food Word Searches

Spelling Words 2024-01-10

15 Items: When you’re fun.Combing your hair.When you are unwise.When you were a child.When you are very happy.Something that opens up.A book that has food recipes.The store where you get books.A fantasy / fiction storybook.When something is out of shape.A night animal that loves trash.Food that you might eat for lunch....

Nattaly and Dash OO 2024-07-22

25 Items: Best Man’s NameBride’s Eye ColorGroom’s First NameBride’s First NameMonth Dash ProposedCouple’s Dog’s NameFirst Date locationMaid of Honor’s NameGroom’s Birthday MonthDating App they met onBride’s Birthday MonthBride’s Favorite MovieLocation of EngagementState Groom was born inCouple’s Favorite StoreMother of the Groom’s Name...

Johnny L. Cephus 2025-03-02

25 Items: Johnny's nicknameJohnny's middle nameJohnny's zodiac signJohnny's favorite foodJohnny's favorite hymnJohnny's mother's nameJohnny's favorite snackJohnny's favorite candyJohnny's favorite colorsJohnny's favorite cerealThe month Johnny was bornJohnny's favorite pastimeJohnny's favorite holidayJohnny's favorite soft drinkJohnny's least favorite animal...

pre A1 2026-05-31

20 Items: You read this.A big wild cat.A beautiful plant.A long yellow fruit.A red or green fruit.An animal with wings.A bird that likes water.CREAM A cold sweet food.A place where people live.A sweet food for birthdays.A vehicle with four wheels.An animal that says "woof".A bird that lives on a farm.A scary creature in stories.You use this to take pictures....

Cells 2025-08-01

23 Items: Makes ribosomesThe powerhouse of the cellThe control center of the cellOrganism that makes its own foodGuides proteins to the Golgi BodyUsing the sun's energy to make foodOrganism that cannot make its own foodControls what goes in and out of nucleusDiffusion of water across cell membranesWhere photosynthesis takes place, is green...

Life Experiences 2025-11-28

25 Items: Making food to eatWalking in nature for funMoving your body in waterSleeping in a tent outdoorsGetting new knowledge or skillsHaving fun with toys or friendsEating food outside on a blanketA trip from one place to anotherDoing something kind for someoneSomething exciting you do or exploreSomething you remember from the past...

A+ Unit 10 2025-06-05

22 Items: – Hard to do.– To get something.– To cook in hot oil.– To move to a new place.– To solve or beat a problem.– A person who works in the army.– A food item used to make a dish.– People believe or say something.– Something that happens every day.– When there is not enough of something.– Cooked slowly in a little bit of liquid....

Ju and Bre OO 2025-03-31

34 Items: years togethergrooms fraternitycouples eye colorcouples first dategrooms favorite foodbrides favorite sodagrooms favorite snackcouples favorite storecouples favorite drinkCity Bre and Ju met inbrides favorite animalcouples favorite rapperbrides favorite dessertmonth couple got engagedcouples favorite tv showwho said i love you first...

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

Study Guide 2024-10-24

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Word Search science stuff 2024-10-28

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sunthe two-part naming system for naming organismsgrouping things together based on similar characteristics...

U2P2-Classification 2024-10-28

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Classifying Organisms 2023-11-03

11 Items: - cells have a nucleus- made up of many cells- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

7.5 Word Search 2025-04-03

10 Items: Real or genuine; not fake.Extremely tiring and difficult.The process of becoming larger or wider.Lasting forever or for a very long time.To admit or accept that something is true.A symbol or sign that represents something.Shining brightly; full of happiness or energy.The process by which plants use sunlight to make food....

unit 2 Vocabulary healthy Food 2020-06-09

7 Items: inseasonpackaginghighinsalthighinfiberhighinsugarlocalproduceprocessedfood

Vocabulary Unit 3 - Check-in 2025-05-21

10 Items: Animals have ... to stay warm.Salad is, in ... to fast food, healthy,The experiment below has to do with ...D'Artagnan is one of the famous three ...Nothe Korea is not a ... because people aren't free there.Some zoos make it possible to ... animals. You can even give them names then....

Unicellular Word Search 2023-11-04

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Asaan's Word Search 2024-10-22

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sunthe two-part naming system for naming organismsgrouping things together based on similar characteristics...

