fall Word Searches

Punbelievable 2025-02-20

14 Items: Why did the bicycle fall over?What has an eye but can't see?What do you call a fake noodle?Why did the picture go to jail?What do you call a lazy kangaroo?How do you organize a space party?Where do penguins keep their money?What do you call a fish with no eyes?What do you call a bear with no teeth?What's orange and sounds like a parrot?...

Snow White pgs. 21-24 2024-01-31

14 Items: Who does the queen talk to?Where does Snow White fall to?What was still as red as blood?Where does the queen go back to?Who fell in love with Snow White?I will give you _______! (pg. 24)Where did they carry Snow White up?Who is the most beautiful of all now?What did the dwarfs make for Snow White?What was wrong with Snow White's apple half?...

The Final Countdown Word Search 2026-05-14

12 Items: The dictionary definition of a wordThe season after spring and before fallplace many people visit to swim and relaxA character who changes throughout a storyA reference to another text, person, or eventThe sequence in which events happen in a storyWords or phrases that appeal to the senses in writing...

Vocab Review 2024-02-06

19 Items: to eatto ease up or give into insult or put downto push forward or onwardthe peak or highest pointempty not used or lived ina small verbal disagreementto insert into living tissueto stir up trouble or violenceto fall straight down very quicklyto completely surround and controlto cancel or do away with formallypieces or parts that have broken off...

Seasons and Tides 2024-01-11

12 Items: The direction the Earth spins.Earth's only natural satellite.Tides produced during quarter moons.Type of light that hits Earth at an angle.Tides that produce higher high tides and lower low tides.This is what the Earth rotates on; also called it's tilt.Type of light that hits Earth straight on with more energy....

Snow Word Search 2025-11-01

10 Items: - A small vehicle used to slide on snow.- Frozen water that is hard and slippery.- A thick piece of clothing worn to keep warm.- The low temperature that makes you feel chilly.- A long cloth worn around the neck to stay warm.- When something turns to ice because of the cold.- Clothing for your hands to protect them from the cold....

9327 Rich Man and Lazarus 2024-03-06

10 Items: Animals that are often kept as pets.The name of the poor man in the story.Having a lot of money or valuable things.A door in a fence that you can go through.A big meal for celebrating, with lots of food.Small pieces of food that fall off when you eat.Painful spots on the skin that can be sick or hurt....

Nature vocabulary 2024-10-22

10 Items: a large natural stream of water.a piece of land surrounded by water.the lowest part of a lake, river or sea.a clear liquid, without colour or taste.a large area of water surrounded by land.a hill of sand near a beach or in a desert.a high area of rock with a very steep side.an area of land, used for growing crops or keeping animals....

Nature and Seasons 2025-04-14

10 Items: BLIZZARD : A heavy snowstorm with strong winds.RAINBOW : A colorful arc that appears after rain.BREEZE : A gentle wind that moves the air softly.BLOSSOM : The flower of a plant, especially in spring.LIGHTNING : A flash of light in the sky during a storm.HARVEST : The time of gathering ripe crops from the field....

CV Aging Cl 5 2024-12-09

15 Items: Reestablishes blood flowOcculsion of LAD leading to MIRoto router of coronary vesselsAbbre for Coronary Artery Bypass GraftTroponin levels establish myocyte injuryDamage to all levels of the heart muscleCombines PCI and CABG to improve outcomesLack of adequate oxygen for cell metabolismSupply a list of these if you come to the ED...

Airconditioners Word Search 2022-06-29

150 Items: bluecakedeerfallmisopinksnowudonyodabaconbearsbellebirdsblackbreadgreenjapanjellykirbykiwismycarpizzaramenrosesrugbysteakwaterzeldaalfortamazonapplescanadacheesedegawadisneyfrenchhockeykitkatmrtofumtfujimypetsnitoriorangepandaspurplesweetstiggertotoroumaibowinteryamatoyellowbananascaramelcarrotscookiescookingdaisiesenglishfishingflowershotdogs...

