fire emblem warriors Word Searches

Va’etchanan 2024-08-10

18 Items: שָׁמַרעָשָׂה“Deuteronomy”Moses successor“Shabbat Nachamu”מִצְוָה (English)Deuteronomy 6:4-9The place of TestingThe goal of the Torah.The son of Zechariah.וָאֶתְחַנַּן (English 3 words)Our G-d is a consuming ______.This is essential in any covenant.These are repeated in portion Va’etchanan.One of Messiah’s names (Talmud), Lamentations 1:16...

80s Music 2025-05-30

15 Items: sang "Called Me"The "Material Girl""Purple Rain" artistGeorge Michael’s duoSinger of "Smooth Operator"New wave group with "Whip It"They blessed the rains in "Africa""Another One Bites the Dust" legendsBand behind "Dude (Looks Like a Lady)"German rockers behind "Winds of Change"All-female group who walked like Egyptians...

What does a Snowman wear? 2025-12-18

10 Items: Frosty's Corncob ___How Frosty came to beA nose & A reindeer treatBeady eyes or fire starterTwo arms out either side made of woodA knit blanket for the neck in snowy timesThree down the front, like a jacket fastenerA mouth that shares its name with a fruity cerealFrosty's transportation (like a witch travels too)...

Better Than The Movies Independent Reading Vocab Sections 1-3 2024-04-26

12 Items: A strength of mindDeep love and respectTo get consumed by fireShowing or expressing love.Thoughtless and irresponsibleNot being or having been challengedA belief about something or someoneTo get the wrong idea about somethingTo form an opinion before you know the truthHaving or developing buds (Beginning of a plant)...

Random 2023-03-28

113 Items: redwarjenomarkLovedinomarscakeworkkpopfrogdopefirebluetownbookeggslifesnowlimesalehomemoonrocktwicejiminkoreawooziateezoneussantamusicdramalemonmoneybeastbellekarmaswiftloverdracodobbywitchworldsmiledevilstylehoshistucknightwintersummerplanetbananaschooldisneyauroraprincestigmamalfoywizardgastonwatsonorangejisungjaemingoogleshineeamazonsearchlovely...

LIGHTS! CAMERA! DISPATCHIN! 2024-04-10

30 Items: OPENFOXOUR HALOMNEMONICGRAVEYARDPHASE ONEA BAD WORDCHECK JWEBTHE OFFICERGO GO JUICEHEADQUARTERSBOOGER SUGARI HEAR VOICESBODY WORN DOWNMIRACLE WORKERSOUR WORK NUMBEROUR NORMAL PACEORDERING SERVICENCIC TCIC ENTRIESNEED ANOTHER UNITWHERE'S THE STAFFTASER TASER TASERTRIAL BY FIRE SHIFTMY COMPUTERS FROZENALL EYES ON US SHIFTCHECKING FOR WARRANTS...

Zack The Movie: The Vengeance Of Derek 2024-08-20

88 Items: IvyLeeJoeyDavePaulAlanEmmaEricKaylaBrianSusanJamesVeenaJulieLiangDallasStevenDanielJoannaDieselJoshJr.MarkJr.PaulJr.BridgetAlanJr.EddieJr.PrincessKimberlyFakeBrianCatherineElizabethOfficerBenOfficerTomKatieWileyDerekWatsonAldaFerraldOfficerDaveJockSanderzOfficerEricZolaWhifreyFlame(Fire)DeniseWatsonOfficerJamesOfficerPerryStevenBrookeOfficerVeena...

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

Throne of Glass 2026-03-05

115 Items: RenTorFaeIceWarTheaKayaDuvaValgFireWindWyrdRingMaskBookVestaBriarAelinRowanChaolManonElideMaeveYreneHasarRolfeAnselAveryWitchCadreMagicWaterGatesRunesSwordCrownTowerQueenHonorLightLochanSorrelImogenFallonDorianAedionLorcanFenrysErawanNesrynSartaqKashinArghunVernonDarrowEyllweOrynthAnticaMorathWyvernRidersThroneAmuletPrinceEmpireBattleAsterinCelaena...

Crimes 2026-01-12

9 Items: someone who kills otherssomeone who steals things in generalsomeone who accesses into others computersomeone who secretly steals thing in a shopsomeone who sets a large fire in a buildingsomeone who steals from a person on a streetsomeone who damages or destroys public thingssomeone who breaks into a shop and steals thing...

The Magic Brocade pgs. 2-7 2023-06-02

12 Items: Where did the woman live?What was the woman's job?What did the woman weave?Who in the family had died?What day does the woman rest?How does the youngest son feel?How do the two older sons feel?What do the sons get for the fire?Where does the woman sell her stuff?What did the woman buy for three coins?What day does the woman go to the market?...

