fast food Word Searches

Search 2024-08-11

14 Items: Bride's jobGroom's phobiaGroom's eye colourBride's maiden nameMonth they first metGroom's mother's nameTheir first date foodMonth they got engagedCity the groom is fromBride's first middle nameBrides second middle nameBreed of the couples dogsNumber of Bride's siblingsPlace the couple had their first holiday together

My house 2025-05-12

11 Items: we COOK herewe sit ON thiswe WATCH TV herewe GO TO PEE herewe WASH hands herewe sit AROUND thiswe RIDE a BIKE herewe GO TO SLEEP herewe PUT FOOD ON thiswe EAT a cake WITH thiswe put on our SHOES here

KG's Christmas Word Search 2022-12-18

11 Items: Where Jesus was bornThe number of wise menPole Where Santa LivesFood eaten at ChristmasA jaggy Christmas plantSend these at ChristmasThe day before ChristmasUsed to decorate the treeUse a carrot for his noseYou pull this at ChristmasThis is hung up by the fireplace

Wedding Word Search 2025-01-05

6 Items: Who confessed first?What is Mega's favourite food?Where did Mega and Vernice meet?What is Vernice's favourite colour?Where is Mega's home city in India?Which month did Mega and Vernice register their marriage?

Our Family 2025-05-07

11 Items: the bankerthe youngest memberthe girl who does artisitc skatingthe funny grandfather and sports loverthe man who knows so much about historythe female business owner and animal loverthe hockey and softball player, golfer toothe boy who runs really fast and is strongthe girl who loves kindergarten and animals...

Our Family 2025-05-07

11 Items: the bankerthe youngest memberthe girl who does artisitc skatingthe business owner and animal loverthe funny grandfather and sports loverthe man who knows so much about historythe hockey and softball player, golfer toothe boy who runs really fast and is strongthe girl who loves kindergarten and animals...

Romeo and Juliet - Key Quotes 2024-10-11

8 Items: A _____on both your housesDeny thy _____ and refuse thy nameIt is the east, and Juliet is the ___O serpent heart, hid with ________ face______ and slow, they stumble that run fast.Then have my lips, the ___ that they have took.If love be _____ with you, you be _____ with loveTake thou this vial, being then in bed, and this distilled liquor _____

Unbreakable Betty Blue 2025-12-19

10 Items: a quiet or small laughhow fast something is movingfeeling uncomfortable or ashameda crash where two things hit each othera contest held to decide the best competitorsomething that represents an idea or meaningsuddenly changed direction to avoid somethingfair and respectful behavior during a competition...

Royal Hobart Regatta 2024-02-12

17 Items: FoodIt startedVisitor 2024Up in the skyCarnival rideCost to get inOut on the riverRoyalty was hereOn the water scoutsNavy representationIn the sky at nightWhere the regatta isPresented to the winnerSwimming across the riverSlide for this novel eventTraining to be in the NavyYou need oars for this sport

Chep & Raquel 2025-01-24

17 Items: Groom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's birthday monthGroom's favorite flavorCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

Wake Word Search 2025-07-30

8 Items: to put on clothesto clean teeth or hairto move using your feetto chew and swallow foodto put things into a bagto clean something with waterto rest with your eyes closedto stop sleeping and open your eyes

Ecosystem word search 2026-02-25

19 Items: only eat other animalscan absorb light energyare comprised of plant-eating organismshave light-harvesting cellular structuresfeed on dead plants and other animal matterspecifically fragment to consume their foodare found at the base of an ecological pyramiddo not have the ability to produce organic mater...

Mom’s Birthday Search 2025-07-14

15 Items: The Car‘s NameThe bike‘s nameMom‘s first NameMom‘s zodiac signMom‘s favorite colorMom‘s birthday monthName of our former catHow Mom likes her foodMom‘s favorite cocktailWhat Mom needs to sleepMom‘s favorite dog breedMom’s favorite instrumentWhat Mom loves to collectMom‘s favorite nickname for meMom‘s favorite type of vacation

Wanted to lift your mood ❤️ 2026-01-27

15 Items: YouYou are ….My fav FoodYou look ….Head to toeI NEED YOURI need my … backYou Make me feel …I can’t wait to ….Gonna hold those ….Gonna give you hellaGonna do this a lotttttJaw Gonna make you laughCan’t wait to give your back someGonna do this to you (release the …) ahaha

