food Word Searches

A+ Unit 10 2025-06-05

22 Items: – Hard to do.– To get something.– To cook in hot oil.– To move to a new place.– To solve or beat a problem.– A person who works in the army.– A food item used to make a dish.– People believe or say something.– Something that happens every day.– When there is not enough of something.– Cooked slowly in a little bit of liquid....

Cells 2025-08-01

23 Items: Makes ribosomesThe powerhouse of the cellThe control center of the cellOrganism that makes its own foodGuides proteins to the Golgi BodyUsing the sun's energy to make foodOrganism that cannot make its own foodControls what goes in and out of nucleusDiffusion of water across cell membranesWhere photosynthesis takes place, is green...

Life Experiences 2025-11-28

25 Items: Making food to eatWalking in nature for funMoving your body in waterSleeping in a tent outdoorsGetting new knowledge or skillsHaving fun with toys or friendsEating food outside on a blanketA trip from one place to anotherDoing something kind for someoneSomething exciting you do or exploreSomething you remember from the past...

Study Guide 2024-10-24

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Word Search science stuff 2024-10-28

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sunthe two-part naming system for naming organismsgrouping things together based on similar characteristics...

U2P2-Classification 2024-10-28

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Vocabulary Unit 3 - Check-in 2025-05-21

10 Items: Animals have ... to stay warm.Salad is, in ... to fast food, healthy,The experiment below has to do with ...D'Artagnan is one of the famous three ...Nothe Korea is not a ... because people aren't free there.Some zoos make it possible to ... animals. You can even give them names then....

Classifying Organisms word search. 2023-10-20

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Study Guide 2024-10-22

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Ecosystems Vocabulary 2024-12-10

11 Items: A living thing in an ecosystemA non-living part of the ecosystemAn organism that ONLY consumes meatAn organism that ONLY consumes plantsAn organism that makes their own foodThe movement of energy in an ecosystemThe process plants use to make their foodAn organism that breaks down dead materialAn organism that consumes both plants and animals...

Unicellular Word Search 2023-11-04

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Asaan's Word Search 2024-10-22

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sunthe two-part naming system for naming organismsgrouping things together based on similar characteristics...

Study Guide 2024-10-29

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Classifying Organisms 2023-11-03

11 Items: - cells have a nucleus- made up of many cells- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

7.5 Word Search 2025-04-03

10 Items: Real or genuine; not fake.Extremely tiring and difficult.The process of becoming larger or wider.Lasting forever or for a very long time.To admit or accept that something is true.A symbol or sign that represents something.Shining brightly; full of happiness or energy.The process by which plants use sunlight to make food....

Unicellular Word Search 2023-10-23

11 Items: made up of one cellcells have a nucleusmade up of many cellscells do NOT have a nucleusmust eat other organisms for foodthe scientific study of classificationcan make its own food using energy from the sungrouping things together based on similar characteristicsnomenclature the two-part naming system for naming organisms...

Science Vocabulary Review! ㋡(Ariah Dominguez) 2024-10-23

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

TASK 1 Anwar is an athlete help him to find some food which he needs: 2025-05-05

5 Items: A lives in water helps muscles growMeat of a farm animal that gives eggEveryone drinks it when they are thirstyA food that comes from hen and is shaped like an ovalThe food that makes muscles strong and comes from cows

Organs so scary yet so cool! 2024-07-19

11 Items: Organ storing urine before it is excreted from the body.Digestive organ where food is broken down and mixed with digestive enzymes.Pair of organs involved in respiration, exchanging oxygen and carbon dioxide.Long, coiled organs where nutrients and water are absorbed from digested food....

unit 2 Vocabulary healthy Food 2020-06-09

7 Items: inseasonpackaginghighinsalthighinfiberhighinsugarlocalproduceprocessedfood

Marleu 2025-09-15

5 Items: Marley's dogMarley's celeb crushMarley's favorite sauceMarley's favorite musicianMarley's favorite food franchise