Paris et ses monuments 2025-04-23

10 Items: river that splits Paris in halfmausoleum honoring many important peoplehas glass pyramid entrance and la Jocondeamusement park based on French comic bookbuilt for 1889 World's Fair, has 1665 stepsMuseum that was a train station, impressionistsbuilt for Napoleon, has tomb of unknown soldierthe "village" created at Versailles for M-A to play...

rare 2025-05-20

94 Items: mewuxieenteiho-ohlugiahoopaazelfchi-yuraikoucosmoglunalakyogrekeldeocelebideoxysarceusdialgapalkiazapdosmewtwophioneregicepoipolesuicuneokidogiting-lucosmoemgroudoncalyrexkartanavictinijirachimoltresogerpondarkraishayminmanaphymespritheatranzygardexerneasyveltalzeraorawo-chiennecrozmasolgaleorayquazabuzzwolenihilegogiratinaarticunovirizioncobalion...

Obvious 2025-07-05

114 Items: HicatJoyYesZenlionHopeLoveZealCalmEchoFireGlowOpenRiseZestFlowHealIdeaKeepPlayCareGrowJumpKindMoveSeekzebrahippoMommyHelloAppleBraveDanceGraceNightOceanPeaceQuestTrustYouthLightMagicQuietShineValueXenonYearnBloomDreamNobleQuestSmileTeachBuildDriveFocusHonorLearnEnergyWonderXenialNatureThriveUniqueCreateListenVisionWanderZenithUpwardCuriousFreedom...

Earthquake in the Early Morning Chapter 6 2023-07-12

12 Items: What is the aunt's name?What building caught fire?Where does the family head to?What were the two boys wearing?What was the woman sobbing into?What happened to the boys' feet?We have to city, but lots of _______.There is no ______ and still less soap.What do Jack and Annie give to the boys?What is the brother's name in the family?...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

Fantasy Friends 2025-04-21

5 Items: Fairy: A tiny magical person with delicate wings.Mermaid: A half‑woman, half‑fish friend of the sea.Unicorn: A horse with one magical horn on its forehead.Elf: A little helper with pointed ears from storybooks.Dragon: A big, friendly (or fierce) creature that can breathe fire.

Medival India Society 2023-02-08

10 Items: Chief of ScribesA person who spreads their religion or beliefsthe founder of the Maurya Empire and the first king of IndiaAt the very bottom of the pyramid they are Peasants and Servants-Near the top of the social structure they are kings and warriors.On the second to last row of the pyramid and they are Merchants and Landowners...

Allison Word Search 2025-02-19

65 Items: E.R.DougShowsC.S.ISuitsF.B.ISuitsWantedAllisonWatchesFriendsRevengeTrackerLionessThePittBig-SkyPickettMattlockTheQueenParadiseMcgeyvorNew-GirlTheAgencyEqualizerTulsaKingNashvilleSouthparkDucktailsBridgertonBlueBloodsF.B.I-TrueQuarantineFull-HouseTrue-CrimeFire-CountryThe-BachelorKim-PossibleProud-FamilyEven-StevensKiller-MindsHawaii-Five-O...

Jekyll and Hyde Vocabulary 2025-11-19

20 Items: WHIRLPOOLMORALLY STRICTSTRICT OR SEVEREANXIETY OR AGITATIONLARGE DISASTROUS FIRESTRONG DISLIKE OR DISTASTEWICKEDNESS, VILENESS, EVILFLIRTATIOUS ACT OR ATTITUDEAPPLING, AWFUL OR DISTASTEFULDOUBTFUL AUTHENTICITY OR UNTRUEILL TEMPERED OR PRONE TO WHININGDILIGENT, CAREFUL OR PERSEVERINGDEMEANOR OR EXPRESSIVE APPEARANCEONE WHO FLAUNTS USELESS KNOWLEDGE...

fire alarm 2025-09-29

1 Item: tomato tomato tomato tomato

Wanted Word Search 2023-04-05

109 Items: aicadhitemdttydpycprfunemateamhelpfirecalmetsbBACKsnowrepotowsswatsofisococoldsquadvoicefallsalarmchiefcourtwantedfelonyplateschairsscreendeputyordersshiftsphonesrescueanialitrunkssignalstormsstrokepatrolenginetankerARRESTlightssirensnercomseecomjudgesradioslicensebenefitweekendsheriffaddresscallerschokingmissingVEHICLEweaponsfriendsstarcomheaters...

Vocab, Unit 1 2024-11-01

20 Items: to let goto wipe outa bandit; robbercareful; cautiousscattered fragmentsnot genuine or truea difficult decisionlacking in restraintan opening or gap; riftto incline to beforehandto make a mess of; a messto spread or scatter freelyto caution or advise againstsudden and violent but briefto save from fire or shipwreck...

