fire emblem warriors Word Searches

Gathang Translation Exercise Word Search 2023-02-26

54 Items: NoManBoyLogDogByeYesOneTwoBigFishGirlBirdFireRockTreeFiveLandCrabWaveShowWhatThatWomanWaterRiverCanoeHelloBeachShellStormAuntyUncleWhereFlyingSisterMotherFatherLittleRunningWalkingJumpingDancingSittingSmilingDolphinBrotherKangarooMountainSleepingSwimmingStandingStingrayThank you

lanadelrey 2026-01-25

108 Items: firegoldhurtjulytaxiwildbirdsdrivegracehoneymusicparispillsradioshinestagestarsstormtexasyoungachingangelsdesirefrenchguitarheavennightsnovelspoetryprettysilversummervioletbalconycolognedancingfloridaforeverfreedomglamourlullabymustangoldbarsperfectplayingsadnesssingingspecialtroublevitaminweddingbackseatbackyardbluedarkbrooklyncashmerecruising...

Goblins & Magical Beings 2026-02-20

83 Items: OWLCUPHATMAPWANDHALLFIREDURODURISNAPEBROOMMAGICALLEYSPELLCHARMCURSEAURORCLOAKHEXIAPOTTERMALFOYDRAGONCASTLEPOTIONTURNERWILLOWFORESTWEASLEYGRANGERFELICISAZKABANHORCRUXSECRETSPHOENIXUNICORNANAPNEODEPULSOEPISKEYGLISSEOOPPUGNOTOTALUMREDUCIOREVELIOHOGWARTSMANDRAKEBASILISKDEMENTORMINISTRYPENSIEVEINIMICUMEVANESCOMOLLIARERELASHIOSLYTHERINRAVENCLAWQUIDDITCH...

Tent Word Search 2026-02-05

10 Items: - a path for walking in nature- resting in a tent or sleeping bag- a bag used to carry camping things- bright lights seen in the night sky- meals cooked or eaten while camping- plants, animals, and places outside- a tall plant with a trunk and leaves- a large body of water near campsites- a small fabric house used when camping...

SAGE Diversion 2016-04-20

110 Items: ArtMathLabsTextDeskSageLateBandFireNounVerbPoemsPaperLunchFieldTripsChairBenchTardystartDanceChoirdrillStudyFlashcardsclaimSimileSocialHealthSchoolBreaksSportsLockerBussesIdiomsGradesClaimsAdverbTestingReadingScienceWritingStoriesQuizzesHistoryStudiesPencilsGrammarFriendsLibraryCoachesJanitorFacultyCarpoolCounterLanguageMetaphorPrefixesSuffixes...

Colors 2023-04-16

111 Items: redskyjamashinkoilpinkroserubyfirerustcornlimepearmossmintbluenavytealgreyironleadcrowonyxsootgoldsnowboneblushcoralpeachbrickapplebloodamberhoneylemongreenoliveslatelapisdenimgrapelilacsmokeslateflintblackpitchravenbrownwhitepearlcreamivorylinensalmoncherrymerlotorangesquashbronzecarrotyellowcanarybutterbananaindigomarinepurplevioletpewtersilver...

Filmkarakterer 2025-04-12

9 Items: Professor med hat og piskPrinsesse, der bor på MotunuiEn elver, der er skarp med bue og pilEjeren af Oldstaven før Severus SnapeTroldmand, der dræber den sidste horcruxTroldmand, der er god til troldmandsskakDreng, der flyver til Ønskeøen med fire børnGammel Jedi, der giver Luke Skywalker sit første lyssværd...

Tv Shows 2025-06-08

12 Items: Netflix Dating ShowThe host of Survivora show that Sam would winwhat represents your lifeA show that Amber would loseGreat first season in Harlemthe man who suffered on 90 dayfind it and use it to stay safeThe first TV show we watched in DROur favorite character from BlacklistA show that we want to go on together...

Hephaestus 2025-12-04

19 Items: Roman name for HephaestusIsland where Hephaestus lands in one versionRepresents his work as a smith and craftsman.Early king of Athens, part human and part serpentGreek god of fire, metalworking, and craftsmanshipSon of Hephaestus; said to have invented the flute.Tool of the forge; a key symbol of Hephaestus’s skill....

trs23 ver3 u13 2023-05-31

10 Items: Lions can run ___.Look ___ the window.A shape with no corners.Something not from Earth.A car has 4. A bike has 2.Cars, trains, buses, planes etc.A kind of small animal with a long tail.It is white or grey and it is made by fire.It has wheels but it doesn't drive on the road.How you feel if someone says "Boo!" behind you.

Language Features 2025-09-11

16 Items: He's a good mate.The world is a stageDo this worksheet now.The Dr ordered an MRI.He's as brave as a lionMrs Raggsen ran rapidlyAnna ate apples all day.I have millions of friendsThe smell assaulted my noseSausages sizzled in the sunWait! I shouted. Wait! Wait!The fire crackled in the hearth.Every cloud has a silver lining....