Study Guide 2024-10-29

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Unicellular Word Search 2023-10-23

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sungrouping things together based on similar characteristicsnomenclature the two-part naming system for naming organisms...

Science Vocabulary Review! ㋡(Ariah Dominguez) 2024-10-23

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Classifying Organisms word search. 2023-10-20

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Study Guide 2024-10-22

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Ecosystems Vocabulary 2024-12-10

11 Items: A living thing in an ecosystemA non-living part of the ecosystemAn organism that ONLY consumes meatAn organism that ONLY consumes plantsAn organism that makes their own foodThe movement of energy in an ecosystemThe process plants use to make their foodAn organism that breaks down dead materialAn organism that consumes both plants and animals...

TASK 1 Anwar is an athlete help him to find some food which he needs: 2025-05-05

5 Items: A lives in water helps muscles growMeat of a farm animal that gives eggEveryone drinks it when they are thirstyA food that comes from hen and is shaped like an ovalThe food that makes muscles strong and comes from cows

Organs so scary yet so cool! 2024-07-19

11 Items: Organ storing urine before it is excreted from the body.Digestive organ where food is broken down and mixed with digestive enzymes.Pair of organs involved in respiration, exchanging oxygen and carbon dioxide.Long, coiled organs where nutrients and water are absorbed from digested food....

Japanese / IWL Class 2024-03-11

8 Items: 車 (car)太陽 (sun)月 (moon)家 (house)食べ物 (food)友人 (friend)コークス (Coke)ペプシ (Pepsi)

Food and Drinks 2023-07-23

4 Items: friescoffeecheeseburgerorange-juice

Marleu 2025-09-15

5 Items: Marley's dogMarley's celeb crushMarley's favorite sauceMarley's favorite musicianMarley's favorite food franchise

שׁבועות word search 2026-05-20

5 Items: The leaderThe Jewish peopleCold delicious foodName of the mountainThe ten commandments

Who Am I??? 2024-09-30

7 Items: My star signMy hair colorWhere I'm fromA hobby of mineMy favorite foodMy favorite colorMy favorite animal

First Overseas Holiday 2025-09-25

10 Items: Livs JacketLivs InjuriesPlane ActivityFood of ChoiceDrink of ChoiceDoctor AppointmentActual Holiday ActivityHoliday Intended ActivityFirst Overseas City TogetherFirst Activity Holiday Destination

Dream jobs 2026-03-19

10 Items: Cooks foodTakes picturesFlies airplanesHelps sick peopleDesigns buildingsCares for animalsHelps students learnWrites computer codeBuilds and fixes thingsCreates ideas and styles

Confectionary word search 2024-03-08

16 Items: – mashed fruit made into a paste (tyrė)– a protein common in wheat flour (glitimas)– thick mixture used to bake pastries (tešla)– product used to add carbon dioxide in dough (mielės)– mixing device for large quantities of food (plakiklis)– primary appliance used to bake food (vyrykle, krosnis)– tool used to slice food into smaller pieces (trintuvė)...

Omnivore's Dilemma- Part 2- "The Industrial Organic Food Chain" 2026-02-04

25 Items: EPAKahnAlarWeedsKraftFarmerFruitsHippieOrganicCommuneKelloggAtrazineLycopenePesticideCascadianSyntheticIndustrialVegetablesFertilizerStonyfieldMonocultureCooperativePolyphenolsResveratrolAgribusiness

Why are trees important? 2026-03-01

10 Items: A big area of water.Where cars drive fast.An open area with lots of grass.The place you go to get on a plane.Animals live here. Food is grown here.Smoke goes out of the house through it.Jam When cars move very slowly or stop.A hard object that comes from the earth.Small body of water that moves like a river....

World Cultures Vocabulary 2024-11-11

13 Items: A variety of on EarthAll the plants or plant life of a placeThe action of clearing a wide area of treesThe process of replanting an area with treesThe process of water movement through a plantA dense forest rich in biodiversity and heavy rainfallA series of flat areas made on a slope, used for farming...