KIDNAP 2025-03-07

1 Item: Nature, Dabo, Mother, Joker, Snakes, Praying, Warriors, Carnival, Madonna, Tech, Megan, Elvi, Ou, Dream, KIDNAP

Global II Review 2025-05-22

24 Items: "Gold, God, and Glory"Heroes in a half-shellLouis XIV's fancy house.Earth-centric solar systemSeafaring Scandinavian warriorsA region of religious significanceThe capital of the Byzantine Empire.The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever....

NBA Related Words 2025-11-01

191 Items: YaoRayPERMVPIceKobeShaqLukaNashDirkZionTraeHeatSunsNetsJazzRingPickDunkZoneTrapFansGritGOATCurryJokicTatumKawhiDavisVinceBullsBucksHawksKingsSpursMagicFoulsUsageBenchGuardDepthCoachDraftTradeLayupSwishBrickPressCourtArenaGrindChillLeBronJordanDurantHardenEmbiidBookerIrvingButlerPippenRodmanMaloneDuncanPierceReggieLakersKnicksPacersSixersPoints...

Elusive Word Search 2023-12-09

10 Items: To ignite or light a fireHappening by chance or accidentTo express sorrow or grief audiblyDifficult to find, catch or achieveA lengthy and aggressive speech or lectureTo move toward or be attracted to somethingToo great or extreme to be expressed in wordsAmusement, especially as expressed in laughter...

Peter Pan pgs. 28-34 2023-12-11

16 Items: Who spotted them?Where is the boys' home?Who was Wendy alone with?I've brough you a _______!What did the arrow strike?Who shot an arrow at Wendy?What were the boys dressed in?Who was looking for the pirates?Who were the pirates looking for?When will they fly straight until?What did each boy have of his own?They followed Peter without ______....

Fire Word Search 2025-01-16

1 Item: FIRE

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

Elusive Word Search 2023-12-09

10 Items: To ignite or light a fireHappening by chance or accidentTo express sorrow or grief audiblyDifficult to find, catch or achieveA lengthy and aggressive speech or lectureTo move toward or be attracted to somethingToo great or extreme to be expressed in wordsAmusement, especially as expressed in laughter...

Our Favorite Things 2025-12-22

15 Items: Our fury girlyI work at TreasureThe place you proposedThe best chihuahua everThe coolest fighting typeHe also goes by Mr MoraleZak Bagans is the GOAT ofWe ate this on my birthdayLife with you is always anThe coolest fire and ice typeThe nickname we have for each otherHome to Top Dawg, and not entertainmentThey just released the Cullen's Home build...

Pekudei 2023-05-04

8 Items: What would cover the Mishkan by day?What would cover the Mishkan by night?In what year was the Mishkan established?What is the correct word for "priesthood"?In what day did Moshe establish the Mishkan?From how many years did a person have to do the census?Under the direction of who, was the work of the Mishkan?...

Christmas 2022-12-15

3 Items: bells, box, gifts, candy cane, sock, fire,tree, santa claus, elf, cookies, décorations,chimney, eggnog, grinch, moovie, skii, snowboard, ornaments, list, ribbon, star, ruddolf, scrudge, sled, snowman, toys, tradition, turkey, angel, candel, sweatshirt,

Christmas 2022-12-15

3 Items: bells, box, gifts, candy cane, sock, fire,tree, santa claus, elf, cookies, décorations,chimney, eggnog, grinch, moovie, skii, snowboard, ornaments, list, ribbon, star, ruddolf, scrudge, sled, snowman, toys, tradition, turkey, angel, candel, sweatshirt,

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

Berühmtesten Tänze der Welt 2026-02-03

25 Items: Swing aus USAaus AustralienHula aus HawaiiHip-Hop aus USAK-Pop aus KoreaTango ArgentinoKumpo aus SenegalTap Dance aus USABreakdance aus USAHaka aus NeuseelandFlamenco aus SpanienFoxtrott aus der USADancehall aus JamaikaBharatanatyam aus Indien"Irish Dance" aus IrlandFire Dance aus PolynesienElectro Dance aus FrankreichMaskentänze aus Tibet/Bhutan...

December 2024 safety quiz 2024-12-04

10 Items: Do not run cords under 4.Report injury via the 4 6.Do not daisy 5 power strips.Wash 5 often to avoid injury.OSHA requires that all 7 injuries be reported.Do not use outlets or cords that have exposed 6.Avoid hanging lights near any potential 4 hazards.Worker 8 need to be reported to OSHA within 8 hours....

game time baby (Q&Jess edition) 2023-11-14

23 Items: Bi-iconHow we metYurt + HomeHeat + waterJess is allergicthis is Q (fire)Best protein everJess's birthstonethis is Jess (water)For the love of ____Camping with friendsYou feel at home hereOur first show togetherFlavor you're obsessed withThought we'd run out of gasOur first time getting drunkOur favorite food spot in LAWe love a good day trip here...

