fast food Word Searches

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

all about us/me :) 2022-11-26

15 Items: our songour doormy dream dogmy eye colourmy footy teammy middle namemy biggest fearmy dream holidaymy favourite foodmy favourite colourour first solo datemy favourite kissesdate we got togethermy favourite icecreamour favourite thing to do

Cardiovascular Systems 2025-11-24

9 Items: incision into a veinoriginating in the heartcondition of fast/rapid heart (rate)inflammation of the muscle of the heartabnormal reduction of (all) blood cellsabnormal reduction of white (blood) cellsabnormal reduction of (blood) clotting cellsPhysician who specializes and treats blood disorders...

№7 Investigate common geriatric health problems and aids 2025-11-27

15 Items: Mood disorderWeakened bonesAbility to moveReduced eyesightDanger of fallingPhysical stabilityHealthy food intakeHelps improve hearingMobility support deviceLoss of bladder controlRegular prescribed drugsProvides daily assistanceHeart/circulation measureMemory loss in older adultsJoint pain and inflammation

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

Characteristics of Living Things 2024-09-05

17 Items: Living things are ________________.Non-living things are _________________.Living things are made of _______________.All living things need ___________________.Living things respond to ______________________.Living things are called ______________________.Living things ________________, or change over time....

Biodiversity and Food Word Search 5/17/2021 2021-05-16

11 Items: fungimammalsprotistkingdomgeneticsConifersdiversitycommunityeubacteriavertebratesinvertebrates

Animals 2024-04-28

20 Items: MilkShellTrumpetSlitherRibbit...Feline friendFast boi lionUgly pink fishyMan's best friendKing of the jungleStriped black and whiteGoldilocks and the threeGray dog with sharp teethBaby _____ do do do do do doGigantic semi-aquatic creatureSlowest animal stereotypicallyGiant reptiles that went extinctThey have wide heads/eyes with no lids...

Review Unit 1 - Unit 8 2024-07-24

24 Items: long bank pinkhand tent beltspot swing swimtest stamp fastfish ship brushlamp paint campflag globe glassplay slide sleepdress truck treesmoke snake snowteeth think bathlunch watch catchdesk scale schoolorange giant cagejeans cheese legsblanket clock clubFriday green grassthat mother fatherrocket queen quiltdolphin whale whitesplint squid square...

Havo 1: Unit 3 2025-03-08

99 Items: MADCARCRYSADBIKECAKECITYFAREFASTFLATLIFTPOOLRIDERUDESAFESLOWSTOPTALLWAITWISHANGRYBOREDDELAYDRIVEFERRYFLOORFUNNYGUESTHOUSELIGHTLORRYPARTYPLANEPROUDSHOUTSMILESPACETIREDTOWERTRAINTRUCKBRIDGECANDLECINEMAHEIGHTINVITELONELYMUSEUMSCAREDSCREAMSUBWAYTICKETUNWRAPAIRPORTAMAZINGBICYCLECROWDEDCYCLINGFACTORYHOLIDAYJEALOUSJOURNEYLIBRARYPRESENTRAILWAYSTADIUM...

SIGHT WORDS 2025-08-14

98 Items: AMATBEDOHENOONORSOUSALLAREATEBUYBUTDIDEATGETITSNEWNOWOFFOUROUTRANSAWSAYSHESITTOOUSEWASWHOWHYYESBEENBESTBOTHCALLCAMECOLDDOESDONTFASTFIVEFOURGAVEGOESGOODHAVEINTOLIKEMADEMANYMUSTPULLREADRIDESINGSOONTELLTHATTHEYTHISUPONVERYWANTWASHWELLWENTWHATWILLWITHWISHWORKYOURBLACKBROWNFIRSTFOUNDGREENRIGHTSLEEPTHEIRTHESETHERETHOSEUNDERWHICHWHITEWOULDWRITEALWAYS...

what are these? are these...? 2024-01-13

22 Items: i'm/good.yes,/i/am.are/you/ok?is/he/weak?yes,/it/is.how/are/you/today?do/you/like/apples?is/the/turtle/slow?is/the/rabbit/slow?are/these/mushrooms?there/are/two/onions.yes,i/do./no,/i/don't.yes,/i/do./no,/i/don't.no,/it/isn't./it's/fast.do/you/have/highlighters?is/he/strong??yes,/he/is.how/many/onions/are/there?no,/he/isn't./he/is/strong....