Special Agent 2025-06-23

13 Items: - A missing baby- Fire emergency-aka Public Safety- Lets get ready to rumble- Training for Run, Hide, Fight- system we use to respond to calls- Status allowing you to receive calls- Department that schedules appointmentsPHONE - How we get our code notifications- system to reach providers on mobile units...

Occupational Safety & Health 2026-04-20

10 Items: Pull, Aim, Squeeze, SweepPhysical harm caused to a personA sudden situation requiring urgent actionPractice exercises for emergency situationsOrganized movement of people to a safe placeEmergency switch used to call for urgent helpRapid burning that can cause damage or injuryOrganization that sets workplace safety standards...

School Word Search 2025-07-30

8 Items: a place where you can buy thingsa place where children go to learna quiet place to read and borrow booksstation a place where firefighters worka place where sick or hurt people get helpstation a place where police officers worka place where people play and relax outsideoffice a place where you send letters and packages

Chayei Sarah 2024-11-17

18 Items: אָבִינוּחַיַּי שָׂרָהRebekkah’s fatherAbraham’s servantRebekkah’s brotherThe first matriarchSarai means ________“to boast about G-d”Abraham’s other wife.King David’s personal prophet.This son of Abraham lived to 137The city in which Sarah is buried.These 2 Hebrew letters spell “father”This Hebrew letter represents revelation....

19 2025-08-17

15 Items: Shows speed.Covers fuel tank.Show speed and fuel.Protective headgear.Common biker materialMeasures distance traveled.Rubber covering that grips the roadOuter edge of a wheel holding the tireCircular part that rolls on the groundThin rods supporting a motorcycle wheelPart that connects the engine to the wheel...

Va’etchanan 2024-08-10

18 Items: שָׁמַרעָשָׂה“Deuteronomy”Moses successor“Shabbat Nachamu”מִצְוָה (English)Deuteronomy 6:4-9The place of TestingThe goal of the Torah.The son of Zechariah.וָאֶתְחַנַּן (English 3 words)Our G-d is a consuming ______.This is essential in any covenant.These are repeated in portion Va’etchanan.One of Messiah’s names (Talmud), Lamentations 1:16...

What does a Snowman wear? 2025-12-18

10 Items: Frosty's Corncob ___How Frosty came to beA nose & A reindeer treatBeady eyes or fire starterTwo arms out either side made of woodA knit blanket for the neck in snowy timesThree down the front, like a jacket fastenerA mouth that shares its name with a fruity cerealFrosty's transportation (like a witch travels too)...

80s Music 2025-05-30

15 Items: sang "Called Me"The "Material Girl""Purple Rain" artistGeorge Michael’s duoSinger of "Smooth Operator"New wave group with "Whip It"They blessed the rains in "Africa""Another One Bites the Dust" legendsBand behind "Dude (Looks Like a Lady)"German rockers behind "Winds of Change"All-female group who walked like Egyptians...

Better Than The Movies Independent Reading Vocab Sections 1-3 2024-04-26

12 Items: A strength of mindDeep love and respectTo get consumed by fireShowing or expressing love.Thoughtless and irresponsibleNot being or having been challengedA belief about something or someoneTo get the wrong idea about somethingTo form an opinion before you know the truthHaving or developing buds (Beginning of a plant)...

Crimes 2026-01-12

9 Items: someone who kills otherssomeone who steals things in generalsomeone who accesses into others computersomeone who secretly steals thing in a shopsomeone who sets a large fire in a buildingsomeone who steals from a person on a streetsomeone who damages or destroys public thingssomeone who breaks into a shop and steals thing...

Random 2023-03-28

113 Items: redwarjenomarkLovedinomarscakeworkkpopfrogdopefirebluetownbookeggslifesnowlimesalehomemoonrocktwicejiminkoreawooziateezoneussantamusicdramalemonmoneybeastbellekarmaswiftloverdracodobbywitchworldsmiledevilstylehoshistucknightwintersummerplanetbananaschooldisneyauroraprincestigmamalfoywizardgastonwatsonorangejisungjaemingoogleshineeamazonsearchlovely...

LIGHTS! CAMERA! DISPATCHIN! 2024-04-10

30 Items: OPENFOXOUR HALOMNEMONICGRAVEYARDPHASE ONEA BAD WORDCHECK JWEBTHE OFFICERGO GO JUICEHEADQUARTERSBOOGER SUGARI HEAR VOICESBODY WORN DOWNMIRACLE WORKERSOUR WORK NUMBEROUR NORMAL PACEORDERING SERVICENCIC TCIC ENTRIESNEED ANOTHER UNITWHERE'S THE STAFFTASER TASER TASERTRIAL BY FIRE SHIFTMY COMPUTERS FROZENALL EYES ON US SHIFTCHECKING FOR WARRANTS...