Cool Jobs 2024-07-14

50 Items: sospyvetsaidchefactormodelbakeragentnurseartistdancerfarmersingerwriterwanteddoctorboringathletedentistteachergood atbecausejanitordesignermagicianmusiciansalesmanexcitingastronautlibrarianpresidentscientistjournalistsaleswomanbusinessmaninterestingi want to befire fighterbusinesswomanin the futureinterested inparty plannerwhen i grow up...

chance 2025-03-24

7 Items: He picked a random number from the hat.She was fortunate to find her lost wallet on the bus.The fire was determined to be an accidental incident.A snowstorm in the middle of summer was a freak event.We met by chance at the coffee shop after years apart.It was an unfortunate mistake that cost them the game....

Jobs 2025-11-25

7 Items: the safety of citizens and enforces the lawstudents in school and provides them with knowledgetreat sick patients and prescribes medicine for themcarries letters and parcels between people and placesresponsible for taking care of the family and the homeuse tools likea plow and scythe to grow crops and feeds us...

What's missing? 2026-01-06

12 Items: Not the gapThis one is queerHas a unique heardLongest stretch the worldThe Miwok were there firstI guess I want to go to Michigan now?I guess I want to go to Wisconsin now?Making chips since the last glacial periodBirth place of the Temu coast guard the USLSSSo now there are two reasons to go to Michigan....

Las profesiones 2026-03-19

16 Items: Uses brushes and paint.Person who drives you around.professional who fixes teeth.Wears a suit and goes to court.Deals with emergencies and fire.Individual has special superpower.Person likes to use paper and pen.You find this person in the kitchen.Works in the classroom with children.Wears a uniform, and travels frequently....

Mass Word Search 2024-05-17

13 Items: The main liquid on our planet.The point at which liquids boil.A chemical reaction that is very hot.The things that make up our universe.Vaporized liquid as a result of boiling.How much gravity pulls down on something.the degree of compactness of a substance.How fast something or someone is traveling.The resistance that stops objects from moving....

Extreme weather conditions 2025-07-31

13 Items: "Water covering normally dry land.""An electric discharge during storms.""A rapid fall of snow down a mountain.""A storm producing frozen rain pellets.""A storm with intense winds and heavy rain""Heavy snowfall accompanied by strong winds.""A storm with lightning, thunder, and heavy rain.""Extended dry period without significant rainfall."...

Ke Word Search 2025-05-14

1 Item: ahi fire

Ke Word Search 2025-05-14

1 Item: ahi fire

Loop A word 2024-12-03

5 Items: - Ang malaking masa ng lupain ng mundo.- Ang pinakamalaking kontinente sa sukat at populasyon.- Ang tawag sa isang yugto ng kaunlaran ng isang lipunan.- Tumutukoy sa pag-aaral ng katangiang pisikal ng daigdig.Ring of Fire - Ang tawag sa isang malawak na sona kung saan madalas nagaganap ang mga paggalaw ng lupa at pagputok ng mga bulkan.

Mystery in the Cereal Bowl 2025-10-24

11 Items: Worked with Wallace at Taco BellHenry Louis Wallace's last victimHenry Louis Wallace's first victimOnly victim Wallace murdered using a rockPalm print was found on this victim's carVictim was killed and found in her own homeVictim was murdered in front of her two sonsHenry Louis Wallace's youngest victim (18 yrs old)...

RLcraft word search 2023-03-29

132 Items: icerocseaikaroaentbugdeergruemakayaleyetifirewispwargmaugabtuarixbirdwormknifejengudjinnaegisargusnymphgekenepionconbaaspidjousttrollgonzoshadekrakeafritpixenpinkykhalkdawonraikohermaettincrusksilexiorayabaiatritegeistghoulclinkgnekkbelphbeastcinderturkeyxaphanvolcanstylphtremorkobalddragongorgonvespidlobbermorockreaperzephyrreivervapulawraith...

one tree hill (season 9) 2023-07-16

130 Items: fatgunbodycopsfearfiretourtricbeachdeathdramadrugsfugueguilthoteljerrylyingmusicnaleyoceantasertwinsdebleeeuropefamilyflyinghotcarinternlaurenplanesairportbrulianburgerscompanyconcertfashiongolfinghatesexhistoryhostagemadisonopenmicreunionrivalryroachessingingsisterstherapybakermandanscottdirectorfightingflirtinghospitaljealousymarriageproposal...

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

FANTASY 2025-11-30

15 Items: the knight’s shiny weapon.a magical horse with one horn.a magical place with tall trees.fairies and dragons use me to fly.a chest filled with gold or jewels.a stick wizards wave to cast spells.bright colors in the sky after rain.something wonderful you can’t explain.a giant creature that can breathe fire.a tiny creature with wings and sparkle....