50 more most common Ukrainian verbs. 2025-01-20

50 Items: to cryto runto hitto putto flyto buyto leadto wearto moveto cookto swimto feedto rideto wishto fallto prayto restto hideto singto readto closeto admitto watchto learnto avoidto fightto throwto offerto reachto raiseto uniteto teachto laughto sleepto drinkto danceto writeto studyto acceptto forgetto createto striketo searchto divideto escapeto choose...

New Year, One Word 2026-01-05

149 Items: bedogoactaddawefunhugjoyletnewoneruntryboldcalmcaredarefallfeelfindgivegrowhelphomehopeknowleadlessliftlovemakemoveopenplanplaypraypushreadrealriserisksaveseekslowsoarsoftsoulstartimewishawareblissbloombravebreakcleancleardreamfightfocusgracehappyheartlaughlearnlightloyalmagicorderpausepeaceplantpowerreachrelaxsavorserveshinesmilestartstillteach...

Mrs. Walker's Second Quarter Words 2025-12-01

15 Items: suitable for growing crops.silly, foolish, or senseless.to improve or make something better.to fall or drop straight down quickly.quiet, uncommunicative, saying little.intended to teach, often in a moralizing way.to prevent someone from succeeding; to thwart.to deeply respect or admire someone or something....

vocab 2024-04-26

11 Items: a great surprise.stare openly and stupidlythreatening harm; menacing.move in a feeble or unsteady way.an involuntary quivering movement.used to express anger or annoyance.walk or move unsteadily, as if about to fall.a fast-growing evergreen Australasian tree that has been widely introduced elsewhere....

January Word Search 2024-08-18

30 Items: Proposal MonthTracy’s CollegeTracy’s hometownTracy’s first carRobert’s hometownMonth of First DateTracy’s middle nameTracy’s favorite dogTracy’s favorite showRobert’s favorite fruitRobert’s middle name(s)Robert’s favorite snackTracy’s favorite seasonTracy’s favorite dessertRobert’s favorite seasonRobert’s favorite dessertMake of Robert’s first car...

Aladdin and the Wonderful Lamp pgs. 26-31 2023-09-18

15 Items: Where did Aladdin's mother go?Who does Aladdin want to marry?Keep your doors and windows _______.Who does Aladdin beg to go to the king?How did Aladdin feel about the princess?Where did the King tell everyone to stay?What did the genie of the lamp give them?Who wanted his son to marry the princess?Where will the princess travel to and from?...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

WS_K4_2 2025-03-19

25 Items: schwerschneidengegen, zuBrust, Herzwas? warum?Zweck, Zielaber, dennochGedanke, IdeePerson, jemandlachen, lächelnich Frage mich…ich hätte gerne…mal, nun, Äh!, Oh!warum, wieso, womitHerr, Frau, Fräuleindarum, weil, nämlichabsolut, ganz und garordentlich, gründlichwahnsinnig, großartigzweifellos, definitivwie erwartet, wie gesagt...

Reflexive Verb Word Search 2025-04-04

50 Items: fitlegearsadwellhairfacehandcombsoapbeardbrushso-sotoothtiredbadlyrazortowelto tanmirrormake-upmascaranot badto feelshampooto hurrymustacheto shavelipstickenergeticto get upvery welltoothbrushtoothpasteto get madto wake upto be namedconditionerpretty wellto go to beddental flossto fall asleepto get dressedto get marriedto dry oneselfto wash oneself...

Airconditioners Word Search 2022-06-29

150 Items: bluecakedeerfallmisopinksnowudonyodabaconbearsbellebirdsblackbreadgreenjapanjellykirbykiwismycarpizzaramenrosesrugbysteakwaterzeldaalfortamazonapplescanadacheesedegawadisneyfrenchhockeykitkatmrtofumtfujimypetsnitoriorangepandaspurplesweetstiggertotoroumaibowinteryamatoyellowbananascaramelcarrotscookiescookingdaisiesenglishfishingflowershotdogs...