Food that's notorious for making people do smelly farts 2023-08-26

10 Items: eggsbeansonionleeksgarlicchickencabbagesproutsbroccolicauliflower

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Montse & Paul 2026-02-03

13 Items: Our cityOur tv showMy fav dishMy fav colorYour fav HP movieYour fav car brandYour fav car colorYour fav videogameYour fav supermarketThe street name we metThe food type of the place we metThe place we kissed for the first timeThe snack we always eat while watching smthing

Unit 10 Vocabulary 2026-01-23

12 Items: easily moved or carriedHaving to do with sight or seeinga ruler or leader who has total poweran animal hunted as food by another animala severe shortage of food over a large areato open up, make or grow larger; to developeasily broken, snapped, or cracked; not flexibleto do away completely with something; to put an end to...

Vocabulary Puzzles 2024-04-26

14 Items: a short crya faint cryan evergreen busha force against youtired and exhaustedfighting or arguing noisilythe feeling of regret sadnessmove swiftly and fast smoothlyvery quiet barely hearing the sounda quiet and soft speech of somethinga land outside of the main part of landNot being able to tell what's happening next...

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Theme 4 complete 2021-04-21

119 Items: ofinfordrypawbitecagecutefastkeepleafmeatsoftwildlakelionbirdcarechewduckfishjumpluckmalemesspondrideskintakeparttameareabusyheropoorrichroseboneflatsafestartownfurryheavysharphorsemouseoceansnaketigergooseshinsstuffspotswingsenemyexistmarrymerryriversandystealtulipadultdustyskullsmalltowertrackhillyquietanimalarriveplentyspinesjunglemonkeyparrot...

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

TTS WS-1 CPRO 2024-05-23

19 Items: Desktop RAMNotebook RAMStorage DeviceStorage DeviceTells Hardware What To DoSends Signals To ComputerThe "brain" of a computerDrive has no moving partsSends Signals From ComputerSoftware needed to run hardwareDisk Drive that has moving partsSoftware embedded on hardware chipIs A Paper-Weight without SoftwareAdvancement over the traditional BIOS...

Christmas 2024-12-17

20 Items: FAT25thred nosegoes on treeif your niceWhite powderred and whitemakes presentsif your naughtyreindeer eat itsteals Christmaswhere presents gowhere Santa livesflies Santas sleighbest Christmas foodyou give it to Santadespises milk torturehung by the fire until deadbecause your parents hate youhe “may” of be born on this day

Cabin Crew Word Search 2026-02-05

85 Items: IceBearBgsuFoodHikeKotaLexiLimoMarcMikeNapsPoolSnowCabinChipsDarlaEmilyFloatGamesGroneHeidiKevinMagicMusicQuinnRustySillySonnyCheersCheeseChillyCoffeeDallasDuckysGenevaGuitarHottubKraskaLightsPranksSnacksSweatsTubingBoatingBowlingDancingElmesonHotseatMohicanOutingsPajamasShotskiBobevansCanoeingConcertsDrugmartFireballFoosballIcechestLaughter...

Year 1 to Year 3 Food 2024-12-03

5 Items: milkriceapplebreadseafood

Mark Word Search 2024-04-16

2 Items: My favorite foodMy favorite video game

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

HAVI | Halal, Food Safety and Quality 2025 - Keys to Safety: Word Hunt 🔍 2025-10-14

35 Items: FEFOHAVIVIVIANHAZARDHYGIENEFREIGHTTHAWINGBACTERIACATELLAEFORKLIFTQUANTITYTOYYIBANALLERGENDELIVERYCONTAINERHARRIETTELOGISTICSCROSSDOCKRECEIVINGREPACKINGINVENTORYINSPECTIONMCCORNMICKPRIMABAGUZMONITORINGCOCKROACHESSUPPLYCHAINTHERMOMETERTEMPERATURECALIBRATIONCOLDSTORAGEPALLETIZINGPROCUREMENTTRACEABILITYDISTRIBUTION

school 2022-12-07

13 Items: the schoolto write withto carry thingsto distract yousomthing you taketo train your brainsomething to gut withsomthing you cant getsomthing you use to readsomwere to get books fromsomthing to delete your mistakessome thing to exersice your brainsomthing you use to draw or write with

Healthy and Unhealthy Foods 2025-10-12

9 Items: I am brain food.I give you energyI keep you fresh.It has too much sugar.I am good for your eyes.I make your bone strong.Crunchy but not healthy.I'm sweet but bad for your teeth.I'm tasty, but I'm not your best friend.