Vocabulary Units 12 & 13 2023-05-17

30 Items: totalsecretharmlessobscuritygreat firecomplainingmake fun ofsad and gloomyindulge in excesswarm and friendlydisregard; dismisspoverty; misfortunefleeting; vanishingextreme exaggerationmeager; insufficientgreediness for wealthhighly skilled artistnot easily understoodold-fashioned; obsoletetending to evade captureassertion or confirmation...

Haunt Word Search 2025-03-12

126 Items: BatCatBooRedRunFlyOwlOrbZapMothFallBinxStabGutsDarkRainWalkDeadMazeCornJumpScarGoatRoseLambMoonWolfEvilFireFallWandCrowRopeHowlCastHauntHouseWitchSalemBlackGhostGhoulMagicCandyAppleCiderCrispMyersKnifeBloodScaryStoneCloakDeathAngelDevilTarotSparkWingsDemonClownOuijaRavenSkullDonutSugarNightStarsFairyBonesTeethChainAlienBroomGreenStormReaperOrange...

christmas 2024-12-17

128 Items: JoyHamElfRedFunSnowSledStarSackCoalBellMaryNoelGoldHolyColdFireCozyMilkBarnOlafCupidCometVixenSantaElvesAngelJesusJollyMerryBuddyGiftsGreenWhiteMagicPartyCheerBibleDonnerDasherDancerSleighLightsChristChurchGrinchWinterJosephTurkeyStnickGivingFamilySilverEggnogUnwrapManjorPreachIcicleFrozenBlitzenPrancerRudolphSnowmanCookiesChimneyKrampusDiehard...

the pro heros of mha 2025-10-29

30 Items: retiredsexy herothe cowboythe gun herothe giant herothe crust herothe sonar herothe fiber herothe tiger herothe blood herothe smile herothe rabbit herosees the futurethe engien herothe cement herothe wooden herothe folding heroa rat hero thingshe hates midoyiathe telephic herothe fat quirk herothe lock hold herothe fire flame hero...

Within View 2025-11-08

131 Items: ALEBOGDEWFIRHENIVYINKNETOWLSAWWETAGEDBLEWBLOWBOLTBYRECHOPDALEDEERDRIPFIREFROGGATEGLENHEWNHUSHMESHMINTMOSSMUCKPATHPOURRESTROAMROPESEWNSHEDSTEWTOADWOLDWOODALDERALOFTAMBERAMBLEBIRCHBIRDSBOOTSBRIARCEDARDECAYDITCHFAYEDFIELDFOGGYGREENGULCHHONEYKNOTSLIGHTMAPLEMARSHMISTYOCHREQUAILQUIETQUILTREEDSSHEEPSHOESSLEEPSMOKESTEAMSTIHLSTONESTORMSWOOPTAWNYTREESUMBER...

The Great Big Search - Yr 8 2025-12-18

134 Items: GoldZincAtomIronMeltHeatFlowRateCoreRingFireLavaRockGroupWaterMetalLightSoundWasteWavesCellsHeartLungsNasalVilliSmallLargeCrustOuterInnerFieldScaleFocusVentsMagmaCyclePeriodSilverVolumeDiluteMatterSankeySystemSexualSeptumLarynxCavityPlasmaMantlePlatesElementMixtureProductMercuryDensityKineticElasticDiagramThermalNervousTendonsBronchiTracheaPharynx...

Deutsche Weihnachten 2024-12-06

50 Items: (snow)(star)(bells)(angel)(frost)(feast)(sleigh)(tinsel)(sweets)(candles)(incense)(snowman)(cinnamon)(fir tree)(presents)(reindeer)(Christmas)(ornaments)(fireplace)(mistletoe)(snowflake)(shepherds)(mulled wine)(gingerbread)(gift giving)(Santa Claus)(family time)(Christ child)(Advent wreath)(Christmas Eve)(Christmas joy)(Christmas tree)...

Abundance Word Search 2025-12-12

129 Items: OxDogFanPigRatRedCoinDrumFireFishGiftGoatGoldGongHomeJadeKnotLionMoonMythNianSilkBloomBrushCycleDanceDeityEarthFagaoFeastFruitHorseIngotLotusLuckyLunarMetalMoneyOperaPeonyQipaoSheepSnakeAngpaoBambooCustomCymbalDragonFamilyGingkoJujubeLegendLycheeMonkeyOrangeOrchidParadePeanutPomeloPrayerRabbitRitualScrollShrineSymbolBanquetCaishenCostumeCouplet...

Revison word search 2023-11-20

17 Items: Extremly largeAlot of soldiersSide of the faceA man made riverA young male chickenExtremly clever or smartTo agree to marry someoneA movement of part of the bodyUsed for joining the ends of a beltTo make waste into reusable materialThe hundredth anniversary of a eventteAn imaginary creature that can breathe fire...

