin Roots Homework 2025-01-24

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modification.not able to be taken away.symbolic rather than literal.change in form, transformation.to conceal the truth, to deceive.a name that is not one’s true name.to go back and forth, change from one thing to another....

Unit 16- Word Search 2025-01-27

12 Items: Rough LikenessTo make hostileTo mimic , imitateA flight or disputeA change or modificationNot able to be taken awaySymbolic Rather than literalTo conceal the truth, to deceiveThe change in form,TransformationA name that is not one's true nameTo go back and forth, Change from one thing to another...

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

UNIT 2 CROSSWORD 2026-05-11

7 Items: a type of castlepenalty for offencea historic city in northern Englandto be more in number than another groupopposition or resistance to one in authorityto die because there is not enough food to eata man with a high social rank, like Edwin and Morcar

Chapter 8 The Flow Of the Food: Preparation 2026-01-30

6 Items: StorageSlackingpreppingEquipmentMicrowaveand Sanitizing

Vocabulary Week 15 2024-12-20

5 Items: The short version of “teaspoon.”The short version of “tablespoon.”To turn on the oven and heat it up.To slowly add ingredients together.To put oil or butter on a pan to keep food from sticking while it bakes.

Places to get food and drinks 2021-03-11

4 Items: StarbucksMcDonaldsBurgerkingChick-fil-a

Global Crises Scramble 2026-03-10

14 Items: TSTMEELTENS (Where humans live)TAREW (H20)_____________________________EGA (How old you are) ___________________DOOF (Solving world hunger)__________________EACPE (no fighting) ___________________________WAL ADN TJSIECU (Legal process)_________________________OPALUTIPNO (the number of people) _________________________...

vocab list 3 word search 2025-10-01

15 Items: WeakToo earlyVery largeTo understandSavage; fierceNo longer livingA flesh eating animalTo save, keep from harmEasy to see and understandAn animal that is hunted for foodA person from whom one is descendedTo cover up or keep from being seenThe time during something lasts or continuesTo stay alive when there is a chance of dying...

Biology Word Search 2026-05-12

40 Items: A change in DNA.Any living thing.A different form of a gene.Tiny single-celled organisms.An animal that hunts other animals.An animal hunted by another animal.The jelly-like material inside a cell.All members of one species in an area.Different populations living together.A nutrient used for growth and repair.A section of DNA that controls a trait....

Dog Word Search 2024-08-19

3 Items: an animal that goes woofa small feral animal that rhymes with hata yummy food that is cold and rhymes with dream

Netherlands 2022-10-31

10 Items: A famous painter.How they say goodbye.A special Dutch food.They love eating cheese.They are all over the Netherlands.Cow, This is where milk comes from.They are know as the national flower.The capital city of of the Netherlands.clogs, They are shoes woren while clog dancing....

Intonation 2024-09-16

10 Items: Are you ready to begin?We are going to "school"(./?)You will eat the "apple" (./?)The test today went "great" (./?)You need to start "studying" (./?)Do you want a big or small "plate"?I liked the pizza, ham, and "chicken".Do you want a medium or large "drink"?The test is going to be "tomorrow" (./?)The food tasted spicy, sour, and "sweet".

Leo Lens: The Monthly Challenge 2025-08-30

10 Items: Capital city of Sri LankaMost popular sport in the countryLocal currency used for transactionsStaple food grain grown in paddy fieldsOfficial language spoken by the majorityTropical fruit used in many local dishesTraditional system of medicine and healingFamous Ceylon export grown in the highlandsNational animal often seen in wildlife parks...

Globalviallage Word Search 2026-01-27

10 Items: Our safe wordOur favorite getawayThe first place we metWhat I want from you (kidding)Your favorite Pokemon characterYour favorite fast food restaurantMy favorite type of kisses you give meThe first movie we watched in the cinemaYou asked me if i used this for accountingThe place I made you blush (I will never let you get over this)

Synonyms 2025-11-15

4 Items: The show commenced at 7:oo p.m.The children buy food at school everyday.Tom assisted his sister with her homework.The road to cross to get to the supermarket was very wide.

Helped Word Search 2025-11-18

4 Items: The show commenced at 7:00 p.m.Tom assisted his sister with her homework.Tom and John buy food at school every day.The road we took to the supermarket was very wide.