Japanese / IWL Class 2024-03-11

8 Items: 車 (car)太陽 (sun)月 (moon)家 (house)食べ物 (food)友人 (friend)コークス (Coke)ペプシ (Pepsi)

First Overseas Holiday 2025-09-25

10 Items: Livs JacketLivs InjuriesPlane ActivityFood of ChoiceDrink of ChoiceDoctor AppointmentActual Holiday ActivityHoliday Intended ActivityFirst Overseas City TogetherFirst Activity Holiday Destination

Omnivore's Dilemma- Part 2- "The Industrial Organic Food Chain" 2026-02-04

25 Items: EPAKahnAlarWeedsKraftFarmerFruitsHippieOrganicCommuneKelloggAtrazineLycopenePesticideCascadianSyntheticIndustrialVegetablesFertilizerStonyfieldMonocultureCooperativePolyphenolsResveratrolAgribusiness

Who Am I??? 2024-09-30

7 Items: My star signMy hair colorWhere I'm fromA hobby of mineMy favorite foodMy favorite colorMy favorite animal

Confectionary word search 2024-03-08

16 Items: – mashed fruit made into a paste (tyrė)– a protein common in wheat flour (glitimas)– thick mixture used to bake pastries (tešla)– product used to add carbon dioxide in dough (mielės)– mixing device for large quantities of food (plakiklis)– primary appliance used to bake food (vyrykle, krosnis)– tool used to slice food into smaller pieces (trintuvė)...

Food and Drinks 2023-07-23

4 Items: friescoffeecheeseburgerorange-juice

Why are trees important? 2026-03-01

10 Items: A big area of water.Where cars drive fast.An open area with lots of grass.The place you go to get on a plane.Animals live here. Food is grown here.Smoke goes out of the house through it.Jam When cars move very slowly or stop.A hard object that comes from the earth.Small body of water that moves like a river....

World Cultures Vocabulary 2024-11-11

13 Items: A variety of on EarthAll the plants or plant life of a placeThe action of clearing a wide area of treesThe process of replanting an area with treesThe process of water movement through a plantA dense forest rich in biodiversity and heavy rainfallA series of flat areas made on a slope, used for farming...

Airport vocab 2025-04-02

15 Items: el vueloel aviónel pilotoAeropuertoel capitánel maletínla mochilala balanzaLas tiendasLa aerolíneael pasaportela carretillaclass la primera claseLa oficina de migracióncourt el patio de comidas

HEALTHY AND UNHEALTHY HABITS.- GREEN for healthy habits and RED for unhealthy habits 2024-06-02

16 Items: PRAYVAPINGSMOKE WEEDDRINK WATERNOT SLEEPINGPROCASTINATEOVERTHINKINGWALK YOUR DOGEAT JUNK FOODSLEEP ALL DAYEXERCISE DAILYBRUSH YOUR TEETHWATCH TV ALL DAYWEARING SUNSCREENEAT BALANCED MEALSPLAY VIDEOGAMES ALL DAY

Liveinadoghouse Word Search 2024-04-09

18 Items: - Eat meat - Jeść mięso- Drink milk - Pić mleko- Like cats - Lubić koty- Bite bones - Gryźć kości- Chase mice - Gonić myszy- Eat carrots - Jeść marchewki- Have a collar - Nosić obrożę- Eat dog food - Jeść psią karmę- Walk on leash - Chodzić na smyczy- Play with a ball - Bawić się piłką- Live in a cage - Mieszkać w klatce...

Food and Drink 2024-09-03

4 Items: PizzaBurgerCoffeeMeatball

Turkey Word Search 2025-06-22

12 Items: A big meal with lots of foodA warm sauce poured over foodFeeling happy for what you haveThe people you love and live withWhere everyone sits to eat togetherA soft, yellow bread made with cornWhen fruits and vegetables are pickedA big bird often eaten on ThanksgivingA sweet dessert, often pumpkin or appleBread and herbs cooked inside the turkey...