Airport vocab 2025-04-02

15 Items: el vueloel aviónel pilotoAeropuertoel capitánel maletínla mochilala balanzaLas tiendasLa aerolíneael pasaportela carretillaclass la primera claseLa oficina de migracióncourt el patio de comidas

Peranakan culture food and games 2025-02-22

7 Items: AcarlaksabalikcurryGasingChekiriCongkak

Food for Thought - Chapter 5 2016-04-16

7 Items: surfseedtrialgardenforgivefarmhousepesticide

English Food and Drink Words Derived from Arabic 2025-05-01

15 Items: LimeLemonMochaCarafeCarwayCoffeeHummusAlcoholApricotSaffronSpinachAlbacoreCouscousArtichokeAubergine

HEALTHY AND UNHEALTHY HABITS.- GREEN for healthy habits and RED for unhealthy habits 2024-06-02

16 Items: PRAYVAPINGSMOKE WEEDDRINK WATERNOT SLEEPINGPROCASTINATEOVERTHINKINGWALK YOUR DOGEAT JUNK FOODSLEEP ALL DAYEXERCISE DAILYBRUSH YOUR TEETHWATCH TV ALL DAYWEARING SUNSCREENEAT BALANCED MEALSPLAY VIDEOGAMES ALL DAY

Liveinadoghouse Word Search 2024-04-09

18 Items: - Eat meat - Jeść mięso- Drink milk - Pić mleko- Like cats - Lubić koty- Bite bones - Gryźć kości- Chase mice - Gonić myszy- Eat carrots - Jeść marchewki- Have a collar - Nosić obrożę- Eat dog food - Jeść psią karmę- Walk on leash - Chodzić na smyczy- Play with a ball - Bawić się piłką- Live in a cage - Mieszkać w klatce...

favorites food meal,snack and drink tanpa kunci jawaban 2025-09-09

18 Items: TeaRicesateCakeMilkSodaBreadDonutcreamCandyWaterJuiceCoffeeNoodlesBiscuitrica-ricaFriedriceChocolate

Prof Furman's Jewish Food Class Review Word Search 2026-06-03

15 Items: Fancy mustardJews from UgandaThe ______ BanquetAshkenazi fish dishIsrael's "national snack"Machines make them squareName of the farm we visitedHe made frozen bagels famousClassic deli sandwich fillingJews from the Iberian PeninsulaThese cookies became kosher in the '90sThanksgiving feast dish of Bene Israel Jews...

Turkey Word Search 2025-06-22

12 Items: A big meal with lots of foodA warm sauce poured over foodFeeling happy for what you haveThe people you love and live withWhere everyone sits to eat togetherA soft, yellow bread made with cornWhen fruits and vegetables are pickedA big bird often eaten on ThanksgivingA sweet dessert, often pumpkin or appleBread and herbs cooked inside the turkey...

Elephants!!!!!!! 2026-05-03

11 Items: funwalkingsimilargood timewhat you eatlots of friendsdifferent animalslong ears and greywho they're related tolots of people love themopposite of the last word

Posties BR 0513 2024-04-29

6 Items: things that are discarded in a bindecaying material used as fertiliserwhere most food waste goes when not reusedstudents go to ___ Farm in Yuen Long to make fertilisera food that was used to dye fabric at the Tung Tak School eventthe word to describe the fruits that were discarded for looking unappealing

Food and Drink 2024-09-03

4 Items: PizzaBurgerCoffeeMeatball

Clue #3 2025-09-27

10 Items: My majorfavorite flowerFavorite HolidayMy favorite CandyMy favorite DrinkMy favorite Animalbeach vs mountainsMorning or night owlFavorite food on campusSport I did in highschool

Cooking Terms Word Search 2022-11-03

36 Items: To cook under direct heat or over coals.To cook slowly and for a long time in liquidTo cook over steam rising from boiling water.To combine thoroughly two or more ingredients.To cook in hot fat that completely covers the food.To cook by dry heat, uncovered, usually in the oven.To cook uncovered in a small amount of fat in a pan....

Remita 2020-03-07

60 Items: buscarruneattrykeycitytownhalffindlookkeepknowlikefoodfairyenjoysleepdrinkbuiltsharesolvepapertulipdaisypoppylaterneverFrenchGermantoiletchangesearchfriendschoolgardenbuttonwhitchwizardalwaysEnglishFinnishSwedishLatviankingdomcountryquartercourageexplainhospitalaccidentdaffodilfootballknowledgenewspaperdodgeballsometimesvolleyballbasketball...