Memorial Day 2025-05-20

12 Items: place to bury the deadoutdoor party with foodfight between countriesmember of the armed forcesred, white, and blue bannermonth that we celebrate Memorial Daythe weekday we celebrate Memorial Daypeople march in the street to celebrateschools, banks, government buildings closedMemorial Day honors soldiers that ____ in wars...

jared and laura 31925 2024-07-17

15 Items: Bride's last nameGroom's dream dog breedThe bride's birth monththe name of Jared's catThe groom's birth monthThe chore the groom doesThe town the couple met inThe couple's favorite foodThe bride's favorite hobbyWhere the couple got engagedThe month the groom proposedThe name of their oldest catThe college the couple attended...

Chedvah hey 2025-10-16

15 Items: – My nickname for Miri.– Gitty’s favorite word.– Adina’s favorite food.– My pet everyone “loved.”– RLM’s name for Jellymonns.– Devorah’s bed’s worst memory.– RLM and Pessie’s shared name.– The boys sponged me as a ___.– Perfume vs. sunscreen vs. ___.– Mine and Pessie’s shared future.– Adina and our not-alive bunkmate....

Vocabulary Review 2 2025-02-25

15 Items: The smallest unit of matter.Anything that takes up space and has mass.A living thing, like a plant, that makes its own food.A living thing that eats other living things for energy.The process of liquid water turning into gas (water vapor).A push or pull that can make an object move or change direction....

Marinate Word Search 2026-04-13

10 Items: a sailornext to the searelated to the seaproduced in or by the seaa small port where boats can docka wetland with grasses and no treesto soak food (like meat) in a marinadea ship made to be submerged underwatera bluish-green color or precious stonean imaginary sea creature that is half human and half fish

great depression 2024-10-08

8 Items: biggest economic disasterpeople went without homesperson who runs the united stateswent without food for a period of time \a series of programs that FDR came up withman who got us out of the great depressionman who every one blamed the great depression onchat a thing FDR came up with to communicate things

Wildrice Word Search 2025-11-20

4 Items: Beansone food plants that make up the Three Sistersany of four species of grasses of the Genus Zizania that have grainCorn cultivated 10,00 years ago in the region known today as Mexico

Civil War Technology 2025-12-02

10 Items: Armor for shipsAn explosive deviceSomething that goes underwaterA way to quickly transmit messagesFood that was supplied to soldiersA dangerous and very lethal inventionA rifle used by the union the civil warSomething that was used as a watch towerA rifle used by the confeds in the civil warA way to create photos instead of illustrations

Culture Word Search 2026-03-18

10 Items: - songs and sounds people enjoy- moving the body to music for fun- to enjoy a special time together- stories about people from the past- people living and helping together- pictures, crafts, and creative work- words people use to talk to each other- the way people live, eat, and celebrate- people who love and care for each other...

Cesar Word Search 2026-01-22

10 Items: - Cesar’s last name- being kind and fair to everyone- a leader who helped farm workers- a person who grows food on a farm- solving problems without fighting- people walking together for a cause- a person who guides and helps others- someone who does a job to help others- rules that help people be treated fairly...

Kenny’s Great Big Word Search! 2026-02-13

10 Items: Your car name“Will you be my…?”Your favorite colorYour favorite artistYou say this word a lotYour (OUR) school mascotOur favorite meal to cook together“You make me feel like I’ve been locked out of…”Where I had Indian food with you for the first timeThe name of the cafe we had our first date location in Oxford

Spanish Words Word Search 2026-05-25

10 Items: Creamy caramel dessertSpanish word for friendsDesert plant found in MexicoCelebration with food music and funTraditional wide brimmed Mexican hatFluffy side dish often served with mealsColorful party decoration filled with candySizzling grilled meat with peppers and onionsCommon side dish made from pinto or black beans...

Levels of Organization 2026-06-03

10 Items: a part of a cellgroups of many cellsthe basic unit of lifean individual living thinggroups of different tissuesall the biotic and abiotic things in an areaall the organisms of one species living in one areasystem organs working together to perform a major functionall the different, interacting populations of species in one area...

Ms. Perone's Birthday! 2026-04-09

11 Items: Ms. Perone's favorite foodMs. Perone's favorite colorMs. Perone's favorite plantThe name of Ms. Perone's dogThe color of Ms. Perone's hairSomething Ms. Perone likes to doWhat state is Ms. Perone come from?The name of Ms. Perone's baby nephewWhat is Ms. Perone's favorite animal?The best subject in Ms. Perone's opinion...