TTS 8b kelompok damiral fajri 2025-09-15

10 Items: hutan apakah yang berfungsi sebagai pengendali erosiApa akibat Indonesia terletak di cincin api (ring of fire)Sebutkan satu contoh peninggalan kerajaan Hindu di Indonesia!berapakah derajat titik lintang paling selatan negara indonesiaapa sebutan indonesia pada saat terjadinya pengaruh hindu budha...

Disasters and Global Issues 2025-12-15

10 Items: The condition of being very poor.Being very overweight and unhealthy.Animals or plants that no longer exist.A long time with very little or no rain.A big fire that burns trees and forests.When oil leaks into the sea and pollutes the water.Animals or plants that may disappear in the future.The natural world around us, like air, land, and water....

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Kinaalda, Word Search 2024-04-10

2 Items: bee nalzhooh, be'azhoo', honeeshgish, kiinaalda, sweat ceremony, stirring sticks, gourd, ats'os, sandpainting, abani, nat'oh, yaateel, fire poker, beeshast'ogii bi'aadii, yellow cornmeal, naada'algai, white cornmeal, naada'atsoi, tsiitlool, hair tie...

Pirate Word Search 2025-02-11

10 Items: The leader of a ship or pirate crewValuable items like gold, jewels, and coinsA short, curved sword often used by piratesA disaster where a ship is destroyed or sunkA person who attacks ships at sea for treasureA large, heavy weapon used on ships to fire projectilesThe traditional pirate flag with a skull and crossbones...

To Town 2026-03-10

10 Items: An old-fashioned car.Another word for lorry.A jumping toy, not a vehicle.Another word for large: b _ _.The title of the book is 'To ______'.The colour of a sunflower: y _ _ _ _ w.A flying vehicle that has spinning blades or rotors.A truck that has a long ladder and water hose to put out fire....

Colors 2024-07-19

10 Items: "The darkest color, like the night sky.""The color of grass and leaves on trees.""The color of the sun and a ripe banana.""The lightest color, like fresh snow or milk.""A color resembling that of wood or chocolate.""The color of ripe strawberries and fire trucks.""A light shade of red, like the color of a rose."...

Vocab - JKL Words 2025-11-04

13 Items: An expression of pure joyA tear or cut of the skinTo pose a threat or danger toTo lose strength, life or forceMaterial easily burned for starting a fireSomething bought/saved for sentimental valueDone excessively or extravagantly (over the top)To defend, explain or make an excuse by reasoningSuspicious of or lacking trust of something/someone...

5BG summer social - find that country! 2024-07-03

17 Items: Land of Rising SunCountry's name ends in QLargest producer of coffeeLargest producer of vanillaCountry that has 26 cantonsCountry with the most islandsThe most populated EU countryCountry formerly known as LusitaniaCountry that has a non-rectangular flagCountry known as the Land of Fire and IceCountry that has a flag with a dragon on it...

Ant Word Search 2023-02-03

136 Items: antagoapearearmatebaraweaptawaybabybackbandbarkblowbothburncanecarecasecashchipcoatcomecookdashdimedonedripfindfinefirefiveformgrewhavebulbcopyalasauntbaldbeetbindblueboatbondboombossbragappleblinkbrownbunnyburstcandyclassfreshglassgradehandsfableabuseagentannoybroilchalkcrowddailypearlaboveaheadamberangerapartbadlybeastbeganbelowblankblushbones...

ie 2025-04-17

15 Items: That ________________ stole my purse!Can we fish off of the ________________?Would you like a ________________ of cake?The corn ________________ is up to my knees!My brother's daughter is my ________________.I know you can do it! I __________________ in you!I would like a four ________________ wedding cake....

SPACE & ENGINEERING 2025-11-30

15 Items: Earth is one of these.a path electricity travels on.a person who travels into space.the part that makes machines go.what the moon does around Earth.you need me to fix or make things.the giant dark place above our sky.a machine that can follow commands.when a rocket lifts off the ground.I glow at night and change my shape....

Most Common Words That Start With F 2025-05-02

142 Items: fanfarfatfeefewfitfixflyforfunfacefactfadefailfairfallfarmfastfatefearfeedfeelfilefillfilmfindfinefirefirmfishfiveflagflatfleeflowfolkfoodfootformfourfreefromfuelfullfundfaithfalsefaultfavorfencefewerfiberfieldfifthfiftyfightfinalfirstflamefleshfloatfloorfocusforceforthfoundframefreshfrontfruitfullyfunnyfabricfactorfairlyfamilyfamousfarmerfather...

these letters carry scent 2026-01-13

50 Items: steelOzonecherryleatherpopcornmagnoliaVHS-tapeOld-coinspaperbacksEucalyptusHotel-soapChalk-dustdragonfruitOrange-peelHoneysuckleFresh-breadorchidflowerSea-salt-airSnow-on-woolcandle-smokepumpkin-seedstomato-leavesMelted-butterIncense-smokePrinter-tonerdark-chocolatea-drop-of-bloodLavender-fieldsSun-warmed-skinNew-electronicssugared-violets...