Zack The Movie: The Vengeance Of Derek 2024-08-20

88 Items: IvyLeeJoeyDavePaulAlanEmmaEricKaylaBrianSusanJamesVeenaJulieLiangDallasStevenDanielJoannaDieselJoshJr.MarkJr.PaulJr.BridgetAlanJr.EddieJr.PrincessKimberlyFakeBrianCatherineElizabethOfficerBenOfficerTomKatieWileyDerekWatsonAldaFerraldOfficerDaveJockSanderzOfficerEricZolaWhifreyFlame(Fire)DeniseWatsonOfficerJamesOfficerPerryStevenBrookeOfficerVeena...

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

Throne of Glass 2026-03-05

115 Items: RenTorFaeIceWarTheaKayaDuvaValgFireWindWyrdRingMaskBookVestaBriarAelinRowanChaolManonElideMaeveYreneHasarRolfeAnselAveryWitchCadreMagicWaterGatesRunesSwordCrownTowerQueenHonorLightLochanSorrelImogenFallonDorianAedionLorcanFenrysErawanNesrynSartaqKashinArghunVernonDarrowEyllweOrynthAnticaMorathWyvernRidersThroneAmuletPrinceEmpireBattleAsterinCelaena...

random ahh (by Mavis) 2026-05-10

14 Items: Darkstalker[solid water][T is for ___][plant with spines][the ethereal quint][yezzir it’s cold outside]supercalifragilisticexpialidocious[the wooden octopus from Wings Of Fire][guy that was a statue for 3,700 years][those hairless creatures that walk on two legs][the colossal that represents ethereal island and workshop]...

The Magic Brocade pgs. 2-7 2023-06-02

12 Items: Where did the woman live?What was the woman's job?What did the woman weave?Who in the family had died?What day does the woman rest?How does the youngest son feel?How do the two older sons feel?What do the sons get for the fire?Where does the woman sell her stuff?What did the woman buy for three coins?What day does the woman go to the market?...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

Fall 2026-09-17

113 Items: earhayjamnapowlpieredbarncoatcornfallfirehikeknitleafpilemazemoonnestnutsrainraketreevestwarmwindyarnacornapplebootscidercrispemberfeastfrostgoosegourdgravyjeanslayermaplenightpatchquiltquietspicevineswagonwoodsyummyzestyautumnbakingbreezeglovesgoldenhoodieinsidejacketkernelleavesorangequinceschoolturkeyunwindyellowzipperbonfirecrimsonequinox...

rare 2025-05-20

94 Items: mewuxieenteiho-ohlugiahoopaazelfchi-yuraikoucosmoglunalakyogrekeldeocelebideoxysarceusdialgapalkiazapdosmewtwophioneregicepoipolesuicuneokidogiting-lucosmoemgroudoncalyrexkartanavictinijirachimoltresogerpondarkraishayminmanaphymespritheatranzygardexerneasyveltalzeraorawo-chiennecrozmasolgaleorayquazabuzzwolenihilegogiratinaarticunovirizioncobalion...

Obvious 2025-07-05

114 Items: HicatJoyYesZenlionHopeLoveZealCalmEchoFireGlowOpenRiseZestFlowHealIdeaKeepPlayCareGrowJumpKindMoveSeekzebrahippoMommyHelloAppleBraveDanceGraceNightOceanPeaceQuestTrustYouthLightMagicQuietShineValueXenonYearnBloomDreamNobleQuestSmileTeachBuildDriveFocusHonorLearnEnergyWonderXenialNatureThriveUniqueCreateListenVisionWanderZenithUpwardCuriousFreedom...

hi 2026-04-22

114 Items: uphibyinamoneperfortheandouraxeareicefitttsfunredtomcatdogsunwordlabsmakefindsignhelplinethencluetheyfactverbnouncornfirecoolcolddriprichgoodjedisithnewtstarloginstyleenterspacesolarbearswoodschainshirtvideochinashortmoneyfunnyclownscarypartyhappygreenforcesnakemousejerryplutoearthmovieanimepowersearchanswerplanetsystemfictonsmokeyrappersinger...

PD Nature Codes D Thru L 2026-05-13

36 Items: DETAILDV RPTHAZARDEVICTIONFIREWORKSGPS ALARMKIDNAP RPTDRUNK DRIVERINTOX PERSONEXTRA PATROLFOUND PERSONHOLDUP ALARMPROSTITUTIONDV INPROGRESSMENTAL PERSONHOLDUP REPORTINVESTIGATIONFAMILY DISPUTEFOUND PROPERTYFAILURE TO PAYDISORDERLY SUBJHARRASSMENT RPTJAIL BREAK ALARMDECEASED SUBJ EPDDECEASED SUBJ VCSFIGHT IN PROGRESSINDECENT EXPOSURE...

Paris et ses monuments 2025-04-23

10 Items: river that splits Paris in halfmausoleum honoring many important peoplehas glass pyramid entrance and la Jocondeamusement park based on French comic bookbuilt for 1889 World's Fair, has 1665 stepsMuseum that was a train station, impressionistsbuilt for Napoleon, has tomb of unknown soldierthe "village" created at Versailles for M-A to play...