1.3 Vocabulario 2025-01-28

47 Items: fatoldbigfuntallweakthinuglyfastslowbaldeyessickwellcalmlazyshortyoungsmallboredangrytiredfunnystrongskinnyprettyredheadexcitednervouspatienthandsomefriendlygeneroussociabletalentedbeautifullong hairsurprisedimpatientorganizedshort haircurly hairunfriendlyembarrassedinterestinghardworkingstraight hair

All About Animals 2025-11-11

20 Items: Jumps and croaksRoars in stripesHowls at the moonOinks on the farmKing of the jungleWoolly farm animalGiant ocean mammalLoyal household petGives milk and moosClever orange animalPurrs and chases miceHops and has long earsSlithers on the groundBird with sharp visionBig furry forest animalSmall and squeaky rodentHas horns and likes to climb...

General Words 2026-02-09

100 Items: BeDoEndGetLawLetSaySeeUseWayCopyFactFastFearFormFreeGiveGoodHaveIdeaLoveMakeMindNamePartSameSignSortTrueWalkWiseWordWorkCauseClearEventForceHappyLevelOrderPlaceRightSenseThingYieldZenitAmountBeliefChanceChangeCommonDegreeGovernInvestLivingMotionNationNormalNumberProperReasonSimpleCertainFeelingFictionGeneralHistoryNaturalObservеPurposeQuality...

Coles word search 2024-02-22

10 Items: relativesyou can readopen and closeto put togetherstuff that is ediblehigh body temperaturenot knowing where you aremonsters that will hunt youa system of letters/numbersa puzzle that moves in the ground

Potassium and Chloride 2025-01-11

10 Items: musclesheartbeatelectrolyteFood with 926mg of K_______ acid in the stomach.The state of being chloride deficient.The state of being potassium deficient.The anion that maintains fluid balance.The cation that maintains fluid balance.The organ that controls blood potassium.

9327 Rich Man and Lazarus 2024-03-06

10 Items: Animals that are often kept as pets.The name of the poor man in the story.Having a lot of money or valuable things.A door in a fence that you can go through.A big meal for celebrating, with lots of food.Small pieces of food that fall off when you eat.Painful spots on the skin that can be sick or hurt....

Divergent Word Search 2024-04-19

12 Items: Brides sororityGroom's eye colorYoungest cat's nameBride's middle nameBachelorette locationGroom's favorite foodBride's birthday monthBride's favorite holidayCouple's first movie dateBrand of the couple's trucksNumber of wedding venues visitedGroom played this sport in high school

Sprout 3 2024-02-13

10 Items: This egg is... (5 letters)Room where you cook food (7 letters)Thomas Edison invented this (9 letters)What you put food in to keep it cool (6 letters)What you sleep inside when you are camping (4 letters)Something that is 'U' shaped and attracts iron(6 letters)The object with 'North,' 'South,' 'East' and 'West' (7 letters)...

Acceleration Word Search 2025-10-05

6 Items: acceleration due to gravitychange in velocity/change in timeThe rate at which velocity changesshows how velocity is related to timewhen the only force acting on an object is gravityhow fast a velocity is changing at a specific instant

livs word search x 2025-09-28

7 Items: what's Liv’s dogs name?what's Liv’s zodiac sign?what's Liv’s biggest fear?whos Liv’s favourite person?what's Liv’s favourite hobby?where’s Liv’s favourite place?what's one thing Liv can't live without?

Summer 2013-04-30

73 Items: FUNFOODGOLFHEATJULYLAKEPOOLMELTWARMBEACHBUNNYGRASSHONEYCRUISEHIKINGPICNICSPORTSTENNISTRAVELBREEZECLOVERGARDENAIRPORTBOATINGCAMPINGCOOKOUTDRESSESHOLIDAYLEISUREDOGPARKPARTIESPLAYFULSAILINGSURFINGTOURISMWEATHERALFRESCODRINKINGEXERCISELAUGHTERMEMORIESOUTDOORSPOPSICLESLUSHIESSUNSHINESWIMMINGVACATIONBASEBALLADVENTUREFESTIVALSFIREFLIESFIREWORKSITINERARY...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