Big Bull Gets Bored 2023-08-30

8 Items: Fire Fighter: the people who put out firesBull: A male cow is called a ______________Fence: Something built to separate land into partsSplat: The sound made when something hits the groundEscalator: Electric stairs that carry you up and downBored: The feeling you get when you have nothing to do...

Greek Generations 2025-11-21

42 Items: God of war.God of wine.God of light.God of the SunGod of the sea.The god of sleep.Goddess of the MoonThe goddess of night.Goddess of the hearthMessenger of the gods.The goddess of the day.Goddess of the harvest.Goddess of fresh water.King of the gods and sky.God of fire and the forge.Goddess of love and beauty.The personification of death...

Takesix Word Search 2024-02-24

11 Items: Ra: The Egyptian ___ god.The crystal of true love.Hades' sacred counterpart.The state where I regrettably live.This last name is sitar-playing royalty!The ancient African kingdom south of the Nile.This cane-carrying rogue kept Joni's camera to sell.This black male acapella group's name plays on a Dave Brubek hit...

Homograph 2025-09-04

20 Items: A season / To jump upNot heavy / BrightnessTo guide / A heavy metalLine of seats / To argueTo bend / Used with arrowsA small clock / To look atDrop from the eye / To ripGreen area / Place your carA container / To be able toA stage drama / To have funA bird / To bend down quicklyHealthy / A deep hole for waterA game / Something to light fire...

Fahrenheit 451 Part 1 2026-01-15

20 Items: Montag’s wifethe fire chiefthe author of the novelwhat “they” call Clarissethe protagonist of the novelwhere Montag hides his bookssmells like perfume to Montaghow old Clarisse claims to bethe earbud radios Mildred usesthe young neighbor Montag meetsClarisse asks Montag if he is thiswhat Mildred claims killed Clarisse...

Pikmin Word Search 2024-07-08

20 Items: Final boss in Pikmin 3A game mode in Pikmin 3Resistant to fire PikminSmall plant-like creaturesCan breathe underwater PikminCollectible items in Pikmin 2Collectible items in Pikmin 3Olimar's co-worker in Pikmin 2Common enemy in the Pikmin seriesSpaceship-like storage for PikminFood source for Pikmin to multiplyAn in-game encyclopedia in Pikmin 2...

smells like 2026-01-12

50 Items: steelOzonecherryleatherpopcornmagnoliaVHS-tapeold-booksOld-coinsEucalyptusHotel-soapChalk-dustdragonfruitOrange-peelHoneysuckleFresh-breadorchidflowerWarm-vanillaSea-salt-airSnow-on-woolcandle-smokepumpkin-seedstomato-leavesMelted-butterIncense-smokePrinter-tonerdark-chocolateOld-paperbacksa-drop-of-bloodLavender-fieldsSun-warmed-skin...

GREEK generations 2025-11-21

41 Items: God of war.God of wine.God of light.God of the SunGod of the sea.The god of sleep.Goddess of the MoonThe goddess of night.Goddess of the hearthMessenger of the gods.The goddess of the day.Goddess of the harvest.Goddess of fresh water.God of fire and the forge.Goddess of love and beauty.The personification of deathThe primordial god of the sea....

English Derivatives from Latin 2025-02-04

12 Items: this person works on your 'dentes'a place where you 'listen' (audire)this device calculates (putare) informationthis professional is very 'learned' (doctus)this vessel, from 'urna', usually holds ashesthis 'writing' (from 'scribere') appears 'on' monumentsthis word, from 'manus' (hand), describes physical labor...

Panhandle Press Wordsearch 2025-12-19

19 Items: Billie Jo's brotherma died because of a...Billie jo's favorite hobbywhere the animals are keptBillie Jo threw a pail of...Billie Jo's father's professionthe state where Billie Jo livesBillie Jo's father's girlfriendthe first name of Billie jo's mathe crop Billie jo's father growstime when the economy was very badthe first name of Billie Jo's father...

Grohl Word Search 2023-12-11

10 Items: Known for his work with Nirvana and Foo Fighters.Renowned for his drumming with The White Stripes.Famous for his precision with Pearl Jam and Soundgarden.Known for his energetic drumming with Queens of the Stone Age.Drummer for The Killers, contributing to their distinctive sound.Percussionist for Arcade Fire, with a dynamic and eclectic style....