Earthquake in the Early Morning Chapter 6 2023-07-12

12 Items: What is the aunt's name?What building caught fire?Where does the family head to?What were the two boys wearing?What was the woman sobbing into?What happened to the boys' feet?We have to city, but lots of _______.There is no ______ and still less soap.What do Jack and Annie give to the boys?What is the brother's name in the family?...

Fantasy Friends 2025-04-21

5 Items: Fairy: A tiny magical person with delicate wings.Mermaid: A half‑woman, half‑fish friend of the sea.Unicorn: A horse with one magical horn on its forehead.Elf: A little helper with pointed ears from storybooks.Dragon: A big, friendly (or fierce) creature that can breathe fire.

KIDNAP 2025-03-07

1 Item: Nature, Dabo, Mother, Joker, Snakes, Praying, Warriors, Carnival, Madonna, Tech, Megan, Elvi, Ou, Dream, KIDNAP

Medival India Society 2023-02-08

10 Items: Chief of ScribesA person who spreads their religion or beliefsthe founder of the Maurya Empire and the first king of IndiaAt the very bottom of the pyramid they are Peasants and Servants-Near the top of the social structure they are kings and warriors.On the second to last row of the pyramid and they are Merchants and Landowners...

Allison Word Search 2025-02-19

65 Items: E.R.DougShowsC.S.ISuitsF.B.ISuitsWantedAllisonWatchesFriendsRevengeTrackerLionessThePittBig-SkyPickettMattlockTheQueenParadiseMcgeyvorNew-GirlTheAgencyEqualizerTulsaKingNashvilleSouthparkDucktailsBridgertonBlueBloodsF.B.I-TrueQuarantineFull-HouseTrue-CrimeFire-CountryThe-BachelorKim-PossibleProud-FamilyEven-StevensKiller-MindsHawaii-Five-O...

Jekyll and Hyde Vocabulary 2025-11-19

20 Items: WHIRLPOOLMORALLY STRICTSTRICT OR SEVEREANXIETY OR AGITATIONLARGE DISASTROUS FIRESTRONG DISLIKE OR DISTASTEWICKEDNESS, VILENESS, EVILFLIRTATIOUS ACT OR ATTITUDEAPPLING, AWFUL OR DISTASTEFULDOUBTFUL AUTHENTICITY OR UNTRUEILL TEMPERED OR PRONE TO WHININGDILIGENT, CAREFUL OR PERSEVERINGDEMEANOR OR EXPRESSIVE APPEARANCEONE WHO FLAUNTS USELESS KNOWLEDGE...

Animals 2026-03-27

100 Items: oxantantfoxpigcowyakfoxpigelkcrowbearsealcrablionmulefroggoatibexmoleboarlambswantangpandakoalaeaglehorsewhalegoosecoralbisoncamelmousehippohyenasheepmoosepandadingobunnyzebraslothlemerskunkotterwhalemonkeyjaguarcougerspidernarwalbedbugwalrusdonkeybaboonjackallizardturtlebeaverparrotmantisrabbitcoyotealpacaracoonbadgerpenguingorrilagiraffegazelle...

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

NBA Related Words 2025-11-01

191 Items: YaoRayPERMVPIceKobeShaqLukaNashDirkZionTraeHeatSunsNetsJazzRingPickDunkZoneTrapFansGritGOATCurryJokicTatumKawhiDavisVinceBullsBucksHawksKingsSpursMagicFoulsUsageBenchGuardDepthCoachDraftTradeLayupSwishBrickPressCourtArenaGrindChillLeBronJordanDurantHardenEmbiidBookerIrvingButlerPippenRodmanMaloneDuncanPierceReggieLakersKnicksPacersSixersPoints...

Global II Review 2025-05-22

24 Items: "Gold, God, and Glory"Heroes in a half-shellLouis XIV's fancy house.Earth-centric solar systemSeafaring Scandinavian warriorsA region of religious significanceThe capital of the Byzantine Empire.The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever....

Wanted Word Search 2023-04-05

109 Items: aicadhitemdttydpycprfunemateamhelpfirecalmetsbBACKsnowrepotowsswatsofisococoldsquadvoicefallsalarmchiefcourtwantedfelonyplateschairsscreendeputyordersshiftsphonesrescueanialitrunkssignalstormsstrokepatrolenginetankerARRESTlightssirensnercomseecomjudgesradioslicensebenefitweekendsheriffaddresscallerschokingmissingVEHICLEweaponsfriendsstarcomheaters...

Vocab, Unit 1 2024-11-01

20 Items: to let goto wipe outa bandit; robbercareful; cautiousscattered fragmentsnot genuine or truea difficult decisionlacking in restraintan opening or gap; riftto incline to beforehandto make a mess of; a messto spread or scatter freelyto caution or advise againstsudden and violent but briefto save from fire or shipwreck...