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

WEDDING WORD SEARCH 2025-05-20

84 Items: DJMAYIDOFUNERICLACEVEILHAIRSUITVOWSOATHLOVEWIFEFOODCAKEPOOSBRIDESTEVEGROOMDRESSTRAINAISLERINGSTRUSTHONORGAMESPARTYTOASTDANCEMIAMIZAYDAMAKEUPTUXEDOBOWTIEALWAYSCHEERSFAMILYSPOUSECRUISEHEAVENWEDDINGJESSICAVANESSABESTMANBOUQUETPROMISECHERISHFOREVERHUSBANDALCOHOLFLOWERSFRIENDSMARRIAGECEREMONYETERNITYPICTURESMARIACHICATERINGCONVERSELAUGHTERMEMORIES...

maya 2025-05-25

26 Items: Lil BroCATNAMEfav foodskin inkHOSTnameLil sistaCLUB prezpays $ herMIDdle nameLang SpokenLCHS mascotFav flower?CAR nicknameLang SpokenIICLUB SecretaryFAV StimulusDaylast song recitalnickname from dadMetropolis VISITEDYellow + Blue= FavMiddle school years @Nickname for grandmotherNickname for GRANDFATHERLearning Institution grad...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Penny Word Search 2025-12-18

18 Items: BabyOne cent coinA sweet treatEating outsideSinging snowmanAttractive metalSnakes and lizardsAntonym of outsideSmall hopping animalNot pay attention toBlood-sucking monsterRun away and get freeAnother word for a bugBreakfast food with syrupSmile to show this feelingSmall hopping animal, again!Sport with a fuzzy, yellow ball...

ie Wordsearch 2025-07-23

10 Items: I am potato fried.The bird ______ with wings.The _________ are like a cop.She _________ her shoe laces.The baby ___________ for food.He ________ the new ice cream.The apple _________ was sweet.You roll this in ludo to play.The clothes outside are _______?What happens when you put nuggets in hot oil?

Unit 2 Week 1 Vocabulary Review 2025-09-29

10 Items: very easily brokenset of connected thingscategorized or grouped withget, take, or obtain (have)shape or outline of something;enough for a particular purposesomeone or something that protectsan animal hunted by others for foodshort, stiff hair of an animal or plantstay alive; live through a dangerous events

Matthew's Suffix wordsearch 2025-10-07

10 Items: Someone who makes food.People who shear sheep.People who support someone.Someone who hikes on trails.Someone who tortures people.A type of common eating fish.Someone who runs a Management.Someone who kills lots of people.An entertainer in a medieval king's courtA Christmas ornament used to break nut shells.

All About Mr. Ross 2025-08-22

18 Items: My CollegeMy Son's NameMy Food AllergyMy Hidden TalentMy Favorite ColorMy Childhood FearMy Daughter's NameMy Favorite SeasonMy Hogwart's HouseMy College ActivityMy Favorite DessertMy Favorite Thing on TVMy Favorite Sport's TeamMy Favorite Game to PlayMy Favorite Kind of BookMy Favorite Sport to PlayMy Favorite Thing To Drink...

SP2 L2, Comparaciones y Verbos 2024-01-03

25 Items: bestsnackworstto dieas...asto tasteto servelike; asto choosemore...thanless...thanto recommendthe most (m)the most (f)the best (m)the best (f)to taste likethe worst (m)the worst (f)to order (food)the youngest (m)the youngest (f)as much/many...asmore than (number)fewer than (number)

Thanksgiving 2025-10-10

86 Items: HamPieRestFoodOvenMilkSnowColdMealMeatHomeFullTastyBeansSleepCreamSugarJuiceGamesJokesHappyBreadGravyRoastRollsSauceFeastFamilyTurkeyMoviesTravelParadeNapkinDishesPlatesLeavesApplesPrayerAutumnDinnerSquashEatingCorncobOrangesCookingHolidayKitchenPopcornCookiesFriendsGibletsHarvestTogetherStuffingFootballPotatoesThankfulPilgrimsShoppingCrockpot...