Peranakan culture food and games 2025-02-22

7 Items: AcarlaksabalikcurryGasingChekiriCongkak

Food for Thought - Chapter 5 2016-04-16

7 Items: surfseedtrialgardenforgivefarmhousepesticide

English Food and Drink Words Derived from Arabic 2025-05-01

15 Items: LimeLemonMochaCarafeCarwayCoffeeHummusAlcoholApricotSaffronSpinachAlbacoreCouscousArtichokeAubergine

Posties BR 0513 2024-04-29

6 Items: things that are discarded in a bindecaying material used as fertiliserwhere most food waste goes when not reusedstudents go to ___ Farm in Yuen Long to make fertilisera food that was used to dye fabric at the Tung Tak School eventthe word to describe the fruits that were discarded for looking unappealing

favorites food meal,snack and drink tanpa kunci jawaban 2025-09-09

18 Items: TeaRicesateCakeMilkSodaBreadDonutcreamCandyWaterJuiceCoffeeNoodlesBiscuitrica-ricaFriedriceChocolate

Clue #3 2025-09-27

10 Items: My majorfavorite flowerFavorite HolidayMy favorite CandyMy favorite DrinkMy favorite Animalbeach vs mountainsMorning or night owlFavorite food on campusSport I did in highschool

Cooking Terms Word Search 2022-11-03

36 Items: To cook under direct heat or over coals.To cook slowly and for a long time in liquidTo cook over steam rising from boiling water.To combine thoroughly two or more ingredients.To cook in hot fat that completely covers the food.To cook by dry heat, uncovered, usually in the oven.To cook uncovered in a small amount of fat in a pan....

Remita 2020-03-07

60 Items: buscarruneattrykeycitytownhalffindlookkeepknowlikefoodfairyenjoysleepdrinkbuiltsharesolvepapertulipdaisypoppylaterneverFrenchGermantoiletchangesearchfriendschoolgardenbuttonwhitchwizardalwaysEnglishFinnishSwedishLatviankingdomcountryquartercourageexplainhospitalaccidentdaffodilfootballknowledgenewspaperdodgeballsometimesvolleyballbasketball...

Nurture 2023-09-05

60 Items: fuelfoodfatsrestgoalsfocusbuddygreetenrolhappywatersleeptiredcramptrustskillssafetyhazardenergyvaluesgrowthnurturewelcomenervousexcitedanxiousfeelingprotectproteinthirstyweatherbeliefsrespecthonestyteachingpositivefeedbackpreparedexerciseattitudesecuritypatiencecharacterstrengthsbehaviourhydrationnutritioncommunitystrategiesexperienceonboarding...

Love Word Search 2024-10-25

60 Items: SolPazLuzSunSkyAmiVieLoveAmorAguaFoodBookWorkLifeHausHundZeitBuchCielPerroAmigoHouseFelizCieloLibroSaludWaterMusicHappyPeaceLightLiebeEssenChienMusikÉcoleStadtLebenLichtTempsVilleSantéComidaSchoolTiempoCiudadFamilyHealthSchuleFreundMaisonWasserArbeitSoleilFamiliaFriedenFamilleMusiqueHeureuxTravail

1-1 Word Search 1 2024-11-18

63 Items: Iitanmemysunthewayshetoosetsayareflyendallhowwhylowsatfastfastbookfoodfeetwishlookreadgoodhandheretooknameleftgrowtoldmallballsamemovegametheydeepdeeprestwidegreatentercovermightstickblackbelowworlduntilriveracrosswheelsinsidealwayswheelsfeelingimportant

VIAJAR 2025-04-07

26 Items: searoomfoodhiketripsbeachto buyflightwaiterislandforestto seebellboyluggageto walkstreetsto campsceneryto traveairplaneto carryto bringbrochuresto arriveto returnplane ticket

Latin III - Week 2:16 Review 2025-05-01

30 Items: sindaybabylampyearrainholyfoodwinedevilnighttodayangrygrassgrainwaterhappygardenpalacedinnergreedyeveningmorningtomorrowpowerfulforeignermeanwhilethereforeyesterdayinner-organs

Alberta Word Search 2025-07-09

64 Items: DJMOHMOHbeercakefoodgoldhugsloveRSVPveilvowswinealterbridecardscigardressfavorgroomringsusherbuffetbustlefamilyguestskissesAlbertabestmanbouquetcandlesdancingflowersforeverfriendsfriendsforeverpromiseceremonycocktaillovinglymarriagepicturesregistrysoulmatechampagnegroomsmenguestbookhoneymoonrehearsalreceptionbridesmaidengagementgreenhouseFirstDance...