New Vocabulary 2026-04-17

22 Items: not dirtynot cleanhaving no moneyfar up, not lowa marriage partybig shop for foodhair on a man’s chinhaving a lot of moneynot high, near groundplace to watch moviescosting a lot of moneynot costing much moneyhair above a man’s liphaving no hair on headneeding rest, no energyhaving few years of agehaving many years of agehaving a husband or wife...

fire alarm 2025-09-29

1 Item: tomato tomato tomato tomato

Jobs vocab 2026-06-01

13 Items: Tom Cruise is oneTaylor Swift is onea cook in a restaurantwhen you need your hair cuta person who draws or paintsthe look after sheep and cowsthe person flying the aeroplanif there's a fire you call themthe person you see when you are sicka person in uniform that can help youthe help doctors and work in hospitals...

Elusive Word Search 2023-12-09

10 Items: To ignite or light a fireHappening by chance or accidentTo express sorrow or grief audiblyDifficult to find, catch or achieveA lengthy and aggressive speech or lectureTo move toward or be attracted to somethingToo great or extreme to be expressed in wordsAmusement, especially as expressed in laughter...

What is Red? by Mary O'Neill 2026-07-02

13 Items: SignMark and dotStrength and powerVery bright like fireflows out in a broken lineNot afraid, full of courageFeeling ashamed or red-facedMaterial that is used to decorate somethingThe time in the evening when the sun disappearsWhen you're embarrassed you want to run away and ...This make up is usually used by women when they dress up...

Peter Pan pgs. 28-34 2023-12-11

16 Items: Who spotted them?Where is the boys' home?Who was Wendy alone with?I've brough you a _______!What did the arrow strike?Who shot an arrow at Wendy?What were the boys dressed in?Who was looking for the pirates?Who were the pirates looking for?When will they fly straight until?What did each boy have of his own?They followed Peter without ______....

Fire Word Search 2025-01-16

1 Item: FIRE

Our Favorite Things 2025-12-22

15 Items: Our fury girlyI work at TreasureThe place you proposedThe best chihuahua everThe coolest fighting typeHe also goes by Mr MoraleZak Bagans is the GOAT ofWe ate this on my birthdayLife with you is always anThe coolest fire and ice typeThe nickname we have for each otherHome to Top Dawg, and not entertainmentThey just released the Cullen's Home build...

Elusive Word Search 2023-12-09

10 Items: To ignite or light a fireHappening by chance or accidentTo express sorrow or grief audiblyDifficult to find, catch or achieveA lengthy and aggressive speech or lectureTo move toward or be attracted to somethingToo great or extreme to be expressed in wordsAmusement, especially as expressed in laughter...

Pekudei 2023-05-04

8 Items: What would cover the Mishkan by day?What would cover the Mishkan by night?In what year was the Mishkan established?What is the correct word for "priesthood"?In what day did Moshe establish the Mishkan?From how many years did a person have to do the census?Under the direction of who, was the work of the Mishkan?...

Christmas 2022-12-15

3 Items: bells, box, gifts, candy cane, sock, fire,tree, santa claus, elf, cookies, décorations,chimney, eggnog, grinch, moovie, skii, snowboard, ornaments, list, ribbon, star, ruddolf, scrudge, sled, snowman, toys, tradition, turkey, angel, candel, sweatshirt,

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

Berühmtesten Tänze der Welt 2026-02-03

25 Items: Swing aus USAaus AustralienHula aus HawaiiHip-Hop aus USAK-Pop aus KoreaTango ArgentinoKumpo aus SenegalTap Dance aus USABreakdance aus USAHaka aus NeuseelandFlamenco aus SpanienFoxtrott aus der USADancehall aus JamaikaBharatanatyam aus Indien"Irish Dance" aus IrlandFire Dance aus PolynesienElectro Dance aus FrankreichMaskentänze aus Tibet/Bhutan...

Christmas 2022-12-15

3 Items: bells, box, gifts, candy cane, sock, fire,tree, santa claus, elf, cookies, décorations,chimney, eggnog, grinch, moovie, skii, snowboard, ornaments, list, ribbon, star, ruddolf, scrudge, sled, snowman, toys, tradition, turkey, angel, candel, sweatshirt,

Chapter 3, Part 2; Applied Terminology for Blood, Lymphatics, and Immunity 2026-03-30

50 Items: A FATA HORN CELLA LYMPH CELLA LARGE EATERA MARROW CELLRESEMBLING LYMPHAN AFTER RED CELLCONDITION OF "FIRE"THE BETWEEN TISSUESTHE ONE/SINGLE CELLSTUDY OF SHAPE/FORMA MARROW GERM/SHOOTA DISEASE OF MARROWA LARGE NUCLEUS CELLAN AFTER MARROW CELLPERTAINING TO JAUNDICETO CUT OUT LYMPH CELLSPERTAINING TO THE GROINTHE JAUNDICE (YELLOWING)...