ROSELLE STREETS 1 2025-06-19

150 Items: ASHDEEELMCASEEDENFALLGARYHALEHILLLAKEBIRCHBRYCECAREYCLAIRCRESTDAISYDARBYDAVIDDEEKEDEVONDINAHDOVERFORUMGRANTHAZELKELLYACADIAALBIONARTHURASHLEYAUTUMNAVALONBORDENBROWERCATINOCHERRYCIRCLECLARIACOLONYDALTONEXETERFORESTFOSTERGARDENHARVEYHOWARDHUDSONHUNTERHYGATEANDOVERARDMOREASHBURYAVEBURYBANBURYBERWICKBRENDONBRISTOLCALLEROCATALPACENTRALCENTURYCHATHAM...

NATURE & OUTDOORS 2025-11-30

15 Items: I am big, tall, and rocky.a path you can walk or hike on.sleep in a tent under the stars.I flow and twist across the land.water sits in me like a big bowl.I warm the earth and shine bright.I am hard and found on the ground.I grow on the ground and feel soft.I have six legs and sometimes buzz.a place with many trees and animals....

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

Board Mania 2025-08-29

11 Items: Buy and trade properties to bankrupt opponentsMake words on a board using letter tiles for pointsGuess coordinates to sink all your opponent’s shipsMatch colors or numbers to play all your cards firstJump over opponent pieces to remove them from the boardPlace hands and feet on colored circles without falling...

Noah's Ark: Genesis 6-9 2023-07-15

14 Items: Who loved God? (page 27)What covered everything? (page 31)The people _____ about God. (page 26)What did God put in the sky? (page 33)What did the dove bring back? (page 33)What animal did Noah send out? (page 33)What did God tell Noah to make? (page 28)Noah and his family _______ God. (page 33)How did Noah and his family feel? (page 32)...

MAG1 NFS Unit 7 Review 2026-06-16

19 Items: Air that moves.A tool to measure rainfall.Swirling wind storms on land.One of four times of the year.A strong storm with lots of snow.A scientist who tells the forecast.A word to describe the air outside.A chilly season with falling leaves.The coldest season with lots of snow.Low temperature, usually during winter....

MOWINGLEA 2026-02-28

14 Items: So stupid!The one they call...He wants to be Rob! I KNOW!Just can't live without Rob!Is this person here right now?Something you put on t-shirts.Another name commonly used for Rob.The apple didn't fall far from the tree.What Rob is to each of you and to the universe.A good word to scream out from time to time (Sp)....

unit 7 2024-05-01

14 Items: increase demand for waterused to extract substancesone strategy to deforestationused to remove natural gas and petroleumground sinking down into open spaces belowlow population density areas outside the citycities fall apart as people migrate to the suburbsthreats include soil erosion, soil compaction, etc....

Yoto Carnegie 2023 Word Search 2023-05-03

9 Items: The number of shadowers in TeamBerkoThe surname of the author of 'When Shadows Fall'TeamBerko (The name of our school shadowing group)The title of the shortlisted book by Jessie BurtonThe title of the shortlisted book by Patrice LawrenceThe surname of the author of 'The Light in Everything'The month of the year in the title of the 2022 medal winner...

Jerusalem's Fall 2025-11-04

1 Item: Babylon Exile Judah Vision Temple Prophecy River Chebar Scroll Israel Restoration Covenant Glory Spirit Watchman Jerusalem Idolatry Hope Obedience

The Wordless Book 2025-12-20

10 Items: Greek word for sinAnother word for a babyWhat does black symbolise?Greek word for eternal deathJesus said to her, “I am the _____ and the life.For all have sinned and fall short of the _____ of God,The one who _____ in me will live, even though they die;As far as the east is from the west, so far has he removed our _____ from us....

cute words♡ 2023-10-25

160 Items: momnapskysunteacakecutedearfallhopehugslakelifelilylovepetsrainrosesandsofttoysbeachbloomblushbookscleandaisydancefreshfunnygiftsgrasshappyhearthoneyhubbyjellojollylightlunchmerrymusicoceanoreospeacequietrelaxrivershinesillysleepsmilesongsstarssweetswingtastytouchtreestruthwaterwavesyummyangelsapplesautumnbreezebrightbubblycolorscuddledreamsfamily...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

Vocab List PE 2 2025-09-30

63 Items: inpendaymaybookdeskyearweekjunejunefallmonthtodaymarchaprilfolderpencilmondayfridaysundayaugustpleasewinterspringsummertuesdayjanuaryfebuaryoctobertomorrowthursdaysaturdaynovemberdecemberit's hotclassroomwednesdayseptemberhow many?it's coldyou say...it's sunnyit's windyit's rainythe seasonit means...it's snowingstudent (male)sheet of paper...