And Word Search 2025-05-19

74 Items: ifonofandoffmadsadfathatyouearonetwosiztenlikeyourhatelovesingquizwordfoodnoseearsopenshutnicemeannounverbfourfiveninekitesandtrackangryhatedlovedlikedwordstrickmouthcloseknifenightnounsverbsthreeseveneightfightmightsandygramsfriendpluralpuzzlesearchtrickyclosedmurderknightgrainsouncesfriendssinginggumballhundredmultiplesingularthousandadjective

random 2026-01-13

72 Items: cardogcatredbedtophisherfoodfeetbearlandsandgluebluepinkwoodleftyouracersavelamproadmakerstarspapersmartcrazyhandssnailwaterblockduckscolorgreenblackwhitesheetbooksrighttiredhappyenjoypuzzleschoolstupidbinderpersonmirrormyselfflowerpaintspurplelaptoppillowbottomscaredonlineanimalsmarkersreadingworriedwebsiteyourselfgroundedteachersstudentsheadlight...

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

Find the tastes & textures of food and drink 2025-10-19

10 Items: soursweetsaltyplainchewysavorybittercreamycrustycrunchy

CH9 - Ecosystems 2022-12-20

23 Items: A living thing.________________________An organism that can make its own food.________________________A nonliving part of an organism's habitat.________________________A living or once-living part of an organism's habitat.________________________All the members of one species living in the same area.________________________...

American slang words 2023-10-09

18 Items: FoodCrazyA carPoliceCowardJealousAmazingVery excitedSmall and cuteA smart personTo go to sleepStunned, shockedTo get what you wantAmazing, really goodA bad person, purchase, etcTo study hard before an examTo suddenly start ignoring someoneUsed to describe something boring or ordinary

LOL 2026-02-09

207 Items: godogeatendeyefarfewflyforgasgetgunguyguyhothowdealdeepdoordowndrawdropdrugeacheasteasyedgeelseeveneverfacefactfailfallfastfearfeelfillfilmfindfinefirefirmfishfivefoodfootformfourfreefromfullfundgamegirlgivegoalgoodgrowhairhalfhandhanghardhaveheadhearheathelpholdhomehopehourhugeideadeathdreamdriveearlyeightenjoyentereventeveryexistfieldfightfinal...

Macbeth Vocabulary 2023-03-16

20 Items: waitsmessengersto considerevil; wickedeasily perceivedfills with dismayconscience; moralsdrunken merrymakingextremely small in sizeextreme ill-will or spiteto adhere, clink, or stick fastthe murdering of one's parent(s)adherence to a strict moral codespecial honor expressed publiclyinduced to commit an unlawful act...

Medical Terminology Word Parts - Prefixes - Roots - Suffixes 2024-10-25

41 Items: bi-ot/omy/oneo-per--cytecis/oanti-auto-hypo-hemi-mono--celepara--gramoste/oluek/ointra-rhin/oaden/ocyan/opath/oneur/obrady-tachy-hyper-micro--algia-lysis-rrheanephr/ocardi/ogastr/oenter/opseudo--megaly-ptosis-rrhapypulmon/odermat/olaryng/o

100 English Words 2025-03-10

100 Items: CatDogIceSunJoyZooFastJumpKindPlayRainTreeBabyEasyKingLionNestDoorGoldKiteLampOpenStarXrayYawnIdeaSnowYearEchoAppleGreenHappyLaughNightQuietVoiceWaterZebraChairDanceFunnyHouseOceanQueenRiverSmileTableUnderBreadClockHeartJellyQuickCloudLemonMusicQuiltTigerWagonXenonMonkeyOrangeYellowAlwaysGardenIslandPencilWindowYogurtEnergyFlowerInsectPillowRabbit...

Vwo 1: Unit 3 2025-03-12

100 Items: CARSADBIKECAKECALMCITYDATEFAREFASTFLATHOMEHOSTHUGEKINDLIFTMEANMOVERIDERUDESAFESITESLOWTALLTAXIWAITBOREDCHEAPDELAYENJOYFERRYFUNNYPARTYQUITESCARYSHARESPACESTORETIREDUPSETVISITWHILECHURCHDRIVERHEIGHTMOSQUEMUSEUMSCAREDSTATUESUBWAYTEMPLETICKETTRAVELBICYCLECOMMUTECOSTUMECROWDEDEXPLOREHOSTESSIMAGINEJOURNEYMESSAGERAILWAYRELAXEDSTADIUMTAXICABTHEATRETRAFFIC...