Vocab List 3A 2023-12-05

32 Items: TeaMilkWithWaterNeverRightCheeseCoffeeTo EatAlwaysI LoveI LikeWithoutLemonadeIced TeaTo DrinkTo ShareEverydayYou LoveYou LikeOf CourseHow AwfulSoft DrinkFood, MealApple JuiceWhich, WhatOrange JuiceMore or LessTo UnderstandVegetable SoupDrink, BeverageHam And Cheese Sandwich

Day of the Dead Spanish Vocabulary 2025-11-10

31 Items: tombmaskarchsaltfoodangelbibleskullcrossaltarwaterfruitflowerscandlesincensemarigoldskeletonofferingdead breadsugar skullsspirit guidespicture/photoflower petalsday of the deadcoffin or casketwhimsical skeletondecorated cut papermonarch butterfliescemetery or graveyardface of day of the deadday of the little angels

E2 C1 2024-09-04

30 Items: foodweekmusicMondayFridaySundayTuesdayto makeusuallyweekendThursdaySaturdaytomorroweverydayWednesdayyesterdaylast yearI'm sorrylast, pastuntil(time)from (time)this, comingThat's rightto play gamesto take a walk좋아요! All good!to listen, to hearto surf the internet요일이에요? What day is it?요일 what day of the week

Ꮷꮃꮝꭹ Word Search 2025-06-06

38 Items: potpanjaricetealidforkfoodbowlknifestovetongsflamemixerplatespoonshelfchairwaterembersfridgedrinkscoffeeladderspatulacup/mugcabinetcounterfreezerdrawersglass/cuptrash bagkitchen sinksliced breadcutting boardᎦᏟᏗ trash canᎦᏍᎩᎶ kitchen tablesmall ladder/step ladder

Christmas 2025 2025-12-24

84 Items: BenIkeDreChadWillTitoLukeFarmcowsBlueGarybowsfoodpiescornEmilyAidenHayesMilouPoppyBriarLillysantagiftsTexascandyMusicchipsLaurenAudreyNonnieLouLouLaineyGarnerRuthieAmandaLouannaggiesEggnogribbonfamilysweetscheeseLoreleiGrandadBarbarabrisketfriendsnotcoldtugowarornamentstockingnewyearsDecemberdessertsdiamondgsweetteanoturkeyUncledrewChristmas...

Rollercoaster search 2025-04-17

10 Items: A push or pullEnergy stored in an objectTo speed up in any directionEnergy of an object in motionHow fast an object is travelingA force that slows a objects movementGravity inflicted on any object at any timeThe speed of an object in any given directionA force exerted on an object by the Earth's gravity...

The Marshmallow and The Coolest Kid 2026-01-16

10 Items: exactness and accuracyvery frightened, as if frozento lift or raise something upextremely embarrassed or ashamedto run very fast for a short distancethe outline of buildings or land against the skyto scold or speak to someone with mild disapprovalcalm self-control, especially in a stressful situation...

Nutrition 2026-02-19

10 Items: lack of nutrients in dietsevere shortage of proteinslack of balance in the dietexcessive nutrients in dietPEM , chronic wasting away of fatbacteria causing diarrhea, sounds like a fishfast bowel movements, can be a sign of infectionpoor bowel movement due to lack of fibre and watereating disorder characterised by binging and purging...

5th day halool 2025-04-29

6 Items: food type you lovea city gathered youattribute in her ( she always help you)nice place you’ve been to together in jordansomething you learned together during university (work)relationship for years - (sisterhood/ work colleagues/ .. etc.)