Holes: Chapters 1 - 20 Vocabulary 2025-10-08

21 Items: A faucetpoisonousunused area of landNot allowed, bannedMake a hole by diggingPitifully sad; hopelessUtterly absurd/ridiculousAnimals preying on othersDeserving hatred or contempttoo poor to produce vegetationNot receiving proper attention.with earnest and eager attentionOf very great extent or quantity.deserted of people, empty or bare....

Word search 2025-10-22

157 Items: IainofAsupToOnmySonoittohebeohisOuttheseesadI'mtooButandforwayareyouhowoldrunmanhisfunhasonenotbedwhohadhimherAllSheyesdoorrainFalluponwakefillWithkeepGoodlovefrommindKnowdownyourfeedmuchneedholdjustfreegetsawaywhenlikedonemustfindthatI'llwaitburnWillevercomeoverit'slateroommadeopenletsonlybodykissI'vesofttearsoulyeahdeafdumbwelltheirshoeswater...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timea balance between different factorsVelocity at a particular instant in timethe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

IELTS HACK: WRITING 2026-06-16

10 Items: To show clearly that something exists or is true.To change or be different in amount, size, or degree.To change frequently and irregularly in level or value.To fall or drop straight down very quickly and suddenly.To rise or increase extremely quickly to a very high level.To say the opposite of what someone else has said; to deny....

Turkey Turkey 2025-11-21

15 Items: The traditional main course.A large and celebratory meal.The time of year when crops are gathered.A festive procession, like the one in NYC.The feeling of appreciation and gratitude.The season when Thanksgiving is celebrated.A group of early settlers who arrived in 1620.The feeling of being thankful and appreciative....

8.1 spanish 2025-03-05

36 Items: SoapCombCityTowelHotelShampooTo waitRoutineBy boatNormallyBy planeBy trainVacationTo get upTo put onGenerallyTo wake upToothpasteTo stay inHair dryerOn vacationTo go to bedTo take a bathTo fall asleepTo dry oneselfTo get dressedTo take a tripTo wash oneselfThe countrysideTo shave oneselfTo take a showerTo put on makeupTo dry ones hair...

Vocab Test 11-14 2025-05-19

20 Items: Become or made better.Put out of sight; hide.Very familiar or private.Loud, energetic, and cheerful.Keep something in good condition.Kept under control; not excessive.Obtained from a particular source.Felt deep respect or admiration for.A feeling of uncertainty or disbelief.Made greater, better, or more intense....

Bahasa Indonesia 2025-10-02

74 Items: Igoweagewhositredonetwotendogcateatyouyesbigandreadknowfallstaybluegoodfivefourmilktheyhererichthislikewherehousesleepwhiteblackgreatthreeeightwaterbreaddrinksorrywhat?standstarttherepricedressyearsapplearrivefinishreturnappearbananaforgetmarketstrongclotheshe/ sherememberbuildingHow much?breakfastthank youdeliciousexcuse meover therehow are you...

Year 7: Term 4 Week 4 2025-10-30

20 Items: A push or a pull. (5)The act of moving. (6)Change in speed over time. (12)Rise and fall of ocean water. (5)Day and night are equal length. (7)Orbits a planet, like the Moon. (9)A icy rock with a glowing tail. (5)How much matter is in an object. (4)Pulls everything toward the Earth. (7)Spring, summer, autumn, or winter. (6)...

Unit 14 (new/old/roots) Word Search 2026-04-01

23 Items: able to walkto surrenderto bring abouta minor officialfollowing in orderhappening repeatedlyto casually walk;strollthe way something is doneseizing everything; greedyone who carries and deliverssomething given up or yieldedto make less heavy or serioushaving no effect or importanceto make less painful or dangerousbeing the most evident or apparent...

spooky road trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

Los Reflexivos 2026-01-07

45 Items: I cutI combI curlI shavehe cutshe combshe feelsI showerI get upI put onshe curlsshe driesI wake uphe shavesI'm dryinghe brusheshe showersI'm washingI'm stayingI'm leavinghe wakes upI'm bathingI'm brushinghe's bathinghe's washinghe's stayinghe is leavingI fall asleepI'm having funI'm taking offshe is sittinghe falls asleephe's having fun...