Year 6 2025-08-21

60 Items: BagBedRunCryEatSadBigHotFarmCityShopBookDoorBallJumpPlaySingWalkTalkWakeColdFoodWorkWaterRiverChairTableDanceSmileLaughDrinkSleepHappySmallHouseGamesStoryForestPencilWindowListenSchoolFamilyFriendGardenTravelMarketHealthNatureVillageKitchenTeacherAnimalsClothesWeatherCountryHolidayMountainBathroomTransport

Week 19: Diphthongs - au, aw, oo 2025-08-24

60 Items: pawsawjawrawdrawclawflawhaulsoupmoonfoodpoolcoolrooftoolbootroothookcookfoottookwoodgoodwoolstrawvaultspoondroolshootbroomsnoopshookstoodwhoopfloodlaunchautumnauthorsaucerbabooncocoonlagoonbroochlaundrycautionawesomeexhaustraccooncartoontyphoonbookletlookoutdaughteroverlookloopholecookbookawkwardlyafternoonmoonlightoutpouring

Basic Vocabulary in Spanish 2025-09-26

27 Items: – my– is– pet– day– Mrs– name– date– food– year– hello– today– sport– fruit– color– class– month– number– school– friend– student– Spanish– birthday– (male) teacher– (female) teacher– last name / surname– (male) teacher / professor– (female) teacher / professor

Freestyle Word Search 2025-12-05

61 Items: JogFakeShotDietFoodDualShelfAnkleMusicHoneyBigboySingleSprawlStanceSitoutCradleWarmupSprintWeightEscapeTimingMovingBananaWhizzerStandupLazymanTreetopStretchPositionFootworkScrambleCooldownPracticeTakedownReversalPhysicalSkyhawksStrengthLiquidivFreestyleDoublelegWrestlingDuckunderHeadthrowFolkstyleDownblockMentalityCommittedPrecisionTechnique...

JESSE & MORGAN 2025-08-05

18 Items: What is Jesse eye colour?what their favorite food?what was their first date?What is Morgans eye colour?What is Jesses middle name?What is Morgans middle name?What month did Jesse propose?What is their favorite holiday?What is Morgans favorite hobby?what is their favorite junk food?Where did Jesse propose to Morgan?How many siblings does Jesse have?...

Cooking Terms Word Search 2024-11-13

36 Items: To cook under direct heat or over coals.To cook slowly and for a long time in liquidTo cook over steam rising from boiling water.To combine thoroughly two or more ingredients.To cook in hot fat that completely covers the food.To cook by dry heat, uncovered, usually in the oven.To cook uncovered in a small amount of fat in a pan....

Mission: DC 2023-08-11

9 Items: readingsecret agentsthey have wingsa breakfast foodanimals live hereyou need popcorn!something you saysomething you learn in schoolsomething you can't tell anyone

Food Safety Word Search 2026-02-10

5 Items: washcooksanitizebacteriaseparate

gilmore girls 2021-02-04

61 Items: acemialukerorydeanjessfinnlanekirksukigigijeepsnowyalerichdavyfoodgirlsemilyloganparisdineraprildoyledavidbopitcollintaylormichellouisediggersherrimarthacoffeegilmorelorelairichardbabettemrs.kimjacksonchiltontristanchineseburgersms.pattymadelinepaulankamr.medinatakoutfoodcornstarchsodashoppechristopherstarshollowmovienightslifeordeathhuntsburger...

Sip and Seek 2022-11-11

60 Items: tieliamvowsveilkerrlovefoodwifebridegroomringssongsdancedressgiftsgamesaislecardsshotscorfudubaisuitspartytoastnakitafavourfamilypetalsspeechinvitegardenweddingjesmondfriendsbouquetstylistcandlesfoliagealcoholcupcakehusbandceremonyconfettimaldivesbraceletreceptiongroomsmenjewellerynewcastlehendersonregistrarcufflinkshoneymoonwitnessescelebrate...