Nurture 2023-09-05

60 Items: fuelfoodfatsrestgoalsfocusbuddygreetenrolhappywatersleeptiredcramptrustskillssafetyhazardenergyvaluesgrowthnurturewelcomenervousexcitedanxiousfeelingprotectproteinthirstyweatherbeliefsrespecthonestyteachingpositivefeedbackpreparedexerciseattitudesecuritypatiencecharacterstrengthsbehaviourhydrationnutritioncommunitystrategiesexperienceonboarding...

Love Word Search 2024-10-25

60 Items: SolPazLuzSunSkyAmiVieLoveAmorAguaFoodBookWorkLifeHausHundZeitBuchCielPerroAmigoHouseFelizCieloLibroSaludWaterMusicHappyPeaceLightLiebeEssenChienMusikÉcoleStadtLebenLichtTempsVilleSantéComidaSchoolTiempoCiudadFamilyHealthSchuleFreundMaisonWasserArbeitSoleilFamiliaFriedenFamilleMusiqueHeureuxTravail

1-1 Word Search 1 2024-11-18

63 Items: Iitanmemysunthewayshetoosetsayareflyendallhowwhylowsatfastfastbookfoodfeetwishlookreadgoodhandheretooknameleftgrowtoldmallballsamemovegametheydeepdeeprestwidegreatentercovermightstickblackbelowworlduntilriveracrosswheelsinsidealwayswheelsfeelingimportant

VIAJAR 2025-04-07

26 Items: searoomfoodhiketripsbeachto buyflightwaiterislandforestto seebellboyluggageto walkstreetsto campsceneryto traveairplaneto carryto bringbrochuresto arriveto returnplane ticket

Latin III - Week 2:16 Review 2025-05-01

30 Items: sindaybabylampyearrainholyfoodwinedevilnighttodayangrygrassgrainwaterhappygardenpalacedinnergreedyeveningmorningtomorrowpowerfulforeignermeanwhilethereforeyesterdayinner-organs

Alberta Word Search 2025-07-09

64 Items: DJMOHMOHbeercakefoodgoldhugsloveRSVPveilvowswinealterbridecardscigardressfavorgroomringsusherbuffetbustlefamilyguestskissesAlbertabestmanbouquetcandlesdancingflowersforeverfriendsfriendsforeverpromiseceremonycocktaillovinglymarriagepicturesregistrysoulmatechampagnegroomsmenguestbookhoneymoonrehearsalreceptionbridesmaidengagementgreenhouseFirstDance...

Year 6 2025-08-21

60 Items: BagBedRunCryEatSadBigHotFarmCityShopBookDoorBallJumpPlaySingWalkTalkWakeColdFoodWorkWaterRiverChairTableDanceSmileLaughDrinkSleepHappySmallHouseGamesStoryForestPencilWindowListenSchoolFamilyFriendGardenTravelMarketHealthNatureVillageKitchenTeacherAnimalsClothesWeatherCountryHolidayMountainBathroomTransport

Week 19: Diphthongs - au, aw, oo 2025-08-24

60 Items: pawsawjawrawdrawclawflawhaulsoupmoonfoodpoolcoolrooftoolbootroothookcookfoottookwoodgoodwoolstrawvaultspoondroolshootbroomsnoopshookstoodwhoopfloodlaunchautumnauthorsaucerbabooncocoonlagoonbroochlaundrycautionawesomeexhaustraccooncartoontyphoonbookletlookoutdaughteroverlookloopholecookbookawkwardlyafternoonmoonlightoutpouring

Basic Vocabulary in Spanish 2025-09-26

27 Items: – my– is– pet– day– Mrs– name– date– food– year– hello– today– sport– fruit– color– class– month– number– school– friend– student– Spanish– birthday– (male) teacher– (female) teacher– last name / surname– (male) teacher / professor– (female) teacher / professor

Freestyle Word Search 2025-12-05

61 Items: JogFakeShotDietFoodDualShelfAnkleMusicHoneyBigboySingleSprawlStanceSitoutCradleWarmupSprintWeightEscapeTimingMovingBananaWhizzerStandupLazymanTreetopStretchPositionFootworkScrambleCooldownPracticeTakedownReversalPhysicalSkyhawksStrengthLiquidivFreestyleDoublelegWrestlingDuckunderHeadthrowFolkstyleDownblockMentalityCommittedPrecisionTechnique...