Past Tense Verbs 2026-05-13

80 Items: isarebuycuthitletputsetrunwinsithidsawdidbitategothurtshutcomefeelsendlendlosemeanfindholdmakeselltellfeedleadmeetreadhavehearlaidpaidsaidwentswamfellgaveroderosetookwoketoreworerangsanksangblewdrewflewgrewknewbeginbringbuildspendsleepcatchfightteachthinkstooddrankdrovefrozewrotechosebrokeshookspokestolethrewbecomeforgotunderstood

States of Consciousness 2025-09-29

17 Items: short daytime restlightest stage of sleepthing you lay your head on at nightstate of rest where the body recovershow sleep disorders are often diagnosedmeasured by EEG, slows as sleep progresseschemical in the brain that makes you sleepycondition where you can't fall asleep easilynatural daily pattern of sleep and wakefulness...

s&s trip 2025-08-13

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

El pretérito (The past tense) 2026-04-13

54 Items: FallYearMonthSundayMondayFridaySpringSummerWinterI wentI drewTuesdayLast...AlreadyNot yetWe wentThursdaySaturdayWe foundI fishedI playedYesterdayLast weekWednesdayThey wentI arrivedWe shavedI got madWe helpedI cleanedLast nightI did/madeShe workedHe did/madeI practicedI organizedI ate lunchThis morningThis eveningLast weekendYou did/made...

Películas clásicas icónicas de los años 70, 80, y 90 2024-09-13

15 Items: friendly alien wants to phone homeGiant shark terrorizes Amity IslandHenry Hill’s rise and fall in the mafiaDinosaurs run wild in a modern theme parkMafia family drama led by Don Vito CorleoneUnderdog boxer rises to fame in PhiladelphiaA priest battles evil to save a possessed girlA time-traveling cyborg is sent to kill Sarah Connor...

Nature 2024-10-30

10 Items: A very tall hillA very steep side of a mountain or rock.A large body of water surrounded by landA piece of land surrounded by water on all sidesA large open area of land, often used for growing cropsA long, narrow body of fresh water that flows across the landThe condition of the air outside, such as temperature, rain, or wind...

A Cold Autumn Day 2025-05-14

20 Items: hard workto push outa small townto breath air ina feeling of colda feeling of being warmto change from ice to waterlarge enough to be importantthe land near a body of waterto start working on a hard jobpart of a coat that covers the heada place that protects you from bad weatherto compete against others to be the fastest...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

salem road trip final 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

s&s trip 2025-08-13

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

Capítulo 2: ¡Una rutina diferente! 2025-11-06

51 Items: armleghotcombsoapheadbackkneefootparktentleftcoldherebrushteethelbowrightmirrorfingershampoocampingsweaterto brushto get upto put onto wake upto stretchtoothbrushtoothpastehuman bodybackpackerI'm comingto sit downto take offearly riserto go to bedtoilet papersleeping bagdaily routineto go campingto fall asleepto take a hiketo wash oneself...

Past Tense Verbs 2026-05-14

80 Items: isgodoarebuycuthitletputsetrunwinsithidlaypaysayseeeatgetflyhurtshutcomefeelsendlendlosemeanfindholdmakeselltellfeedleadmeetreadhavehearswimbitefallgiveriderisetakewaketearwearringsinksingblowdrawgrowknowbeginbringbuildspendsleepcatchfightteachthinkstanddrinkdrivewritebreakshakespeakstealthrowbecomeforgetfreezechooseunderstand

The 4th Grade Times Thanksgiving Word Search 2022-11-02

1 Item: pie turkey Apple cider Leaves Walk fall Thanksgiving potatoes

Demand Word Search 2025-01-16

11 Items: Money set aside for future use.The money spent on goods and services.Goods or services produced in an economy.A compulsory contribution to state revenue.The desire for goods or services at a given price.A place or system where goods and services are exchanged.Money spent by consumers or government on goods and services....