Vocab Man 2024-03-06

28 Items: hamteaeggsmilkbreadtoastbaconlunchsaladapplepizzawatercerealbananayogurtcookieorangecheesecoffeeto eatsausagelemonadeto drinkfor lunchhamburgerfood, mealfruit saladstrawberries

3B 2024-05-10

27 Items: badallmeatpeasricefatsmanysteakoniondinnergrapesgrainsbutterto walkbecausepotatoestomatoespastrieseverydayspaghettiice creambeveragessomethingI´m hungryI´m thirstyto exercisechicken (food)

Everything (semuanya) 2024-07-26

62 Items: eggfoodricebobamilksoapeyesbodyrashmangobreadgermsnursefevercoughdizzylunchjuliedurianfruitscerealdoctorbananatomatoorangecarrotdinnerhealthynoodlesspinachchickenlegpainrunningwalkingsurfingcyclingreadingbacteriamosquitohospitalheadacheshouldervomitingexerciseswimmingskippingfootballbadmintonbreakfaststephaniemangosteenvegetablescleanwater...

RGR Unit 18 Word Hunt: "/oo/" 2025-01-21

60 Items: huecooklooktookhooknookrookwoodhoodgoodfootsootwooloozemoonsoonfoodmoodrooftoolcoolpoolloopzoomboomcutemutelutesuitnewtdunetunefeudstewviewfusedutyshookbrookcrookstoodproofscooptroopgroombloomgloomspoonswoonflutebrutefruitqueuebeautypurityfutileforsookmistookpartookundertook

UNIT 9 WORDS 2025-06-11

61 Items: actashairfoodhurtarealoselacksiteromeharmeventmounteventruinsvalueburieddamagebrokenheightlettertragicstatusunescopowderrecenttouristvolcanocausingdiggingdroughttsunamidestroynaturalseveralrecoverpompeiiancientresultsharmfuleruptiondisasteraffectedvesusiusdescribemoistureheritageartisticuncommonpreservedexplosionconditionhurricanesituation...

Plants 2025-07-28

59 Items: AirBigPeaSoilGrowFoodSizeStemHardStemHardBarkNeemPineRoseWeakMintRiceWallPlantGreenWaterSmallTreesHerbsBrownWoodyTrunklayerMangoGrassStickplantthingsOxygenFriendAroundShrubsStrongBanyanCottonFruitsSpicesBananaplantsCoconutSpinachSupportUprightSunlightClimbersCreepersBranchesGulmoharHibiscusCorianderGrapevineVegetablesBougainvillea

Te Reo 2025-09-16

31 Items: manreddogjadeworkfoodwalklovegifttalklandhillbooksongwomanwaterelderriverqueengreensacredislandguestsprayerSundaystomachmeetingtreasurechildrenmountainancient reptile

Thanksgiving 2025-11-25

61 Items: PieBoyDexIanFallFoodAndyAuntBabyGirlNickEsmeRhysLulaCleoTobyTayaKyleMyraAdamMiloZachLaneFaithUncleJaredMicahNadiaSonnyKatieTommyWyattEmilyAaronJalloKlumbFamilyLeavesTurkeyMassieHarlowEverlyKellenSwisseMuonioEunhyeFriendsRosalieGrandmaGrandpaCousinsBrielleRoxanneRebeccaKaitlynThankfulNovemberMadelineJonathanHendricksonThanksgiving

Sophia's Word Search 2026-01-23

60 Items: 670515GeodogSSOsun4.dskiponymoonwallsnapfoodmilkBertahorsebunny90.cmluckyAppleteddyCandyPintoDanceInstawatercloudSophiaCloudyrabbitsummerwinnerWalnutCookiebrokenIslandSchoolwintercheeseburgerAllstarunicornlasangeglitterdressageSunnyboyCharlottePixeldicefireangelRoyalstarBubblegumsnapghostStarStableGoldenviewHollyshineshowjumpingAngelwinner...

On the Move! Animal Migration 2024-11-06

10 Items: To go from one place to anotherTo stay alive, even in hard conditionsA very large number of things or animalsWhat animals and people eat to stay aliveAnimals with feathers and wings that can flyA word to describe when temperatures are higherLiving creatures, like birds, fish, and mammalsSmall creatures with six legs, like ants and butterflies...

Purim 2025-03-02

10 Items: happiness brakes all___the hero of the story (a women)a yummy food that we eat on Purimwe wear___ and conceal our selvesa mean lady that was like her husbandwe read this twice, by day and by nightwe use this when a certain name is readwe give to two people enough for a mealwe increase in this in the month of Adar...