What'S Word Search 2024-05-27

13 Items: 食べ物…と~…がほしいチーム,組米,稲,ご飯what isカレー(料理)(…を)する,行う…することができる…に加わる,参加するおどる,ダンスをする…を好む、…が好きである健康で、元気で、よい、じょうずに,うまく,よく

Word Search #1 2025-07-03

13 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?Where do you store your food?Where is the best place to be?What holds your plates and cups?What takes you from point A, to point B?...

Word Search 2026-01-29

12 Items: Guess what?OUR yellow son.Your starter Pokemon!My Favorite Coffee Cake!Your main Football Team!Your favorite Star Wars filmMy number one fast food place!Where we had our first photobooth tgth!The first ever thing you cooked for me!The app where we first started talking!What we say on Facetime before we sleep...

Characteristics of Life 2024-11-15

12 Items: Any living thingAn organisms genetic codeMade of more than one cellChange in a species over timeBacteria are this type of cellAn organism increasing in sizeProkaryotic cells do not have thisChanges in an organisms environmentMaintaining stable internal conditionsAn organism that can make its own foodChanges in an organism over its lifetime...

Carilah jawabannya 2025-11-12

12 Items: a drink from BetawiPattimura comes fromtraditional food from jogjaone famous tradition in Balione of the foods from Betawithe capital city of Indonesiaone of the traditions from Niasthe first president of Indonesiathe hero who founded Taman Siswathe hero who fought for women's rightsa wedding tradition from the Betawi tribe...

October Word Search Puzzle 2025-10-30

12 Items: GLOW – you’ll shine in quiet waysSERENE – calm moments will find youDREAMY – let yourself imagine freelySPARK – new creative energy awakensCOZY – rest and warmth are your themeMAGICAL – expect whimsy and surprisesAUTUMN – embracing change beautifullyBLESSED – gratitude will fill your daysLUCKY – good things are aligning for you...

IYTC January Games 2025-01-26

5 Items: Type of event NorCal will be hostingWhere will Arizona's fundraiser be held?What country has IYTC traveled to in the past?The new platform to view IYTC's latest social media updatesWhat food will be available to purchase at Maryland's fundraiser?

great depression 2024-10-08

8 Items: biggest economic disasterpeople went without homesperson who runs the united stateswent without food for a period of time \a series of programs that FDR came up withman who got us out of the great depressionman who every one blamed the great depression onchat a thing FDR came up with to communicate things

Bill, Word Search 2026-02-25

8 Items: monkeys favorite foodA gorilla with a pet kittenThe theme of this newspapera member of the primate familyWe have these monkeys at our local zooThe name the fans have given Punches toyA cute little monkey who got abandoned by his momThe famous circus chimpanzee at our zoo that passed

word search of food and candy and toys and animles 2026-04-01

8 Items: catdogcandypizzajagurgummyshotdogdoughnuts

Reflect Word Search 2025-04-24

14 Items: Food you eat.It holds water.Lots of colors.You dance to this.When the sun goes up.A light you can carry.When the sun goes down.A special day we celebrate.Bright, colorful lights in the sky.When you think back about something.The season of the year that has flowers.Folded paper you put money or a letter in.Something you do each year for celebration....

How well do you know Vanie? 2024-12-24

13 Items: The year Vanie was bornVanie's favourite singerVanie's favourite cocktailThe place Vanie now lives!The year Vanie got marriedThe island Vanie was born onVanie's favourite (French) dishVanie's passion when not singingThe city where Vanie got engagedVanie's age as of midnight tonight!Vanie's favourite Trini snack / fast food...

City Mouse and Country Mouse Vocabulary Set 1 2026-05-22

17 Items: very goodto defeatdistrustfulsmall rodentunable to be explainedvery cautious and carefulto groom oneself carefullysupernatural ability or power(in acting) an intentional pausea disease that swells the jointsdifficult to deal with or controlexpressed beautifully or emotionallyto speak slowly with drawn out vowels...

yuleysi's word search 2023-03-03

20 Items: sky colorfeel goodgrass colora dark colorbrown personyour moms momfixes your carcuts your hairwhat you see withyou use it to talkwhen you feel downyou drink to hydratewhat people call youthe color of the sunmexican eat them a lotsomewhere you go to learnyou eat it a lot in the summersomething healthy besides veggies...

Rush Revere and the Brave Pilgrims: Ch. 1-4 Vocabulary 2024-01-07

20 Items: hard timesvery stormyvery confidentgreatly surpriseda strainer for foodnot clearly outlinedto bulge or swell outquestioning thoroughlyto act in a loving wayhappening in an instantto think over carefullyhaving or showing successa beginner with no experienceshowing doubt or unwillingnessfeeling or showing embarrassment...