Middle Ages Review Word Search 2024-03-01

19 Items: Mr. Murphy's catsFirst Holy Roman EmperorA mix of two distinct culturesCommon targets of Viking raidsA code of laws based on Roman lawThe capitol of the Byzantine EmpireThe social system of the Middle AgesLeader of the Eastern Orthodox ChurchThe economic system of the Middle AgesReligious wars that lasted for 200 years...

Christmasornament Word Search 2022-12-22

8 Items: a symbol with five or more pointsSanta clause comes into the house trough itSanta Claus travels in a sleigh pulled by...a ball-shaped Christmas decoration for hanging on a treeYou say that said at Christmas to wish people a nice Christmas timea real or plastic tree that is decorated and kept in the home at Christmas...

The 4th Grade Times Thanksgiving Word Search 2022-11-02

1 Item: pie turkey Apple cider Leaves Walk fall Thanksgiving potatoes

The 4th Grade Times Thanksgiving Word Search 2022-11-02

1 Item: pie turkey Apple cider Leaves Walk fall Thanksgiving potatoes

Legislative Branch Word Search 2025-02-13

18 Items: What IRS stands forTo lay and collect ________Only Congress can Declare ____What Holiday do we Celebrate on MondayC&B or Power Congress has over SpendingWho decides the Vice President if no one gets 270Right to a fair trial "Show me the Body in Latin"C&B Power Congress has to remove federal officalsWho decides the President if no candidate gets 270...

Christmasornament Word Search 2022-12-22

8 Items: a symbol with five or more pointsSanta clause comes into the house trough itSanta Claus travels in a sleigh pulled by...a ball-shaped Christmas decoration for hanging on a treeYou say that said at Christmas to wish people a nice Christmas timea real or plastic tree that is decorated and kept in the home at Christmas...

Movies 2025-11-12

12 Items: ABBA songs and Greek islandsA classic love story in MoroccoA humble boxer becomes a championA giant shark attacks a beach townA smart little girl with magical powersA Roman fighter seeks revenge in the ColosseumA magic carpet, a lamp and a genie in the desertA romantic story between a living woman and a ghost...

Filix School of Education (Grade-IV) Science 2024-05-03

18 Items: The centre of the tooth.Disease caused by virusesthey makes our teeth strongA thin sticky layer of germsDisease caused due to protozoaIt is caused due to tooth decay.The four front teeth in each jaw.They are also called tearing teeth.Helps to make soft cakes and bread.We must visit him/her twice a year.They are also called grinding teeth....

Injuries 2024-03-02

1 Item: , burn , cut, hurt , sprain, break, crash, fall off, slip, trip

Billionaire Boy Chapter 3 Word Search 2026-05-18

10 Items: Joe and Bob fall behind __________ else during the run.The boys’ talk about weight is honest but also __________.During PE, Bob has to do __________ running without proper kit.Mr __________ forces Bob to run even though his kit is missing.Bob would have let Joe come last for __________, not for money....

Layers of the Earth 2025-10-13

11 Items: The degree of compactness of a substance.Molten rock found beneath the Earth's surface.The thin, brittle, outermost solid layer of the Earth.Molten rock that has erupted onto the Earth's surface.Crust thicker, less dense crust that forms the continents.Crust Sub-layer Thinner, more dense crust under the oceans....

Halloween/Autumn Word Search 2025-10-14

11 Items: How do you say "autumn" in Spanish?In which month are the most babies born?What is the full moon in November called?Egyptians were the first people to use _____.Which Hindu festival takes place in the fall?Who were the first people to carve jack-o'-lanterns?Where is it illegal to use silly string on Halloween?...

Wonder Vocab 2025-11-08

14 Items: To speak very softly and quietly.A talk between two or more people.To want something to happen or be true.Normal or usual; not special or different.To keep someone or something safe from harmTo learn at home, usually taught by parentsTo act like something is true when it is not.To look at someone or something for a long time....

Basic concepts related to functions 2024-12-23

16 Items: Graph of a linear functionA value that does not changeGraph of a quadratic functionA symbol that represents a numberA function whose graph is a parabolaA visual representation of a functionAll positive and negative whole numbersThe point where a graph crosses an axisAll possible output values of a functionA function that reverses another function...