Halloween/Fall Word Search 2025-09-24

7 Items: white/clear scary creaturea part of the body, a bonenature thing that's on treesActivity you do on Halloweenholiday where you get to dress upfood item commonly flavored in fall drinksBird commonly associated with fall/Halloween

Autumn Word Search 2025-11-24

11 Items: YummyFalls off treesAnother word for AutumnThe 11th month of the yearA sauce that goes on turkeyPopular Thanksgiving side dishMost popular food for ThanksgivingMost popular dessert for ThanksgivingHoliday where you express your gratitudeDecoration for holloween, also a pie ingredientType of nuts most commonly associated with Autumn

Search the words related to food 2022-12-20

5 Items: fishricesoupmilkdates

trs23 ver2 u9 2022-11-04

8 Items: baby cata big plantput ice cream in itwhen your body feels badsmall amount of food to eatit's green and lives near waterlives in the ground, birds eat itwhat we say when a question is easy to answer

Connect Word Search 2025-09-09

10 Items: Too much energyAll the same kindAn exaggerated statementTo join two things togetherCommunicating without wordsMade of different parts or kindsWriting that is true, not made upOrganism that eats others for foodPerson who leads an orchestra or trainWords that sound alike but mean different things

Most difficult animal word search 2026-02-20

100 Items: a wild piga male ducksmall horsea female ducka large mousea large rabbitthe death mothavian creaturescovered in woolsimilar to sheeppink farm animalplural for mouseMan's best friendthin and slitherya "paradise bird"has three stomachsMan's feline friendlargest land animalfast mounted animalclose to an ostrichwild and aggressiveAmericas iconic bird...

Eukaryote Word Search 2025-03-24

14 Items: organisms made up of many cellsorganisms made of only one cellTiny, hairlike parts that help a protist move.Paramecium is a unicellular ciliated protozoan.A long, hairlike part that protists use to move.protist that moves by a flagellum, known for its eyespot.A cell that contains a nucleus and membrane bound organelles...

Valentine's Puzzle 2026-01-24

10 Items: Your favorite foodYour favorite drinkWhat do I call you?Your favorite animalYour favorite flowerYou love these with buldakA place where you fought a warA place we shared many glances everydayYour answer to "Will you be my Valentine"The month we first met in the train tracks

Roller coaster 2025-04-17

11 Items: gravityany push or pullgravitationconstanthow fast something movesa force that draws to eachotherThe energy of an object in motionThe force exerted on an object by the Earth'sThe energy stored by an object ready to be usedA force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels...

feqn fkjq 2025-04-11

2 Items: "caught.""mystery", "abuse", "blackmail", "food", "youtube", "awareness", "tzuyang", "reality"

UTB Winter Wordsearch - Just for Fun 2025-11-17

13 Items: UTB Bottom ReserveWinter fireside mothNot scarce seasonal UmberNative anglewing butterflySaid no to one of our BluesRarest of our native WhitesBeauty from a London suburb?Doesn't sound like a fast CarpetThe Earth and the Moon share this moth's nameLarge or Small... or maybe named after a countyHibernator from a different family to the others...

7th grade Landon 2024-05-15

15 Items: waterenergypumps bloodbone in forearmfights infectionmakes plants greenholds the cells dnahow plants make food4 sections in the heartwhen water turns into a gasmakes up most of the atmospherelooks like cotton candy in the skythin walls that blood travels throughdeoxygenated blood travels through thistakes one minute to travel through the body

Date Day 2025-09-08

15 Items: Winter sportFemale cowboyComes after 6Favorite FoodOur youngest dogWhat do horses eatMonth you were bornFavorite summer sportMonth of our first dateTip of Baxter's tail is..Where are we going SaturdayLive music with lots of peopleIf you have no heart, you are..Years we've been together in JanuaryWhere is football played in Edmonton

The Main Shops 2023-05-27

7 Items: Where you store your FPDKeeping those pups cleanIf your dog is hungry, shop hereShopping for some training areas?Pick up the collars and leashes hereThe better alternative to your shoesOnly available if you’re past level 20

How well do you know us? 2025-10-20

12 Items: Melvin's CCA in JCJiamin’s favourite foodJiamin's favourite colourJiamin’s Major in UniversityLocation of their first datePre-wedding photoshoot countryAnime that Melvin still watchesMelvin's most listened Chinese singerJiamin attends these classes regularlyJiamin’s dream destination in AustraliaCountry that they went canyoneering together...