LAMC  2021-12-02

61 Items: analabinrcbcstinedeshpurBROomarlouderic4950foodnamekrmsnuidandyjillcokeabby470049001515leahcrazymaloumrs.vbloodstoolurinekabirdannycarlolunchnumberbruisedoctorcernerbribribonnieadrionarashmyypatientcheckinkatrinachickenonstagethemafiacarolinacoconutslilabethoffstagecopaymentwheelchairyolandlandrelakasunnyappointmentdateofbirthsemenanalysis...

Ms. Gates' Christmas Elves 2024-12-13

59 Items: kodylukepolepolefoodtreeavoryelvineavenmariasiyerkylieelvesgoochhayesbellscandymerryvixencometcupidkayleeaudreyjaydenamyrahkaidenkhilynlondonjohnnycarlosvaughnclausefamilyfultonjinglesleighdasherdonnerkennedyryleighdeshawnlashauncambriabrandonvincentjacksoneverettrudolphprancerblitzenmiryellejessianabrittanypresentsreindeergorenflochristmas...

Mason Mish's word search 2025-03-24

30 Items: runbikewalkcookcampchatreadbakeknitfoodlearndancesharewriteskatebeachgardendesignnatureeventsguitarmoviestravelcollectculturepictureexercise4wheelerssocialmediaphotography

Bestie Word Search 2025-07-08

60 Items: bruhvlogloudfoodscfeheropizzacandyoreosmovieemojiBiblefunnysassybeachreelsgoofymagicGETOUbestiescrolltargetsunsetsummertravelflighthonestdancerdisneybarbierobloxsmoresfriendssparklenetflixmascaraexplorecampingvillaincostumepresentcookiesmemoriesicecreamshoppingroadtripprincessbloxburgbirthdayballoonsskifflessstarbucksChristmasinstagramspongebob...

John C. Kish 2025-08-16

46 Items: BriArtNicoClubClubPrepFoodZoneJamesMusicAnimeBucksDanceJokesSteamTripsMcCawSnackCaresBeadsSharonBattleFamilyComedySportsSportsTaylorSewellMorrowLegacyCenterMentorBrandiiOrigamiFriendsRugballKaraokeViktoriaKamariahKeystoneLaughterDodgeballPinecrestBraceletsTechnologyand Minnows

A Kilkenny Christmas 2025-12-17

60 Items: hamfunfoodgivenoresnowcoldtreemassholywhamsantamusicirishgiftsvisitgamesjesusqueenelvisparadestallsdrinkscraftslightsbuyingwarmthfamilygatherwinterbaubletreatsbakingturkeydinnermovieschurchsellingdancingfriendsmarketscookingsingingsinatramagicaltwinklekilkennyyulefestreindeerdecemberwrappingnativitycoldplaychristmaschocolatecathedralfireworks...

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

LAMC  2021-12-02

60 Items: analabinrcbcstinedeshpurBROomarlouderic4950foodnamekrmsnuidandyjillcokeabby470049001515leahcrazymaloumrs.vbloodstoolurinekabirdannycarlolunchnumberbruisedoctorcernerbribribonnieadrionarashmyypatientcheckinkatrinachickenonstagethemafiacarolinacoconutslilabethcopaymentwheelchairyolandlandanabannanarelakasunnyappointmentsemenanalysishealthconnect

School word search challenge 2023-03-07

55 Items: elaartfunmathhuntfoodbelllabswordsfactswellsmoneychinaegyptindiaaddingmillersewingstitchskillsartistgreecesoccerhealthalgebrareadingwritingcookingdrawingprojectfanslersciencedissectobservehermanndividingpaintingmennellaexercisefootballfractionsparagraphgym-classkick-ballping-pongmorphologyhutchinsonvolleyballbasketballsubtractingmultiplying...

Reading and Writing Fun 1 2024-06-18

62 Items: butandzootoosomejumpdeerwildsofamenulazygainfoodreachfirstthirdvisitlionsquitecandyheartcountluckyavoidpolitedinnerpersonsecondsimpleothersclientcameracommonoffershealthgroupsmannersfinallyanimalsmonkeysweightsjogginginsteadhowevermeaningrememberenjoyingexercisebirthdaycultureselephantssometimesnutritionbuildingstelephonesomethingamericans...