Seasonal Changes ( From Snowy Days to Sunny Rays! ) 2025-05-03

5 Items: THUNDERBOLT: A powerful flash of lightning accompanied by a booming sound of thunderRAINCLOUD: A dark, moisture-laden cloud that drops raindrops when it becomes saturatedSUNFLOWER: A tall plant with a large, bright yellow flower head that follows the sun’s movement...

Unit 7: Other Land Use Part 1 2024-04-25

14 Items: areas where the public shares resourcesfire that only burns underbrush and is beneficialfire that smolders underground and is hard to put outgrowth strategies that develop sustainable communitiesgrowth forest resulting from natural secondary successionland degradation severe enough that land becomes a desert...

Transaction Word Search 2025-10-31

21 Items: to make or become lesssafe and suitable to be eatenenough for a particular purposea view or attitude toward the futureto experience pain, difficulty, or lossof an acceptable standard; satisfactoryan action of buying or selling somethingto expect or predict something will happenrelating to a town, city, or local government...

Valentine's Day Word Search III 2026-01-05

20 Items: A special snack or small gift.Being nice and helpful to others.A gentle way to show love or caring.Red flowers often given to show love.Colorful plants often given as a gift.A caring relationship between friends.A paper message with kind words inside.A symbol used to show love and kindness.A color that represents love and hearts....

Sam & Alexis 2024-09-19

31 Items: Best ManWho is olderMatron of honorRoad they live onGrooms middle nameBrides middle nameBrides maiden nameTown Bride grew upMonth Groom proposedMonth they first metGrooms birthday monthSaid I love you firstDating app they met onCouples favorite seasonCouples favorite TV showCouples favorite holidayGrooms favorite card gameLake the Groom grew up on...

Daniel & Brittany 2024-10-10

40 Items: Year they metWhere they metBest Man's nameGrooms birthstoneBrides birthstoneBride's dream jobCouples' dogs nameGroom's ProfessionBride's middle nameGroom's middle nameGroom's zodiac signBride's zodiac signWhere was Bride bornWhere was Groom bornMonth Daniel proposedColor of Groom's eyesCouples favorite songGrooms favorite colorGroom's favorite food...

Spooky Word Search 2024-10-31

179 Items: axebogboocatnunspywigbatsfallfearhowlmaskmistmothalienbeardbeastbloodbonesboxercandyclowncovencryptdecaydemoneerieenemyfancyfangsfoggyghoulgourdmummyouijapartypropsravenscaryskullslimesnakestaffswordtoxictrollvenomwingsafraidapplesautumncasketcharmscircuscorpsecreepycurfewghostsgoblinhorrorleavesmakeuporangeparadepeglegplaguepiratepoisonscared...

Walk Two Moons Word Search 2025-10-08

21 Items: Sal’s crushPhoebe’s last nameMargaret’s last nameSergeant Bickle’s soncool, chill, unbotheredwhere Lewiston is locatedthe state where Sal grew upwhat “Sal” is a nickname forSal prays to and kisses thesewhat Gram and Gramps call PhoebeSal’s mom’s first name…no, not Sugara fruit that reminds Sal of her motherto fall far and quickly without control...

vocab 2 2025-10-13

64 Items: inpendaymaybookdeskyearweekJuneJulyfallmonthtodaymarchAprilfolderpencilMondayFridaySundayaugustpleaseseasonwinterspringsummerTuesdayJanuaryoctoberyou sayits hotnotebooktomorrowThursdaySaturdayFebruarynovemberdecemberhow manythere isit meansits coldclassroomWednesdayseptemberits sunnyits windyits spelledits rainingits snowingmale studentmale teacher...

Thanksgiving 2025-11-13

20 Items: The season when crops are gathered.A large quantity of something good.The month we celebrate Thanksgiving.The act of giving freely and kindly.Good things in life to be thankful for.Creamy side dish often served with gravy.A joyful gathering to mark a special occasion.When people come together for an event or meal....