December 2024 safety quiz 2024-12-04

10 Items: Do not run cords under 4.Report injury via the 4 6.Do not daisy 5 power strips.Wash 5 often to avoid injury.OSHA requires that all 7 injuries be reported.Do not use outlets or cords that have exposed 6.Avoid hanging lights near any potential 4 hazards.Worker 8 need to be reported to OSHA within 8 hours....

My Side of the Mountain 2026-04-28

14 Items: a tree branchan insufficienta bird's feathersto hunt illegallydone in a secretive waycapable of catching firein an early stage of developmenta branch where a bird sits or neststo tie or fasten in order to restrainworrying or thinking about one's problemto allow fresh air in and stale air to escape...

game time baby (Q&Jess edition) 2023-11-14

23 Items: Bi-iconHow we metYurt + HomeHeat + waterJess is allergicthis is Q (fire)Best protein everJess's birthstonethis is Jess (water)For the love of ____Camping with friendsYou feel at home hereOur first show togetherFlavor you're obsessed withThought we'd run out of gasOur first time getting drunkOur favorite food spot in LAWe love a good day trip here...

Cool Jobs 2024-07-14

50 Items: sospyvetsaidchefactormodelbakeragentnurseartistdancerfarmersingerwriterwanteddoctorboringathletedentistteachergood atbecausejanitordesignermagicianmusiciansalesmanexcitingastronautlibrarianpresidentscientistjournalistsaleswomanbusinessmaninterestingi want to befire fighterbusinesswomanin the futureinterested inparty plannerwhen i grow up...

chance 2025-03-24

7 Items: He picked a random number from the hat.She was fortunate to find her lost wallet on the bus.The fire was determined to be an accidental incident.A snowstorm in the middle of summer was a freak event.We met by chance at the coffee shop after years apart.It was an unfortunate mistake that cost them the game....

Jobs 2025-11-25

7 Items: the safety of citizens and enforces the lawstudents in school and provides them with knowledgetreat sick patients and prescribes medicine for themcarries letters and parcels between people and placesresponsible for taking care of the family and the homeuse tools likea plow and scythe to grow crops and feeds us...

What's missing? 2026-01-06

12 Items: Not the gapThis one is queerHas a unique heardLongest stretch the worldThe Miwok were there firstI guess I want to go to Michigan now?I guess I want to go to Wisconsin now?Making chips since the last glacial periodBirth place of the Temu coast guard the USLSSSo now there are two reasons to go to Michigan....

JCAHO Readiness- General Info 2026-03-24

14 Items: Code blackCode red procedureSevere weather threatWho is Kathy Wareham?Hostage or active aggressorWhat does a code yellow mean?Esclatation of concerns first stepNo food or drink at the __________.Reporting system for colleague injuryProcess for using a fire extinguisherYou must wear your badge above your __________....

Ancient World History | David 2026-04-21

10 Items: Pilate was a ______the Jews _____ the RomansJesus fulfilled the laws of MosesJoseph was from the line of this manChristianity was made ________ in 313 ADThe dynasty that Judea was under Roman RuleHe blamed the Christians for the fire in 64 ADHe wrote 7 letters to the churches of Asia MinorThe councils of Hippo and Carthage were at this location...

Las profesiones 2026-03-19

16 Items: Uses brushes and paint.Person who drives you around.professional who fixes teeth.Wears a suit and goes to court.Deals with emergencies and fire.Individual has special superpower.Person likes to use paper and pen.You find this person in the kitchen.Works in the classroom with children.Wears a uniform, and travels frequently....

Weather Vocabulary Wordsearch 2026-06-22

8 Items: Rain, hail, sleet and snowThe day to day changes in the atmosphereGases that absorb and trap heat from the SunLong term pattern of weather over a period of 30 yearsAn unplanned, uncontrolled fire in a forest or grasslandA period of prolonged dry weather with little or no rainfallLong term shifts in Earth's average temperatures and weather patterns...

Mass Word Search 2024-05-17

13 Items: The main liquid on our planet.The point at which liquids boil.A chemical reaction that is very hot.The things that make up our universe.Vaporized liquid as a result of boiling.How much gravity pulls down on something.the degree of compactness of a substance.How fast something or someone is traveling.The resistance that stops objects from moving....

Extreme weather conditions 2025-07-31

13 Items: "Water covering normally dry land.""An electric discharge during storms.""A rapid fall of snow down a mountain.""A storm producing frozen rain pellets.""A storm with intense winds and heavy rain""Heavy snowfall accompanied by strong winds.""A storm with lightning, thunder, and heavy rain.""Extended dry period without significant rainfall."...

Mystery in the Cereal Bowl 2025-10-24

11 Items: Worked with Wallace at Taco BellHenry Louis Wallace's last victimHenry Louis Wallace's first victimOnly victim Wallace murdered using a rockPalm print was found on this victim's carVictim was killed and found in her own homeVictim was murdered in front of her two sonsHenry Louis Wallace's youngest victim (18 yrs old)...