Drag Word Search 2024-09-27

11 Items: ENERGYWHAT WE ARE STUDYINGDRAG IS INCREASED BY AWHAT A PARACHUTE INCREASESSIMPLE AND COMPLEX __________A TASTY FOOD THAT BREAKS EASILYA SYSTEM OF PARTS WORKING TOGETHERKNOWLEDGE USED TO ASSIST EVERYDAY LIFEA TYPE OF ENGINEERING THAT REQUIRES GEARSA TYPE OF ENGINEERING THAT REQUIRES WIRESA TYPE OF ENGINEERING THAT REQUIRES BUILDINGS

Nutrition Unit 2024-12-16

11 Items: our fatsLack of Ironunsaturated fats -> saturatedthe starches and sugars in foodsticks to walls of arteries (bad)Indigestible complex carbohydratesAbsorbed, Transported, and Stored in FatSolid @ room temperature; risk of diseasesubstances from environment body cant makeDissolved in water and aren't stored in body...

Bed Word Search 2025-06-26

12 Items: The object where you sleep.An object where you can see yourself.The part of a house that you step on.An object that you use to iluminate darkness.A place where you can stand up and wash yourself.An object where you put your food to preserve it.The place of the house where you can cook your food....

A Word Search 2025-09-19

5 Items: move your body with musicyou can listen to and enjoy.food outside in a park or garden.look at words in a book or story.sport with a bat, a ball, and bases.

LOS QUEHACERES SOPA DE LETRAS 2024-02-29

17 Items: to cookto dustto vacuumto mow the lawnto make the bedto set the tableto do the laundryto sweep the floorto wash the dishesto clean the houseto clear the tableto iron the clothesto prepare the foodto take the trash outto dust the furnitureto get something dirtyto neaten; to straighten up

Sustainable Development Goals 2025-11-05

17 Items: People should have good jobs and fair pay.Protect the Earth by fighting climate change.Protect forests, animals, and plants on land.All people should have healthy food every day.Use and reuse things carefully to reduce waste.Keep the seas clean and protect marine animals.Everyone should have clean water and safe toilets....

Blue Word Search 2024-06-16

15 Items: love languagehow many kidsfavorite foodfavorite colormy biggest fearapology languagehow to keep trustmy five year planfavorite dead yearmy favorite part about youmy favorite memory with youhow can you better support mehow have you benefited my lifemy idea of a successful relationshipmy one non-breakable relationship rule for you

Trust God Instead of Complaining 2026-01-30

18 Items: catlionzebrahippoelephantMan's best friendGod’s chosen leaderDoing what God saysFood God sent from heavenWhat Moses struck in angerWhat God gave from the rockThankful for what God givesWaiting without complainingWhat God does for His peopleThe one we should always trustRelying on God instead of worryingBirds God provided for the people to eat...

Roblox Games Word Search 2024-02-26

30 Items: FPSTrainsR6 FPSMysteryFood SimSurvivalGraffiti... CreedBig HandsSpeed SimBig Hero 6Voice ChatRepetitionBad TeacherGun CampersRoblox MeccaStrength SimKill ZombiesFootball TeamClick to RaceTown Role-playUnlimited AmmoTable RouletteHere "Eye" ComeRoblox FortniteTown in WisconsinFairy Tale School25 Robux to AccessRoblox Phasmophobia...

Ashly OO 2024-05-09

20 Items: Tom’s eye colorTom’s star signAshley’s eye colorAshley’s star signFavorite gas stationTom’s favorite candyTom’s Favorite ColorTom’s favorite movieCouple's work industryAshley’s favorite candyAshley’s favorite ColorAshley’s favorite MovieTom’s favorite sports teamCouple's favorite TV seriesCouple's favorite board gameCouple's favorite restaurant...

Cat Word Search 2025-04-23

93 Items: meonupcatcardogyouourboymanmenmapdrywetbigredonetwosixprogodlionleftrocktheythemleftgirlballlockwordreadwallfoodbluegraydarkpinkgoldtimefoursickfarmnoobnosedumbcuteuglycarlshoedoorzebrahippohouserightclosewhiteblacktabelrightwomenwatermousecabelcleandirtyworldwritetoolsfloorphonelargebrownlightgreencrazyclockthreefriendbottomengineyellowpurple...