test1 2026-02-28

9 Items: Farthest planetDirty air or water.feeling need for foodperson you don’t knowline of waiting peopleboats that carry peoplefoods like dal and beanscarries away dirty watera measure from elbow to fingertip

Sweatinsider Word Search! 2025-11-24

9 Items: a real foodstate of mindback in vogue!our last puzzleit's almost timething that scurriesmake sure to bring itthe tree, you know the one!you may wear these (or fall in love)

💣Bomb Blitz - Food💣 2023-12-20

5 Items: porklambgyrofrieschicken

Level 1: Types of Food 2025-09-25

5 Items: EggMilkAppleBreadCheese

Laura & Monica 2025-04-24

14 Items: Dog's nameCat's NameLaura's hometownFavorite TV showMonica's hometownLaura's go to beerLaura's birth monthMonica's birth monthWhere the couple metFirst vacation togetherBoard game used to proposeThe month they got engagedCouple's favorite kind of foodCouple's dream vacation location

Year Word Search 2026-01-01

12 Items: not oldwhat we eata special daya bright colora light decorationa time of 12 monthspeople we live withbringing good thingsshows days and monthsanimal signs for yearsthe light in the night skyto make something not dirty

Unit 8: Unusual Friendship 2026-01-27

10 Items: not normala baby dog.most of the timeto become less tense.to help and keep safe.the baby of a bear or a lion.being king and playing togethera very fast wild cat with spots.a job someone has or a part they do.what you felt and thought the first time you saw something.

Spanish vocab 3A 2023-05-09

23 Items: meatpeasricesteakoniondinnergrapesgrainsbutterlettucecarrotsto walkpotatoesspaghettiice creampasteriesbeveragesIḿ hungrylas-grasasIḿ thirstycooked fishgreen beanschicken(food)

Ideal Holiday 2025-06-05

30 Items: cartimerainsnowboatfoodmoneyto gospainwalesplanecoachbeachto buybikingto eatto staygermanyenglandto playto spendscotlandone weekto danceshoppingto sleepto go outto sunbatheI would likescuba diving

50 more most common Ukrainian adjectives. 2025-01-19

50 Items: farredwetfastslowlatebluepinkgrayopenhugelazycalmheavyearlyclosewhiteblackgreenbrownroundroughlyingsharpmodernfamousyellowgoldensilversquareclosedsmoothhoneststupidtenderancientunknownhostilethirstycheerfulfriendlyfriendlyminiaturerespectedtriangularintelligenthardworkingdiamond-shaped(tupy) - bluntlight (in terms of weight)

Sight Word Word Search 2025-01-29

100 Items: orusifsitbuyuseitsoffwhyfarcutgothotowntentrysixpullreadbeensingbestbothtellcalldoescoldfastuponfivegaveverywashgoesmademanyworkyourbabydonefallfullhurtkeepkindgrowholdlongmuchcakeonlypickshowmilkwarmdrawwoodrightsleeptheirdon’tthesefirstthosefoundwhichgreenwouldwriteaboutapplebringcleaneightbreadcarrydrinkneversmallstarttodaysevenshalllaughlight...

Apple Word Search 2025-02-17

100 Items: UpInGoNoCatDogEggHatIceSunVanSadBigHotOutYesBagHatCarBusRunEatCryBallFishGoatJumpKiteLionMoonNestRainTreeFastSlowColdDownLeftOpenStopLoveHomeBookDeskDoorCoatBoatWalkSingReadDrawCookPlayHelpApplePandaQueenWaterYo-yoZebraHappySmallRightCloseThankPaperChairClockShoesSocksShirtPantsTrainPlaneClimbDanceWritePaintDrinkSleepDreamLaughSmileWatchShareBuild...

A Fabulous Word Search 2025-07-01

100 Items: runziproarswimglowfastgrinkindhowlechotentyawnmazeblowtailapplebravepaintmagiccloudnightcrashclockdizzyoceansocksclimbsnoredreamsmilemarchtrickcrawlstinghatchstormskatecheerslidesniffmuddyjugglewindowbottleforestbounceorangeinventsoftlycastlepuzzlestickytravelsilverhiddengardenshadowwiggletunnelparrotrustleticklebananagobblesneakybouncerocketbutton...