Brooks and Hannah OO 2024-08-27

24 Items: BRIDE'S DOGWHERE THEY MET?THEIR FIRST DATEHANNAH’S SORORITYGROOM'S FIRST DOGWHERE THEY’LL LIVEBROOKS’ MIDDLE NAMETheir favorite lakeWHO WILL MARRY THEMMAID OF HONOR’S NAMEBROOKS’ FAVORITE BEERCOLOR OF GROOM'S EYESGROOM'S BIRTHDAY MONTHMOTHER OF GROOM'S NAMEMOTHER OF BRIDE’S NAMETHEIR FAVORITE TV SHOWBRIDE'S BIRTHDAY MONTHWHERE THEY’LL HONEYMOON...

how well do yk nessa 2025-08-24

24 Items: fav foodfav scentdream jobfav seasonmy fav showmy fav songfav subjectmy fav colorclass we metmy bday monthmy fav singermy fav numberfav sweet treatmy fav restaurantthe activity i dothe thing i collectmy fav clothes storethe instrument I playfav adam sandler moviemy fav guard equipmentfavorite makeup productsport i played for 10 years...

Grace and Ben’s River Voyages and Trivia 2025-08-26

30 Items: FinDIYHydeFishHGTVLovePearlDrumsCoralBanditForeverWeddingAquariumMichiganTinyhouseWisconsinNewlywedsThe Mother of the BrideThe Mother of the GroomThe Bride’s favorite foodThe Grooms favorite sportThe name of the tiny houseThe first state we moved toWhere was our last vacation?The Bride’s undergraduate Alma materThe city the newlyweds now call home...

Jenna & Blake 2025-09-03

22 Items: Brides middle nameGrooms middle nameGrooms go to drinkWhere the couple metBlakes favorite foodThe couple lives hereJennas favorite colorName of the couples dogBrides favorite dessertBrides favorite holidayHoliday Blake likes mostBrides high school sportMonth of their first dateBrides childhood nicknameBlakes dream vacation spot...

Party Word Search 2026-02-22

20 Items: To have funA happy faceA happy shoutA sweet dessertClothes you wearA small amount of foodAn activity with rulesTo enjoy a special daySpecial clothes for funSomething special to eatA liquid you can swallowMoving your body to musicTo hit your hands togetherA sound you make when happyA fun gathering with friendsA musical instrument you hit...

All Things Patty 2025-12-09

14 Items: The wizard and IA food obsessionYour favorite colorYour style of choiceYour favorite flowerShe burns blue for SpyderWho’s your one and only sonYou have these in your mouthYour closet is FULL of theseHe has sun breathing techniqueWhat show do you watch all the timeHe is on your newest pair of converseHe sings your top song on Apple Wrapped...

Our favorite things 2026-02-12

14 Items: how did we meet?Our favorite soda?Our favorite cookies?“do you have the ____?”what do we call each other ?What do we order from Chinese?where did we go on 12/31/2025?we fight over who’s better at?“I NEED TO SMOKE _____EVERYDAY”the first place we traveled too?whats better than weed(sometimes)?in the summer we can’t live without?...

Our Earth and Environment 2023-02-15

14 Items: our planeta dense forestWhat gives us oxygengrows from the groundwhat plants grow fromtaking trash and reusing itthe outer land near a riveranother word for what’s outsidewhere you can find the frogs! 🐸taking food waste and making it soilwhat comes from the sun on warm daysthose on the earth that are not human...

Week 13 Words 2023-05-15

7 Items: You can put this on your food. __________When you move your body to music. ___________This is something you can eat. ______________When you say the words to a song. ____________When you think of something to do. ___________If you don't cook something, it is this. _____________When you do something over and over to get better. _______

Protein Word Search 2025-09-12

6 Items: a nutrient that keeps your body strongthis type of food that is high in proteinproteins helps these tissues repair and growgreen foods that have small amounts of proteinprotein helps your most vital organ work properlyprotein helps your body do this after injury or exercise

Chapter 1 - The First Americans - myWorld Social Studies 2023-01-26

14 Items: to movethe system of growing crops for foodto change in order to live in a new placea group or family member who lived in the pasta large animal that once roamed the Great Plainssomeone who hunts animals and collects wild plants for fooda person who travels from place to place in order to survive...