JESSE & MORGAN 2025-08-05

18 Items: What is Jesse eye colour?what their favorite food?what was their first date?What is Morgans eye colour?What is Jesses middle name?What is Morgans middle name?What month did Jesse propose?What is their favorite holiday?What is Morgans favorite hobby?what is their favorite junk food?Where did Jesse propose to Morgan?How many siblings does Jesse have?...

Cooking Terms Word Search 2024-11-13

36 Items: To cook under direct heat or over coals.To cook slowly and for a long time in liquidTo cook over steam rising from boiling water.To combine thoroughly two or more ingredients.To cook in hot fat that completely covers the food.To cook by dry heat, uncovered, usually in the oven.To cook uncovered in a small amount of fat in a pan....

Food Safety Word Search 2026-02-10

5 Items: washcooksanitizebacteriaseparate

Mission: DC 2023-08-11

9 Items: readingsecret agentsthey have wingsa breakfast foodanimals live hereyou need popcorn!something you saysomething you learn in schoolsomething you can't tell anyone

General Energy Science 2026-03-31

15 Items: Medium photons can travel through.Everyday source of chemical energy.Another phase change involving heat.Kinetic energy is proportional to this.Electromagnetic energy is carried by these.Mechanical energy is possessed due to this.Where chemical energy is stored in molecules.A common conductor used in electrical circuits....

On the Move! Animal Migration 2024-11-06

10 Items: To go from one place to anotherTo stay alive, even in hard conditionsA very large number of things or animalsWhat animals and people eat to stay aliveAnimals with feathers and wings that can flyA word to describe when temperatures are higherLiving creatures, like birds, fish, and mammalsSmall creatures with six legs, like ants and butterflies...

Purim 2025-03-02

10 Items: happiness brakes all___the hero of the story (a women)a yummy food that we eat on Purimwe wear___ and conceal our selvesa mean lady that was like her husbandwe read this twice, by day and by nightwe use this when a certain name is readwe give to two people enough for a mealwe increase in this in the month of Adar...

gilmore girls 2021-02-04

61 Items: acemialukerorydeanjessfinnlanekirksukigigijeepsnowyalerichdavyfoodgirlsemilyloganparisdineraprildoyledavidbopitcollintaylormichellouisediggersherrimarthacoffeegilmorelorelairichardbabettemrs.kimjacksonchiltontristanchineseburgersms.pattymadelinepaulankamr.medinatakoutfoodcornstarchsodashoppechristopherstarshollowmovienightslifeordeathhuntsburger...

Sip and Seek 2022-11-11

60 Items: tieliamvowsveilkerrlovefoodwifebridegroomringssongsdancedressgiftsgamesaislecardsshotscorfudubaisuitspartytoastnakitafavourfamilypetalsspeechinvitegardenweddingjesmondfriendsbouquetstylistcandlesfoliagealcoholcupcakehusbandceremonyconfettimaldivesbraceletreceptiongroomsmenjewellerynewcastlehendersonregistrarcufflinkshoneymoonwitnessescelebrate...

Vocab Man 2024-03-06

28 Items: hamteaeggsmilkbreadtoastbaconlunchsaladapplepizzawatercerealbananayogurtcookieorangecheesecoffeeto eatsausagelemonadeto drinkfor lunchhamburgerfood, mealfruit saladstrawberries

3B 2024-05-10

27 Items: badallmeatpeasricefatsmanysteakoniondinnergrapesgrainsbutterto walkbecausepotatoestomatoespastrieseverydayspaghettiice creambeveragessomethingI´m hungryI´m thirstyto exercisechicken (food)

Everything (semuanya) 2024-07-26

62 Items: eggfoodricebobamilksoapeyesbodyrashmangobreadgermsnursefevercoughdizzylunchjuliedurianfruitscerealdoctorbananatomatoorangecarrotdinnerhealthynoodlesspinachchickenlegpainrunningwalkingsurfingcyclingreadingbacteriamosquitohospitalheadacheshouldervomitingexerciseswimmingskippingfootballbadmintonbreakfaststephaniemangosteenvegetablescleanwater...