Semester 2 Final Word Search 2015-05-15

74 Items: winroothaircellcellwallareaheattubefoodorganstomasugaraminoacidsxylemlightovuleovaryspermchaintissuephloempollenpetalsstigmauterusenergycarbonnucleussurfaceallelesdiploidhaploidmeiosismitosisanthersgeneticbiomassdioxidegenotypedominantmutationchemicalproducerconsumercytoplasmnutritiondiffusionmesophyllphenotyperecessiveovulationvariationherbivore...

Thanksgiving 2022-11-02

75 Items: codyameatbunhamdeerfallshipfishbakeovenloveleafmeatfoodmealhomepotsfeastgoosepeaceacornbreadbeansgravyapplerollssaucesaladroasttabletasteturkeyfamilyrecipecolonyguestsdinnerpotatosquashvoyageholidayharvestlobsterfriendsamericasquantoparentsdessertgibletspatuxetcookingcularinypilgrimsgoodnessplymouthceremonynovemberthursdayculturesnewworldstuffing...

Spanish vocab 2023-05-09

23 Items: meatpeasricesteakoniondinnergrapesgrainsbutterlettucecarrotsto walkpotatoesspaghettiice creampasteriesbeveragesIḿ hungrylas-grasasIḿ thirstycooked fishgreen beanschicken(food)

Sophia Word Search 2023-06-03

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

Test 2025-01-11

34 Items: TeaShopTimeWantWashPartySaladShareShortStartTableTeethTodaySundayTomatoTwelveTwentyPeppersSixteenSpinachThirstyTuesdaySandwichSaturdayThirteenThursdayTomorrowSeventeenMonday weRestaurantVegetablesMouth weekOnion yesterdayNineteen Wednesday

1 2023-06-04

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

Vocab Set 5 2023-10-12

30 Items: nowshopfoodwinecitydeadsoonwaterhouseslavetiredagainto eatfarmerdinnerschoolsacredto callto comegreatlyto shoutto hurryto watchto laughto drinkthe restto prepareslave-girlto be absentto be present

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

Intro to Ag Vocab Word Search 1 2025-12-08

74 Items: cowdoejobacidbasebeefcalfcropdatafoodfuellambleafcellschickcreedfaunafieldfloragenesinputbuffercareerdangerdesertembryoenergyexportheiferimportkittenanatomyaquaticcautiondensityerosionharvestinquiryaccidentaccuracybacteriaclassifyconflictdistancelandformlatitudeamendmentcarnivorecommoditydimensionemergencyfeedstuffgrasslandherbivoreincubator...

5th period 2022-11-28

23 Items: boombaapodacaourcityJustin....G fav foodG fav teamonesecuritytwosecuritystock _____Wings @ ziathunderbirdsCaptain Heroschool symbolAria's sisterone letter namejordandoorcalledbrother is Angelthree letter namelives in pineappleMovie based on maskwho is a cheerleadertakes bag fire drillWhere is he? find him...

TLE Word search 2025-02-03

25 Items: Use to mixedUse to open cansUse to measuring liquidsUse to hold food in placeUse to combine ingredientsUse to strai the dry ingredientsUse to toast multiple types of breadUse to apply spreads, over bread slicesUse to chill sandwiches and other foodsUse to mixture of fillings from the pansUse to allowing ease of slicing and handling...

Sarah Word Search 2023-01-20

76 Items: joytielovecakewifekissvowsveilsuitfoodgownhomepastsarahbridegroomringstoastdresshappyunionheartaislemusicwhiteburnsheartdanielfamilycoupledinnergarterfuturemilliejacksonforeverflowersweddingdancinghusbandpromisebouquetfriendspartnerpresentmarriagemaddisonproposalceremonytogethertrailhubplanningnuptialsromanticdevotionchildrenhoneymoongathering...

3A Vocab 2024-03-04

28 Items: teamilkwithnevercoffeeto eatalwaysI loveI likeRight?withoutlemonadeiced teato drinkto shareeverydayyou loveyou likeof coursesoft drinkfood, mealHow awful!apple juiceorange juiceWhich? What?more or lessto understanddrink/beverage

MOUNT BEULAH MB CHURCH 2024-05-07

36 Items: DRwmuAVEHALLLINEUNITHILLSCHOIRWIVESSTUDYBOARDPANTYBOARDCHORUSSCHOOLADULTSclerksWORKERSdeaconsACADEMYMINISTRYoutreachTO GLORYministrytrusteescommitteedeaconessministersDEPARTMENTLH BELL SRLADY GRACIEorientationTRANING UNIONBEULAH TERRACEB SHIELDS MANORREV DR EG SHIELDS SR