Wortsuchsel 7.2 2025-05-11

33 Items: sourfiberveganmousesaltysweetscreenbitteruniqueheartycrispydreamyProteinProteincrunchyto typearomaticgluten freeplant-basedunsweetenedto downloadlactose freelow in sugarsuitable forhigh in fiberhigh in proteinfood intolerancetender, delicatesource of proteintempting, enticingfine, fancy, refinedexquisite, magnificentto have a high ____content

INTRO and UNIT 1 OCTOBER 2025-10-08

20 Items: ViajeCollarEsquinaPulseraNubladoRotonda.PendientesParque infantilHacer ejercicioEn el extranjero.Plaza mayor (two words).A place where money is kept.You use it to cross a river.Hacer turismo / ver monumentosA place where products are made.The room where you have a shower.Patinaje sobre hielo (two words).To go for a walk in the mountains....

THANKSGIVING 2025-11-03

89 Items: FUNJAMTEDCODYCORNCOZYEMMAFALLFOODLOVENAPSOVENPIESSALTGAMESGRAVYHAPPYLAUGHPATTIPECANPEPSIROLLSSALADSALADSMILESTOVEWINDYAPPLESAPRONSAUTUMNBAKINGBUTTERCARSONCOLTERDINNERDRINKSEATINGFAMILYGOBBLELEAVESPARADEPEPPERSPICESTRAVELTURKEYWADDLEAMERICACARROTSCOOKINGDESSERTENGLANDFRIENDSGOBLETSNAPKINSNATIVESPUMPKINSQUANTOSTUFFEDCHERISSEFATPANTSFOOTBALLGRATEFUL...

The Hardest Burkina Faso Word Search In The World! 2025-11-21

88 Items: AidAidAridFoodWASHHandDamsNGOsHopeWellsPeacechangeHealthGenderUNICEFM.S.F.AccessPolicyFutureGlobalCrisisActionDroughtPovertyWeatherDiseaseCholeraTyphoidHygieneFundingStorageJusticeUrgencyScarcityRainfallConflictSurvivalAdvocacyDrillingSecurityCapacityTrainingProgressMortalityLivestockMigrationEducationSufferingResponsesTreatmentCommunityEmergency...

Big Soo Word Search 2026-01-25

89 Items: FUNTMAEATKFCIVYROBMACLIVFOODBOGOGOLFFREEDEALPLAYKINGSUZYLOCALVALUESHAREBONUSKRAFTBRYANANGIERILEYDARINBIGSOOWENDYSREDEEMCOUPONIMPACTSUBWAYDININGBUDGETRETAILTHRIFTGETNGOJAYDENSAVINGSCHARITYCARWASHVENDORSAUSTADSDOWNTOWNBARGAINSSAVERSOOCINNABONSERVICESBOUTIQUEGIVEBACKMINERVASPIZZAINNSHOPPINGBENIFITSVALHALLADUTCHESSROLLINPINFALLSPARKLEWISDRUGBROOKINGS...

Geology Word Search 2024-12-11

16 Items: Parent RockForm over warm waterFunnel-shaped vortex cloudFast moving volcanic mud flowMakes up most of earth's crustLarge cracks that form in rocksCool, strong outer layer of earthMagma becomes this after eruptionCompass direction of a rock layerOccurs when water dissolves mineralsphysical removal and transport of rocks...

Animals 2025-11-19

16 Items: — It can bark.— It has eight legs.— It can climb trees.— It has a hard shell.— It is long and thin.— It is black and white.— It has colorful wings.— It can swim very fast.— It is orange and black.— It is small and can hop.— It is strong and can roar.— It has a long colorful tail— It has soft fur and whiskers.— It is big and has a long nose....

About Jonathan 2025-01-06

15 Items: Favorite colorFavorite fruit.Favorite seasonThis is how old I amMy favorite Hoilday.My favorite sports team.This is what grade I'm inMy favorite movie about baseball.My favorite character from angry birds.My favorite sport. The field is a diamond.My favorite animal, I have one named Austin.My favorite show on nickelodeon about a sea creature....

Caracteristicas de objectos 2023-03-02

20 Items: a pillow issome meats getconcrete has to beif it's not full it'sif it's not clean it'sif it's not short it'sif it's not hot it's ...if it's not high it's ...if it's not cold it's ...if it's not true it's ...if it's not fast it's ...if it's not small it's ...if it's just made it's ...if it isn't empty it's ...the feeling of gravel is ......