RGR Unit 18 Word Hunt: "/oo/" 2025-01-21

60 Items: huecooklooktookhooknookrookwoodhoodgoodfootsootwooloozemoonsoonfoodmoodrooftoolcoolpoolloopzoomboomcutemutelutesuitnewtdunetunefeudstewviewfusedutyshookbrookcrookstoodproofscooptroopgroombloomgloomspoonswoonflutebrutefruitqueuebeautypurityfutileforsookmistookpartookundertook

UNIT 9 WORDS 2025-06-11

61 Items: actashairfoodhurtarealoselacksiteromeharmeventmounteventruinsvalueburieddamagebrokenheightlettertragicstatusunescopowderrecenttouristvolcanocausingdiggingdroughttsunamidestroynaturalseveralrecoverpompeiiancientresultsharmfuleruptiondisasteraffectedvesusiusdescribemoistureheritageartisticuncommonpreservedexplosionconditionhurricanesituation...

Plants 2025-07-28

59 Items: AirBigPeaSoilGrowFoodSizeStemHardStemHardBarkNeemPineRoseWeakMintRiceWallPlantGreenWaterSmallTreesHerbsBrownWoodyTrunklayerMangoGrassStickplantthingsOxygenFriendAroundShrubsStrongBanyanCottonFruitsSpicesBananaplantsCoconutSpinachSupportUprightSunlightClimbersCreepersBranchesGulmoharHibiscusCorianderGrapevineVegetablesBougainvillea

Te Reo 2025-09-16

31 Items: manreddogjadeworkfoodwalklovegifttalklandhillbooksongwomanwaterelderriverqueengreensacredislandguestsprayerSundaystomachmeetingtreasurechildrenmountainancient reptile

Thanksgiving 2025-11-25

61 Items: PieBoyDexIanFallFoodAndyAuntBabyGirlNickEsmeRhysLulaCleoTobyTayaKyleMyraAdamMiloZachLaneFaithUncleJaredMicahNadiaSonnyKatieTommyWyattEmilyAaronJalloKlumbFamilyLeavesTurkeyMassieHarlowEverlyKellenSwisseMuonioEunhyeFriendsRosalieGrandmaGrandpaCousinsBrielleRoxanneRebeccaKaitlynThankfulNovemberMadelineJonathanHendricksonThanksgiving

Sophia's Word Search 2026-01-23

60 Items: 670515GeodogSSOsun4.dskiponymoonwallsnapfoodmilkBertahorsebunny90.cmluckyAppleteddyCandyPintoDanceInstawatercloudSophiaCloudyrabbitsummerwinnerWalnutCookiebrokenIslandSchoolwintercheeseburgerAllstarunicornlasangeglitterdressageSunnyboyCharlottePixeldicefireangelRoyalstarBubblegumsnapghostStarStableGoldenviewHollyshineshowjumpingAngelwinner...

Spanish 2026-03-18

29 Items: hameggsbreadtoastbaconlunchsaladapplepizzawaterdrinknevercerealbananayogurtcookieorangecheesecoffeeto eatalwayssausageto drinkto sharebreakfastfor lunchhamburgerfood,mealstrawberries

Biology 2026-04-09

60 Items: GeneCellCodonNichechainAlleleFossilBioticEnzymeMeiosisMitosisEcologyAbioticHabitatNucleusOsmosisVacuoleGenotypeDominantMutationProducerConsumerOmnivoreRibosomeLysosomeEukaryotePhenotypeRecessiveAnticodonEvolutionEcosystemCommunityHerbivoreCarnivoreSymbiosisMutualismOrganelleCytoplasmDiffusionSubstrateChromosomeHomozygousInterphaseAdaptation...

Woche 12 Vokabeln 2026-05-01

28 Items: cupsaltbowlforkwallplateglassknifesugarnapkinpeppersaucerto_cuttrafficteaspoonto_greetto_thankto_changerealistictablespoonmeal(food)to_achievewhat_a_feastto_look/appearto_pass(class)help_yourselvescold_cut_platterto_put/place(lay)

Family Word Search 2023-05-02

55 Items: EndfunroarFairRoomsofamerrymusicTruckohanahouseshoutposseBrushcheerNightfamilycamdencreatebrightsummerbrunchflowerartistgardenmelodyhooplamarketpuzzleexplorepicassovibrantjubileebreweryfriendsdynamicbouquetpicturerainbowhangoutholidaydiscovercolorfullaughterfestivalsunshineelectrichamburgerentertaincongregateinstrumentcelebrationmagnificent...