Loop A word 2024-12-03

5 Items: - Ang malaking masa ng lupain ng mundo.- Ang pinakamalaking kontinente sa sukat at populasyon.- Ang tawag sa isang yugto ng kaunlaran ng isang lipunan.- Tumutukoy sa pag-aaral ng katangiang pisikal ng daigdig.Ring of Fire - Ang tawag sa isang malawak na sona kung saan madalas nagaganap ang mga paggalaw ng lupa at pagputok ng mga bulkan.

Ke Word Search 2025-05-14

1 Item: ahi fire

Ke Word Search 2025-05-14

1 Item: ahi fire

RLcraft word search 2023-03-29

132 Items: icerocseaikaroaentbugdeergruemakayaleyetifirewispwargmaugabtuarixbirdwormknifejengudjinnaegisargusnymphgekenepionconbaaspidjousttrollgonzoshadekrakeafritpixenpinkykhalkdawonraikohermaettincrusksilexiorayabaiatritegeistghoulclinkgnekkbelphbeastcinderturkeyxaphanvolcanstylphtremorkobalddragongorgonvespidlobbermorockreaperzephyrreivervapulawraith...

one tree hill (season 9) 2023-07-16

130 Items: fatgunbodycopsfearfiretourtricbeachdeathdramadrugsfugueguilthoteljerrylyingmusicnaleyoceantasertwinsdebleeeuropefamilyflyinghotcarinternlaurenplanesairportbrulianburgerscompanyconcertfashiongolfinghatesexhistoryhostagemadisonopenmicreunionrivalryroachessingingsisterstherapybakermandanscottdirectorfightingflirtinghospitaljealousymarriageproposal...

Random 2026-07-19

130 Items: TedLiaI.NHanAsaAirMaxMikeWillSeMiRumiMiraZoeyJinuAbbyBabyYejiYunaLisaRoseRoraRamiRukaRukaLaraHornTubaOboeElsaAnnaSvenOlafFireUrduFrogAudiAyanIzzyNancySteveRobinEricaHollyJoyceKarenVecnaSuzieGiHunJunHoDerpyFelixMinjiHanniHyeinJisooJamesMeganManonSnareFluteCelloViolaPianoWaterEarthJaxenKadenRileyAsherMylesJulieItalyElevenHopperDustinJunHeeNamGyu...

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

Pg. 39 2026-06-10

15 Items: comes from treesa groundwater sourcenot planned in advancea surge of water pressureavailable amount of somethingcommunicate info using a radioend of a rope used to tie a knota large container for holding waterthe condition of being fully in placedevice placed over the end of a suctionthe level of groundwater under the Earth...

Sopa de letras "Problemas ambientales" Spanish 3 H 2026-05-01

66 Items: FireFloodToxicSolarEnergyOxygenCarbonGlobalCrisisActionPlanetErosionEcologyDroughtTornadoPlasticMineralNaturalVehicleProjectProgramSpeciesEmissionClimaticDisasterChemicalElectricSolutionActivityPollutionReductionRecyclingResourcesEcosystemRadiationHurricanePesticideRenewableEducationCommunityMigrationProtectionAtmosphereIndustrialFertilizer...

ashcat BTS songs 2026-04-20

135 Items: vonno23on283drmrjfyadnarunlie2.0whobtsjinvanlikeswimraingogoidolhomedopefirejumplostnutslostbluemusesugabt21koyamangtataseoulgroinsevenforusyoursmyyoujhopecookyaliensnormalpleasedangerdimplefilterineedurunbtssavemecoffeebutterheavenagustdshookichimmydiseasemicdroptaketwonotodaybicyclestrangefriendsfaceofffallinghaegeumhateyouallnighthooligan...

Vocabulary Units 12 & 13 2023-05-17

30 Items: totalsecretharmlessobscuritygreat firecomplainingmake fun ofsad and gloomyindulge in excesswarm and friendlydisregard; dismisspoverty; misfortunefleeting; vanishingextreme exaggerationmeager; insufficientgreediness for wealthhighly skilled artistnot easily understoodold-fashioned; obsoletetending to evade captureassertion or confirmation...

Haunt Word Search 2025-03-12

126 Items: BatCatBooRedRunFlyOwlOrbZapMothFallBinxStabGutsDarkRainWalkDeadMazeCornJumpScarGoatRoseLambMoonWolfEvilFireFallWandCrowRopeHowlCastHauntHouseWitchSalemBlackGhostGhoulMagicCandyAppleCiderCrispMyersKnifeBloodScaryStoneCloakDeathAngelDevilTarotSparkWingsDemonClownOuijaRavenSkullDonutSugarNightStarsFairyBonesTeethChainAlienBroomGreenStormReaperOrange...

FANTASY 2025-11-30

15 Items: the knight’s shiny weapon.a magical horse with one horn.a magical place with tall trees.fairies and dragons use me to fly.a chest filled with gold or jewels.a stick wizards wave to cast spells.bright colors in the sky after rain.something wonderful you can’t explain.a giant creature that can breathe fire.a tiny creature with wings and sparkle....