Snow Word Search 2025-11-01

10 Items: - A small vehicle used to slide on snow.- Frozen water that is hard and slippery.- A thick piece of clothing worn to keep warm.- The low temperature that makes you feel chilly.- A long cloth worn around the neck to stay warm.- When something turns to ice because of the cold.- Clothing for your hands to protect them from the cold....

Avatar: The Last Airbender S1E1 2023-03-10

14 Items: kind of scaryto be very carefulto be very, very weta synonym for flyingthe ability to control airthe ability to control firethe ability to control waterrefers to your arms and legsanother expression to say stupid or dumbto make a mess of things and do things wrongthings you have to do in your house, like cleaning...

American Holidays Vocabulary 2024-02-21

12 Items: freedom____________to work____________a gathering of people to have fun_________a day celebrating a famous person or event ________a person who has spent time in the military________respect that is given to someone who is admired ___________to do something special for an important event________________...

Brian's Winter Word search! 2024-04-26

12 Items: to light something on fireto drool saliva while eating something.a piece of ground rising on a marsh area.a person that opposes an enemy or opponentsomething that you need to survive in life.to close something very tightly and securely.stripped leather that can be used as material.sealed enough so that air cant escape or get in....

Bamidbar 2024-06-01

14 Items: “Kohen”Firstborn of Leah“In the wilderness”“the one who counts”Dan and Naphtali were sons of _______.This functioned as a portable Mt. SinaiA priest must be descended from ______.They died for offering unauthorized fire before HaShemThe Torah calls the armies of Israel “_____”. Numbers 1:3These were set apart to protect and maintain the Sanctuary....

Top Inventions of All Time 2025-12-11

18 Items: wireless internet_______________created by Thomas Edison_______________home of some stranger things_______________makes up roads and sidewalks_______________probably created by a caveman_______________add or subtract with this tool_______________sail the 7 seas on this vessel__________________invented by Alexander Graham Bell_______________...

Roman Mystery Religions 2026-03-08

15 Items: The cave like templesThe consort of Magna MaterThe other name of Magna MaterThis emperor legalised ChristianityThis goddess was imported from EgyptMithraism had this type of structureAn ancient religion practiced in JudeaThis drunken cult was outlawed in 186bcA new religion, founded by a ‘criminal’A reason to ban Christianity due to miracles...

Property & Commercial Insurance Terms 2022-07-06

20 Items: rateperilbaileehazardpremiumrobberyindemnifyvandalismThe chance of lossThe date on which a policy endsLegally binding contract of insuranceA request by an insured for insuranceA person entrusting goods to another.Risks, perils or properties defined in the policy as not covered...

spelling words + a lot extra 2024-05-01

35 Items: trulySciencesuggestsectionsuggestzygardeumbrellauniversecapybaragreninjasuccessfulsufficientexperiencechesnaughtunfortunatelyaka cave gamehe never diesaka dancy duckSerena mega monthey ARE stellarteam flare leadergotta catch em allaka con artist catthe capitalism ratthe most popular gimmickaka da clutch #2 clutcherthe poor prey of shiny hunters...

The Hunger Games Series 2025-04-01

146 Items: AXEBOWHOBPINRUESIDAVOXCATOCHAFCOALCOINDOVEFIREGALEGOATGRAYLAKELUCYMAGSODDSSEAMSEAMSHOWSNOWSTEWTOWNTOWNTRAPANNIEARENABAIRDCINNACLOCKCLOVECOVEYDRONEEFFIEFEASTFENCEGAMESGEESEGRAINMADGEPANEMPEARLPEETAQUELLRAVENROSESSCORETOKENVITUSWYATTAMPERTANTHEMBAKERYBALLADBEETEEBRUTUSESCAPEFORESTHUNGERLENORELUMBERLUXURYMARVELMININGPOISONPORTIASNAKESTHRESHTIGRIS...

Ten Codes 2025-09-19

48 Items: 10-6010-6110-6210-6310-6410-6510-6610-6710-6810-6910-7010-7110-7210-7310-7410-7510-7610-7710-7810-7910-8010-8110-8210-8310-8410-8510-8610-8710-8810-8910-9010-9110-9210-9310-9410-9510-9610-9710-9810-9910-10010-10210-10310-10410-10510-10610-10710-109

Artic Word Search 2025-11-04

150 Items: capfogiceicylognaprawskicoatcoldfiregalegustheatlugemeltsledsnowthawwindwoolArticAngelberetbleakbootsbriskchillcoughduvetharshparkapolarquiltscarfskatesleetslushsnowysocksstormstovewindybitingchillschillycocoondraftydrearyeggnogfleecefrigidfrostyfrozenglovesheaterhockeyhoodieicecapicedamicicleJacketshiversledgesneezewinterwintryblanketchimney...