Michelle and Dominic 2024-09-30

36 Items: Who is olderBride’s eye colorGroom’s eye colorWho is the best manBride’s birth monthGroom’s birth monthGroom’s middle nameBride’s middle nameGroom’s favorite foodBride’s favorite foodBride’s favorite movieGroom’s favorite movieBride’s favorite actorBride's favorite colorGroom’s favorite colorGroom’s drink of choiceBride’s drink of choice...

Chapter 8 The Flow of Food Preparation 2026-01-30

6 Items: cookingStorageVariableslackingMicrowaveSmallbatches

My House 2026-03-01

12 Items: An instrument used to measure and show the time.A device used to talk to people who are far away.An electrical device that blows hot air to dry hair.A motorized appliance used for cleaning clothes and linens.An electrical device that sucks up dust and dirt from floors.A small appliance that browns slices of bread using radiant heat....

1729 Word Search 2024-05-04

8 Items: {2^31} - 1Lysets hastighed i m/sAntal permutationer af en 2x2 Rubiks terningBoltzmanns konstant i 10^23 J/K til 6 decimaler$\sum_{n=1}^\infty \frac{1}{n^2}$ til 6 decimalerDen reciprokke finstrukturkonstant til 6 decimalerDet magiske tal (0x5F3759DF) i Quakes Fast Inverse square root algoritme...

Wake Word Search 2025-07-29

8 Items: to put on clothesto chew and swallow foodto put things into a bagto move by using your feetto clean your teeth or hairto rest with your eyes closedto stop sleeping and open your eyesto use water to make something clean

MI 2024-09-20

5 Items: Notify the nurse _____Do not give the person _____ or LiquidPatients describe MI's as a "sense of ____"A heart attack occurs when blood vessels are _____A Myocardial Infarction is also known as a _____ _____.

Writing 1 2022-11-01

21 Items: lay eggssays meowsays woofgives woolmakes milkuses a saddlesells you foodsells you foodhas a curly tailroars with a maneworks on the farmworks in a schoolis a famous pokemonlives in a pineapplewiggles on the groundmakes you feel betterhas feathers and fliesdrives a big red engineprotects your neighborhoodtakes care of you in hospital...

Anything 2023-05-01

90 Items: nobadputnotlothimcarnewmenratwhatnavybluedealleftshotkissnopehavebeencookbearfoodfacttimetextsoftcoolkidsrankkickcurbtreebabycribdarecashholegivekitehighshingirltherepeaceworldnightjuicerightchiefgrosssadlyblasthousemoneypitchfloorshifttodaycoffeecamerapleasechoicegigglediscusrecordsaddlebottomalwayscottoninlinepayinghandlebrokenscreamschoolcorrect...

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

WEDDING 2024-02-01

90 Items: joytiebeercakefoodjeepkisslovesuitveilvowswifewineblissbridedancedressgroommusicringstacostoastunionunityvenuecheersfamilyhikingpippinvikingbestmanbouquetcampingcandlescherishcookingcrochetdiamondflowersforeverfriendshibachihusbandpackerspromiseraleighromancetolkienweddingceremonycolumbiaeternitygreenbaylaughtermarriagemarylandmemoriessoulmate...

For Us, Living essentials 2025-05-14

98 Items: BedcarmopTeahomefoodpotspanssofaSoapFansragscombmugscoattapepensgluewaterstovebowlstablebroombrushRazorPhoneBroomknifebowlswhiskladleForksShoesleashPlatesbedingvacuumSafetyvacuumspoonsKettlePantrycoffeegloveshammerTreatspettagCollarpetbedsheltershampoodrawersComfortheatersCookingspatulaGlassesToasterBlenderpetFoodHarnesspetToysDishsoapbodywash...

Pobre Ana Ch 1 Vocab 2025-09-04

31 Items: newcookfoodmeatpoorbrownapplemoneynevershirtblondshoesI wantalwaysclotheshelp meto savebeautifula attendss/he takess/he wearss/he laughsfor permissionsuelo the floorshopping centercomas don't eat!pongas Don't put!s/he asks him/hers/he tells him/hers/he gives to him/hers/he gets good grades