Notting Word Search 2024-08-16

39 Items: BFoodKingSocaIriePunchAswadDavidJonesbandsGiggsChildReggaeRhymesFloats& BassCochranLaslettcultureStormzyJamaicaCalypsoJudgingll SoulMarleysCostumes& TobagoWindrushCarnivalHendersonDancehallcompetitionStreet FayreSystems 1973Hill CarnivalDays celebrationstages performersWest Indian GazettePancras Town Hall 1959

Pagkonsumo Word Search 2025-09-28

70 Items: TaoIdeaGuroFoodAralLupaLeadWaterDailySpaceSalikValuePresyoPadronChooseTalentSkillsDemandMarketSalaryGusaliPagbuoProductLimitedMinimumMineralPaggawaKapitalCapitalUtilityPrimaryLipunanMatalinoScammingbusinessBusinessTertiarySerbisyoTrainingPaggubatawarenessEducationArkitektoPanaderyaMakinaryaDependentResourcesIntensivePamilihanPagmiminaSecondary...

Thanksgiving Word Find 2025-11-12

68 Items: YamPiePieRollCornMoonRollCozyGiveFoodHomeWarmListSauceBeansGravyCrustCreamAcornMapleFaithBlessGobbleGatherNutmegThanksPrayerFamilyRecipeWarmthAutumnBreezeWishesRoastedKitchenCookingRecipesHistoryHayrideStuffedFillingSweaterOrchardComfortCarvingFestiveBlessingPotatoesColoniesFestivalCinnamonKindnessRoastingTogetherCelebrateGratitudeMayflower...

Payton's Clue Week Day 2 2025-10-12

10 Items: Your big's star signYour big's cat's nameYour big's dream careerYour big's favorite foodYour big's first concertYour big's favorite colorYour big's favorite movieYour big's favorite flowerYour big's favorite animalYour big's favorite holiday

Hard word search for Curious minds 2025-11-19

27 Items: ClueThe gas we breatheKing of the animalsSmart marine mammalThe lightest elementThe coldest continentThe only flying mammalExtinct giant reptilesFamous musical composerEarth's natural satelliteA mountain that spews lavaTower Famous tower in ParisA machine that can perform tasksThe world's largest coral systemBees produce this sweet substance...

Task1.1 Food idiom wordsearch 2024-02-29

4 Items: two peas in a pod........ of discordto spill the ..................... a few sandwiches short of a picnic

Traditional Biotechnology (Food Biotechnoloogy) 2024-04-22

4 Items: Genes are isolated from human DNA using...enzymeA bacterial plasmid is cut with the same enzyme creating ....The human DNA is inserted to the bacterial plasmid using the enzyme....Some crops have been genetically modified to produce additional vitamins

Regine & JT 2024-08-30

28 Items: Grooms favorite candyCouples favorite liquorCouples favorite seasonGrooms favorite dessertCouples favorite cuisineGrooms favorite war movieWho is the morning personBrides favorite condimentBrides favorite music genreMonth the couple got engagedCouples favorite movie genreGrooms favorite way to relaxBrides favorite pizza topping...

Free time 2024-12-01

5 Items: jumping sportFind pasta foodfind the pyramidsjump arms first into a swimming poolthere are animals, fruit, and vegetables in this place

Lilibet's amazing word search 2024-05-13

7 Items: Very bigA crunchy vegetableThe opposite of tallsomewhere you cook foodSomeone who looks after youI have just- - a new schoolA sound you make when stepping into mud

#2 Puzzle "Synonyms" 2024-09-06

50 Items: BIGSADENDHOTBADOLDNEWCRYBUYCOLDGOODFASTSLOWLOUDEASYHARDUGLYRICHPOORDUMBWEAKKINDMEANHELPHURTHATEGIVESELLWALKSMALLHAPPYSTARTQUIETCLEANDIRTYSMARTBRAVEFUNNYLUCKYBUILDTEACHSTRONGSCAREDHONESTFRIENDANSWERSERIOUSBEAUTIFULDISHONESTUNFORTUNATE