Likes and Dislikes 2024-05-07

51 Items: teadayTeagamecatsdogsfoodfishsodadanceCreamjeansonionsleepwateranimalapplesbananacoffeefamilyflowersalamitiktoktomatoyellowchickenclothesorangessausageyoutubebirthdaycomputerlemonadeto musicpinapplesneakersbreakfastchocolatehamburgerchocolatemotorbikespaghettiactivitiesvegetablesvideogamesTelevisionwatermelonfoodtropolisto the beachstrawberries...

George Michael Bischoff Reunion 2024-07-11

62 Items: dnafunpieauntcakeemmafoodlonglylemaryetheljacobniecesarahstarkthornuncledirofffamilyfathergeorgelaughslestermothernephewpicnictraveltrilbyyvonnebrotherchickencookiescousinsdresseleleanorfarmerslavernemichaelreunionstoriesballoonsbaseballbischoffcarolinechildrencoleslawgertrudeicecreamlemonademargaretmemorieselizabethfrederickkoppelmanmeatballs...

5th Grade Word Search C-I 2024-11-18

59 Items: debtchaincinemaclergygurgleiciclecardiaccommutecorrodedeflatedwindleforeignepisodefreedomgeneticglaciergrouchygraphicimmensecalendarceremonycreativecriticalcurrencydeliveryfancifulfemininegemstonegorgeousgraffitiguidanceimpropercalculatecarnationcavernouscolumnistcomplaintconfirmedcuriositydeformitydemocracyenjoyablehappinesshoneycombidentical...

Alvin's Birthday 2025-09-18

43 Items: DadFunSonHugsLove1935CakeFoodUncleAlvinMontoVirgoQuietMontoCaringCheersFamilyGangerWishesDrinksFriendGrandadHusbandTolmiesCricketBrotherChildrenMemoriesDairyfarmResilientCelebrateSeptemberMulgildieHardworkerCake cuttingNine DecadesQueenslanderFather In-LawGreat Grandad90th BirthdayHome and AwayBrother In-LawAged to Perfection

Word Search 2025-12-18

61 Items: JENFOODSKOLALEXEMMAERICJACKMIKENEILPETESEANSUKUPCLUBSPLAZACHEFSDELTAAARONAMBERTONYNTONYRSCOTTTRACIEVENTSMYSTICSUITESFAMILYCANDISCHRISGCHRISJCONNORJORDANJUSTINKELLEYMORGANNICOLESHERRITRAVISARAMARKSUCCESSALCOHOLKITCHENPOLARISVIKINGSCANDICEFRANKIEKIRSTENCATERINGTEAMWORKHARDWORKFERNANDOLITTLESIXMISSESOTAROCKSTARSEMPLOYEESMEDTRONICWAREHOUSEFIELDGOAL...

Come on Everyone 1 2026-03-12

60 Items: MapNowNewBuyMixThisThatNameDoorCardGameManyMoveFarmKiwiCornBeanShopFoodMakePickLookGuessMouseStoryStartFruitApplePeachMelonOnionSchoolCircleFriendFinishSisterFarmerOrangeBananaCherryGrapesCarrotPotatoPotatoGarlicPepperMarketFriendBrotherPumpkinComputerBackpackCucumberMushroomBroccoliClassroomVegetableWhiteboardWatermelonStrawberry

Christmas Holiday 2026-03-26

63 Items: HamfoodBabyNoelmerryjollyhollyelvesCocoaCiderwinterlightswreathtinselribbonbaublestnicksleighadventmangerEggnogTurkeySeasonfestiveholidaygarlandiciclessnowmanchimneyWisemenCookiesNavidadyuletidegoodwillgreeneryblizzardreindeercarolingsleddingwrappingpresentsnativityStuffingtraditionmistletoeevergreenornamentsstockingsnorthpoleBethlehemShepherds...