5th Grade Word Search C-I 2024-11-18

59 Items: debtchaincinemaclergygurgleiciclecardiaccommutecorrodedeflatedwindleforeignepisodefreedomgeneticglaciergrouchygraphicimmensecalendarceremonycreativecriticalcurrencydeliveryfancifulfemininegemstonegorgeousgraffitiguidanceimpropercalculatecarnationcavernouscolumnistcomplaintconfirmedcuriositydeformitydemocracyenjoyablehappinesshoneycombidentical...

Family Word Search 2023-05-02

55 Items: EndfunroarFairRoomsofamerrymusicTruckohanahouseshoutposseBrushcheerNightfamilycamdencreatebrightsummerbrunchflowerartistgardenmelodyhooplamarketpuzzleexplorepicassovibrantjubileebreweryfriendsdynamicbouquetpicturerainbowhangoutholidaydiscovercolorfullaughterfestivalsunshineelectrichamburgerentertaincongregateinstrumentcelebrationmagnificent...

Likes and Dislikes 2024-05-07

51 Items: teadayTeagamecatsdogsfoodfishsodadanceCreamjeansonionsleepwateranimalapplesbananacoffeefamilyflowersalamitiktoktomatoyellowchickenclothesorangessausageyoutubebirthdaycomputerlemonadeto musicpinapplesneakersbreakfastchocolatehamburgerchocolatemotorbikespaghettiactivitiesvegetablesvideogamesTelevisionwatermelonfoodtropolisto the beachstrawberries...

George Michael Bischoff Reunion 2024-07-11

62 Items: dnafunpieauntcakeemmafoodlonglylemaryetheljacobniecesarahstarkthornuncledirofffamilyfathergeorgelaughslestermothernephewpicnictraveltrilbyyvonnebrotherchickencookiescousinsdresseleleanorfarmerslavernemichaelreunionstoriesballoonsbaseballbischoffcarolinechildrencoleslawgertrudeicecreamlemonademargaretmemorieselizabethfrederickkoppelmanmeatballs...

5th Grade Word Search C-I 2024-11-18

59 Items: debtchaincinemaclergygurgleiciclecardiaccommutecorrodedeflatedwindleforeignepisodefreedomgeneticglaciergrouchygraphicimmensecalendarceremonycreativecriticalcurrencydeliveryfancifulfemininegemstonegorgeousgraffitiguidanceimpropercalculatecarnationcavernouscolumnistcomplaintconfirmedcuriositydeformitydemocracyenjoyablehappinesshoneycombidentical...

Alvin's Birthday 2025-09-18

43 Items: DadFunSonHugsLove1935CakeFoodUncleAlvinMontoVirgoQuietMontoCaringCheersFamilyGangerWishesDrinksFriendGrandadHusbandTolmiesCricketBrotherChildrenMemoriesDairyfarmResilientCelebrateSeptemberMulgildieHardworkerCake cuttingNine DecadesQueenslanderFather In-LawGreat Grandad90th BirthdayHome and AwayBrother In-LawAged to Perfection

Word Search 2025-12-18

61 Items: JENFOODSKOLALEXEMMAERICJACKMIKENEILPETESEANSUKUPCLUBSPLAZACHEFSDELTAAARONAMBERTONYNTONYRSCOTTTRACIEVENTSMYSTICSUITESFAMILYCANDISCHRISGCHRISJCONNORJORDANJUSTINKELLEYMORGANNICOLESHERRITRAVISARAMARKSUCCESSALCOHOLKITCHENPOLARISVIKINGSCANDICEFRANKIEKIRSTENCATERINGTEAMWORKHARDWORKFERNANDOLITTLESIXMISSESOTAROCKSTARSEMPLOYEESMEDTRONICWAREHOUSEFIELDGOAL...