#6 Puzzle "Antonyms" 2024-09-06

50 Items: UPBIGDAYWETNEWWINFATHOTTOPBUYFASTOPENLOUDFULLGIVESOFTHIGHTHINFINDLEFTKINDNEARTALLRICHWIDEDEEPHAPPYFRONTCLEANLAUGHSTARTBLACKLIGHTABOVESWEETHEAVYTIGHTEARLYSMILESUNNYALIVEFIRSTBUILDSTRONGFRIENDINSIDEARRIVECREATEFORWARDREMEMBER

3rd grade sight words Form B 2025-01-29

100 Items: sunredwardogtopmaplowbodyfivecoldstepplaneasytruesingfishareadoormarksurefallkingtownshipwindI’llrockunitroomknewfastbusyeverbestholddrawwoodfiretoldseenuponhoursmusicblackcriedcolorstandheardwholevowelsouthorderearlywaveshorsetablebirdsnorthtodayspacemoneyshortfieldsincepiecevoicedidn’tpassednoticegroundbecomelistenacrossslowlyfigureduringbetter...

Business Unit 2025-04-11

25 Items: FlowHeatingMose Sonof FloridaSolves it AllCooling HeatingService Companyand Air ServiceDuron Service CoAir Home ServicesGray Plumbing IncPlumbing Air ElectricPlumbing Heating CoolingPlumbing Air ConditioningElectric Plumbing and AirAC Heating & Duct CleaningHeating & Cooling ElectricalComfort Heating Air PlumbingHeating and Air Conditioning...

Alleluia Word Search 2026-02-01

100 Items: JOYSINWAYFASTHOLYHOPELAMBLENTLIFELOVEMARYPALMTOMBVINEWORDALTARASHESBIBLEBREADCROSSCROWNFAITHGLORYGRACEJESUSLIGHTMERCYMOSESOLIVEPEACEPETERPSALMSTONETRUTHCANDLECHRISTCHURCHEASTERGARDENGOSPELHEAVENISRAELPRAISEPRAYERREPENTSAVIORSPIRITTEMPLETHORNSWISDOMAPOSTLEBAPTISMCALVARYCHALICEFASTINGHOSANNAKINGDOMMIRACLEMORNINGPARABLEPROPHETPROMISESABBATHSERVANT...

Sicily’s Halloween Word Search 2022-10-05

15 Items: Sweet foodWolf monsterMagical womanCar of a witchApposite of dayOrange vegetableDemonic creatureBones of a personMonth of HalloweenBlack bug with 8 legsSoul of a dead personBlood drinking monsterOutfits worn on HalloweenMakes werewolves come aliveResting place of a dead person

Chapter 1 Food Science: An Old but New Subject 2022-09-05

12 Items: organicnutritionfoodsciencefoodanalogsfooddefenseadulterationfoodsecurityfoodprocessingfarmtothetablefoodscientistshydroponiccropscryogenicliquids

? 2022-07-27

2 Items: surfaces that touch food must bewhat are three of the NINE food allergens

BEAT WOODBERRY 2024-11-03

12 Items: WHAT DO WE EAT?HOW DO WE EAT IT?WOODBERRY TOILETSEPISCOPAL'S COLORWOODBERRY'S COLOROUR SUPERIOR STADIUMWOODBERRY STAPLE FOODEPISCOPAL'S HEAD COACHWOODBERRY'S HEAD COACHCOMMON ARCHITECTURAL FEATUREWHERE THE FIRST EHS-WFS GAME WAS HELDYEARS EPISCOPAL IS OLDER THAN WOODBERRY

ROUND 3 2022-09-15

8 Items: / A CUTE NICKNAME/ FOOD OF THE GODS/ A GENTLEMEN'S SPORT/ A CHILDREN'S CARTOON/ AYUSHI SHARMA'S VIDEO GAME/ STUFF WE LIKE TO 'TALK' ABOUT/ A FOOTBALL CHANT YOU CAN'T NOT DO/ A SORT OF CONNECTED NETWORK OF COMPUTERS

Cell Word Search 2026-01-03

4 Items: the basic unit of lifeanother word for digestLysosomes are _____ the cellLysosome have ______ for food and water

Vocabulary words 2024-12-05

12 Items: a fat protein unita basic fat moleculethe basic building blocks of fatturns vegetable oilds into solidsan amino acid that your body needs but cannot makea food that lacks one or more essential amino acida food that contains all nine essential amino acidsa molecule that combines with other amino acids to make proteins...

types of movies 2024-07-19

10 Items: Aims to evoke fear or suspenseIntended to make audiences laughBuilds suspense and excitement .Centers around love and relationshipsFocuses on serious themes and emotionsUses animation techniques to create the filmPresents factual information or real-life eventsInvolves magic, mythical creatures, or imaginary worlds...