hardest 2026-04-26

63 Items: gomeascatdogyoucanillnewwinhatdadmomsonsunantgodbabyevilmeankidalovelilybankkisspoolhardyourfindcantmademakewesteastfoodfishlowaneckladystarohiocasenoontwinsfunnyfunnynorthsouthmexiotexasrabbitturdlecanadapurpleobjecthawaiisundaygeorgialettersfloridacaroinaladybugsaterday

LAMC  2021-12-02

60 Items: analabinrcbcstinedeshpurBROomarlouderic4950foodnamekrmsnuidandyjillcokeabby470049001515leahcrazymaloumrs.vbloodstoolurinekabirdannycarlolunchnumberbruisedoctorcernerbribribonnieadrionarashmyypatientcheckinkatrinachickenonstagethemafiacarolinacoconutslilabethcopaymentwheelchairyolandlandanabannanarelakasunnyappointmentsemenanalysishealthconnect

School word search challenge 2023-03-07

55 Items: elaartfunmathhuntfoodbelllabswordsfactswellsmoneychinaegyptindiaaddingmillersewingstitchskillsartistgreecesoccerhealthalgebrareadingwritingcookingdrawingprojectfanslersciencedissectobservehermanndividingpaintingmennellaexercisefootballfractionsparagraphgym-classkick-ballping-pongmorphologyhutchinsonvolleyballbasketballsubtractingmultiplying...

Reading and Writing Fun 1 2024-06-18

62 Items: butandzootoosomejumpdeerwildsofamenulazygainfoodreachfirstthirdvisitlionsquitecandyheartcountluckyavoidpolitedinnerpersonsecondsimpleothersclientcameracommonoffershealthgroupsmannersfinallyanimalsmonkeysweightsjogginginsteadhowevermeaningrememberenjoyingexercisebirthdaycultureselephantssometimesnutritionbuildingstelephonesomethingamericans...

5th Grade Word Search C-I 2024-11-18

59 Items: debtchaincinemaclergygurgleiciclecardiaccommutecorrodedeflatedwindleforeignepisodefreedomgeneticglaciergrouchygraphicimmensecalendarceremonycreativecriticalcurrencydeliveryfancifulfemininegemstonegorgeousgraffitiguidanceimpropercalculatecarnationcavernouscolumnistcomplaintconfirmedcuriositydeformitydemocracyenjoyablehappinesshoneycombidentical...

Ultimate Word Search 2026-04-14

60 Items: ManAirGlueHeroMoonNovaSizeStarEggsHookRackFoodWellWaspCookGameModelSonicDonutHoneyThemaInnerGiftsPepsiVenomBloodPartyTeethClothMarketScriptBagelsWinnerDinnerSchemaTruismRecordFrozenGarlicHorrorGothicCoffinKnightHeroineHighwayNaturalMuffinsThinnerExtremaSpinnerPencilsHotdogsCookiesLaundryFlowersEncantoAladdinHawkeyeCupcakesStructure

persephone vocab 2026-04-15

25 Items: godhasfoodyearpartleadsgrowscomesspringwintergoddessflowerskingdomchariotfinallydaughterthereforeto returnflourishesearth, landweeps, criesstays, remainspretty, beautifulseeks, searches forunderworld (land of the dead)

The Pollinator Garden 2026-05-25

60 Items: batsbeesdilleggspupapondfoodsunnyherbsmothshostswaterrockstreeswingswaspsfruitgardennativeyarrowcosmosnectarfennelasterspollenbushesplantslarvaeparsleysheltermonarchzinniasorganicpuddlesinsectsverbenahabitatviceroydaisiesattractwillowsmilkweedwildlifemineralsironweedlavenderantennaecoreopsisgoldenrodmigrationecosystemconeflowerbutterflies...

Revision 2026-06-19

64 Items: godoflycarlampdeskroofplaybookgluefoodmenusailridebikeHousepadelchairrulerlunchfruitsnackdrivelorryplanegardenstairswindowboxingtennishockeylaptoppencilschoolbinderdinnerkitchenbedroomkitchenfishingcampingdancingbathroomfootballhandballswimmingpingpongbackpackscissorstaekwandobadmintonbreakfastmotorbikesubmarinelivingroomdiningroombasketball...