Symbolism 2026-05-13

7 Items: Symbolizes civilization, law, and orderly speech.This entity represents the world or society as a whole.Represents the democratic government and order on the island.Represents the hope for rescue and connection to civilization.Represents the leader of autocracy, dictatorship, and savagery on the island....

christmas 2024-12-17

128 Items: JoyHamElfRedFunSnowSledStarSackCoalBellMaryNoelGoldHolyColdFireCozyMilkBarnOlafCupidCometVixenSantaElvesAngelJesusJollyMerryBuddyGiftsGreenWhiteMagicPartyCheerBibleDonnerDasherDancerSleighLightsChristChurchGrinchWinterJosephTurkeyStnickGivingFamilySilverEggnogUnwrapManjorPreachIcicleFrozenBlitzenPrancerRudolphSnowmanCookiesChimneyKrampusDiehard...

the pro heros of mha 2025-10-29

30 Items: retiredsexy herothe cowboythe gun herothe giant herothe crust herothe sonar herothe fiber herothe tiger herothe blood herothe smile herothe rabbit herosees the futurethe engien herothe cement herothe wooden herothe folding heroa rat hero thingshe hates midoyiathe telephic herothe fat quirk herothe lock hold herothe fire flame hero...

Within View 2025-11-08

131 Items: ALEBOGDEWFIRHENIVYINKNETOWLSAWWETAGEDBLEWBLOWBOLTBYRECHOPDALEDEERDRIPFIREFROGGATEGLENHEWNHUSHMESHMINTMOSSMUCKPATHPOURRESTROAMROPESEWNSHEDSTEWTOADWOLDWOODALDERALOFTAMBERAMBLEBIRCHBIRDSBOOTSBRIARCEDARDECAYDITCHFAYEDFIELDFOGGYGREENGULCHHONEYKNOTSLIGHTMAPLEMARSHMISTYOCHREQUAILQUIETQUILTREEDSSHEEPSHOESSLEEPSMOKESTEAMSTIHLSTONESTORMSWOOPTAWNYTREESUMBER...

The Great Big Search - Yr 8 2025-12-18

134 Items: GoldZincAtomIronMeltHeatFlowRateCoreRingFireLavaRockGroupWaterMetalLightSoundWasteWavesCellsHeartLungsNasalVilliSmallLargeCrustOuterInnerFieldScaleFocusVentsMagmaCyclePeriodSilverVolumeDiluteMatterSankeySystemSexualSeptumLarynxCavityPlasmaMantlePlatesElementMixtureProductMercuryDensityKineticElasticDiagramThermalNervousTendonsBronchiTracheaPharynx...

Fourth Wing 2026-07-24

135 Items: RedAsimBlueCathDainDukeFireJackKingLiamMateMiraOrenAaricAetosAlloyAmariBlackBodhiBrownClawsDeighDeathDrakeDunneElsumGreenKaoriLoialMagicMalekMarbhMavenNolonQuinnQueenRelicRidocRunesSquadTairnTauriTeineVeninWardsXadenAimsirAotromAretiaBattleBondedCadetsCodaghDragonFeirgeFlyingHedeonImogenKrovlaLilithMenderNaolinOrangeRessonRidersSaddleSawyerSgaeyl...

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Deutsche Weihnachten 2024-12-06

50 Items: (snow)(star)(bells)(angel)(frost)(feast)(sleigh)(tinsel)(sweets)(candles)(incense)(snowman)(cinnamon)(fir tree)(presents)(reindeer)(Christmas)(ornaments)(fireplace)(mistletoe)(snowflake)(shepherds)(mulled wine)(gingerbread)(gift giving)(Santa Claus)(family time)(Christ child)(Advent wreath)(Christmas Eve)(Christmas joy)(Christmas tree)...

Abundance Word Search 2025-12-12

129 Items: OxDogFanPigRatRedCoinDrumFireFishGiftGoatGoldGongHomeJadeKnotLionMoonMythNianSilkBloomBrushCycleDanceDeityEarthFagaoFeastFruitHorseIngotLotusLuckyLunarMetalMoneyOperaPeonyQipaoSheepSnakeAngpaoBambooCustomCymbalDragonFamilyGingkoJujubeLegendLycheeMonkeyOrangeOrchidParadePeanutPomeloPrayerRabbitRitualScrollShrineSymbolBanquetCaishenCostumeCouplet...

Ezra's lesson 40 and 41 crossword puzzle 2026-04-21

10 Items: The Military governor.When the Church started.The religion that Christianity came out of.The amount of OT prophecies Jesus fulfilled.The Roman leader who converted to Christianity.The emperor who blamed Christians for the fire in 64 AD.The Emperor that made Christianity the official religion of Rome....

Revison word search 2023-11-20

17 Items: Extremly largeAlot of soldiersSide of the faceA man made riverA young male chickenExtremly clever or smartTo agree to marry someoneA movement of part of the bodyUsed for joining the ends of a beltTo make waste into reusable materialThe hundredth anniversary of a eventteAn imaginary creature that can breathe fire...