Avocado Word Search 2025-09-16

6 Items: bookPanda foodIt gets wetter as it dries!Green fruit with a great big pitA place for using crayons (2 words)Where a girl writes her private thoughts

Love 2026-01-31

6 Items: Our tandem nameMy favorite foodMonth of our weddingThe place where you proposedThe place we celebrated Valentine's 2025One of my favorite face feature of yours

Chapter 4 from Food for Thought - The Lie 2016-04-05

10 Items: farmmaizecropsplanttrashstreambridgepollenprotestsurfboard

Pets 2023-04-03

10 Items: man's best friendI'm small and cuteI squeal when tickledI slither on the groundI swim in a bowl of watertigers and lions are big _____I hop around on my two back feetIn the water I'm fast but on land I'm slowI jump and can swim but at different timesyou can walk, trot, canter and gallop with me

Me Gusta 2025-04-07

15 Items: To runTo buyTo drawTo restTo drinkTo read a bookTo ride a bikeTo play sportsTo play soccerTo play guitarTo go for a walkTo learn SpanishTo listen to musicTo talk on the phoneTo prepare food/a meal

How well do you know me? 2025-09-09

15 Items: biggest fearfavorite foodfavorite musicfavorite animalMy favorite colormy height is 5’_”what makes me laughfavorite pizza placeLeast favorite colorMy moms maiden name isfavorite pair of shoesFavorite family membermorning or night personDream vacation is in the…how many places I’ve lived

Vocabulary 2025-11-20

15 Items: A nerve cellRemoval of wasteProcess of taking in substancesTissue that receives & sends signalsa unit used to measure the energy in foodswavelike muscle contractions that push foodplant material in food that is difficult to digestan organic molecule made from a chain of amino acidsTissue made up of skeletal, cardiac, and smooth muscles...

Hampton Manor Game 1 2025-07-08

11 Items: Holly's roommateA frog lover residentWhat is everyone hereMonday afternoon gameNorma's favorite foodMost creative residentBest Cleaning Lady aroundA Christmas Plant residentFriendliest Guy upfront areaLikes to bring it around townA game everyone likes to play

Spot the words 2023-02-20

8 Items: Human beingsA type of foodMan's best friendLazy and Furry PetsBiggest land animalA orange vegetable that is grownAn animal that swings on branchesA yellowish or purple vegetable that is grown

1. Word Search 2025-09-29

15 Items: Apartment A set of roomsFridge Short for refrigeratorJacuzzi A large hot tub or bathStove An appliance used for cooking foodBedroom A room used primarily for sleepingDelicious Having a very pleasant taste or smellBalcony A platform that extends from a buildingHammock A swinging bed made of fabric or netting...

How well do you know us/ your girlfriend 2026-02-13

13 Items: My future dogMy middle nameMy favorite foodMy favorite colorMy favorite drinkMy favorite movieMy favorite seasonMy favorite TV showMy favorite siblingSomething I always sayOur first date locationOur anniversary Roman numeralsWhat you got on our first date

Word Search for Dementia Care 2026-03-10

10 Items: you sit on itshows the timeyou sleep on ityou open to go inyou eat meals hereyou drink from thisplays music or newswhat you eat everydayyou walk or drive on ityou read stories from this

Asian American 2025-05-02

6 Items: the way people livefifth month of the yearland surrounded by watersomething that looks very lovelycolorful part of plant with petalsparty with music, dancing and food.

Funnel Word Search 2025-02-13

6 Items: used to fill jarsused to scrape foodused to grate or shredused for slicing foodsused to peel fruits and vegesused to blend dry and wet ingredients

VERY COOL EPIC SWAG CHRISTMAS WORDSEARCH PUZZLE 3D (80 PERCENT OFF SADNESS SALE) MULTIPLAYER POSSIBLY COMING IN LATE 2023 By Blair "Barry" Crawford 2022-12-13

10 Items: mei dont knowfrom the film elfNOT the south polethe big fat red guyA KFC Christmas Mealthe queen of christmas#CHRISTMAS is all about...#MARMALADE is _______'s favorite fooda famous car from a famous film (a lie)