Come on Everyone 1 2026-03-12

60 Items: MapNowNewBuyMixThisThatNameDoorCardGameManyMoveFarmKiwiCornBeanShopFoodMakePickLookGuessMouseStoryStartFruitApplePeachMelonOnionSchoolCircleFriendFinishSisterFarmerOrangeBananaCherryGrapesCarrotPotatoPotatoGarlicPepperMarketFriendBrotherPumpkinComputerBackpackCucumberMushroomBroccoliClassroomVegetableWhiteboardWatermelonStrawberry

Population Word Search 2025-01-17

13 Items: All of the food chains in an ecosystemOrganism that breaks down dead organic materialAn individual animal, plant, or single-celled life formMake their own food, which creates energy for them to growAn interacting group of various species in a common locationA non-living part of an ecosystem that shapes its environment...

Absent Work 2024-09-16

20 Items: / Final step in a CER/ Means afraid of water/ Smallest unit of life/ Powerhouse of the cell/ Building block of matter/ Variable that is measured/ Contains human genetic code/ Variable that is manipulated/ Proposed answer to a question/ Humans inhale this to survive/ Used to support a claim in a CER/ Process by which plants make food...

Seveth Year - Lesson 2 2024-12-06

15 Items: Genuine; true.A bird's feathers.Imaginary; not real.To eat up thoroughly.A choice item of food.Coming earlier in time.The killing of an animal for food.Wise in a clever or practical way.Moving in a clumsy or awkward way.Living by killing and eating other animals.Open to attack; easily injured physically or emotionally....

6th Grade Review 2025-05-05

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The number of teaspoons in a tablespoonThe amount the recipe makes (Ex. 16 cookies)Red, yellow and blue are these types of colors.One of the MyPlate food groups that includes cheeseOne of the MyPlate food groups that includes chickenOne of the MyPlate food groups that includes broccoli....

Holiday Types 2024-05-02

16 Items: SafariCruiseRoad tripFood tourCity breakStaycationEco-tourismBeach holidaySkiing holidayCultural holidayWellness retreatEducational tourAdventure holidayVolunteer vacationReligious pilgrimagehere are some common words used to describe different types of holidays:

unit 10 2024-01-22

12 Items: to endguiltyto groweasily brokento move lowerfood shortageeasily carrieda sincere requestcarful with moneyan animal in dangerruler with total powersomething to do with sight or seeing

Cooking Around the World 2025-11-30

15 Items: salty, sweet, sour are?I make food taste exciting!stirring ingredients together.the person who cooks the food.a hot place where burgers cook.a cheesy circle kids love to eat.long, squiggly strands you can slurp.tiny white grains found in many meals.warm and served in a bowl with a spoon.noodles’ Italian cousin in many shapes....

Vendors Word Search 2023-09-18

6 Items: a black substance that can be used for heating or cookinga sweet substance, often in the form of white or brown crystalsto cook food, especially meat, without liquid in an oven or over a firepeople who sell things, for example food or newspapers, usually outside on the street...

tle 2025-02-03

25 Items: use to drainuse to spreaduse to open canpartner of knifeuse to toast breadused to cut lettuce6,8,10 and 12 inchesthese are flat heateduse to scrape left over5 to 10 inches long knifeused to combine ingredientsused to hold food in placeused to slice foods more evenlymachines use to chill sandwichessmall ones are perfect for cutting...

Review 2024-10-21

11 Items: Made up of one cell.Made up of many cells.Cells that DO have a nucleus.Cells that DON'T have a nucleus.Must eat other organisms for food.The scientific study of classification.Can make its own food using energy from the sun.The two-part naming system for naming organisms.Grouping things together based on similar characteristics....

Soccer shaped word search about food and fibre 2025-05-19

14 Items: FatsMeatNutshempwoolJuteBulkDairyFruitfibreCerealCottonTextileAddictive

Guest 2025-05-14

8 Items: Sophies JobErnie's NicknameBens Favourite FoodHow Old Is Kobe TomorrowWhere Did We Get EngagedFirst Holiday DestinationSophie's Favourite CocktailArtificial Product Ben Sell's

Health for Food Handlers 2025-08-28

5 Items: within the 48 hours prior to starting work.especially when accompanied by a sore throat.on exposed skin that are actively discharging.(yellowing of the skin or eyes, suspected of being hepatitis A).the person may resume food-handling duties after 48 hours of being symptom-free).