Valentine's Day Word Search III 2026-01-05

20 Items: A special snack or small gift.Being nice and helpful to others.A gentle way to show love or caring.Red flowers often given to show love.Colorful plants often given as a gift.A caring relationship between friends.A paper message with kind words inside.A symbol used to show love and kindness.A color that represents love and hearts....

Valentine Word Search 2026-01-05

20 Items: A special snack or small gift.Being nice and helpful to others.A gentle way to show love or caring.Red flowers often given to show love.Colorful plants often given as a gift.A caring relationship between friends.A paper message with kind words inside.A symbol used to show love and kindness.A color that represents love and hearts....

Love Word Search 2026-01-30

25 Items: Side by side; not apartThe French word for loveTo love and admire deeplySymbol of love and emotionA romantic outing togetherA popular Valentine’s treatSoft, gentle, loving in toneA sweet way to show affectionA love that lasts without endClassic flowers given for loveWarm embraces to show you careStrong, intense feelings of love...

Science: whole year 2 2026-05-18

21 Items: NUMBERSCHESAPEAKE BAYLARGEST PLANETMEASURES HUMIDITYGREAT DISMAL SWAMPMEASURES TEMPERATURENUMBER OF WATERSHEDS IN VIRGINIACURRENTLY LIVING OR ONCE LIVING THINGSNEGATIVELY CHARGED PARTICLE INSIDE AN ATOMPOSITIVELY CHARGED PARTICLE INSIDE AN ATOMADD THESE TO NUMBERS SO THEY AREN’T NAKED!ONE OF THESE AROUND THE SUN TAKES 365 DAYS...

Basketball 2025-07-18

1 Item: ball, hoop, pass, run, throw, court, player, win, lose, league, dribble, fall

Safety with Fun activity 2025-12-04

1 Item: power zone slip trip fall gloves PPE safety health ergonomics harness Amcare

WORDS THAT ARE BOTH NOUNS AND VERBS 2014-12-15

176 Items: actaimbuygelcutdiedyeendeyefaxhitjamhugliepadpayAchebackbankbeambeatbendblowbombgluebumpburncakecallcampcarechipcluecombfoldgazecookcopycostcurecurldealdialformduckdumpdustechofacefallfearfeelgripharmheadheathidehosehuntinchironitchjailjokejumpkeepkissknitgrinlandhandhateheaphelpholdleadloadlockmailmakemeannameneedpartpasspeelpeltplaytesttouralert...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Thanksgiving Wordsearch 2024-10-25

181 Items: HamJamYamBunsCareCookCornDineDuckFallFishFoodFullHopeHugsKaleLoveMealMeatNutsOvenPotsSailStirTrayAcornAromaBasteBeansBisonBreadCarveCaterCropsFeastFloatGooseGourdGravyKayakPeacePecanPrideRoastRollsRootsSaladSauceServeTastyTotemTripsAutumnBakingClovesCrowdsFamilyGatherGivingGobbleGuestsHearthInviteJoyfulKissesLeavesNapkinNutmegOnionsParadePotato...

Spanish1-PE2 2025-10-08

65 Items: inpendaymaybookdeskyearweekjunejulymonthtodaymarchaprilfolderpencilmondayfridaysundayaugustpleaseseasonwinterspringsummertuesdayjanuaryfebuaryoctoberitś hotnotebooktomorrowthursdaysaturdaynovemberdecemberhow manyitś coldclassroomwednesdayseptemberitś sunnyitś windyyou say...it means...itś rainingitś snowingfall,autumnmale studentmale teacher...

vocab 2 2024-09-11

63 Items: enhoyhaymayoluneseneromarzoabriljuniojulionievael anoel diael mesmananamartesjuevessabadoagustollueveviernesdomingooctubrecuantosse diceel lapizel libroferbrerohace solel otonola semanamiercolesnoviembrediciembrepor favorhace frioel veranola carpetael pupitreseptiembrese escribehace calorel cuadernoel profesorhace vientola estacionel invierno...

halloween 2025-09-11

177 Items: batboocatelfhatowlRIPwigbonecapedarkdeadevilfallfeargoryhowlmaskmistmoonogrerobetogatutuwandalienangelbeastblackbloodcandycarvecloakclowncrowncryptdeathdemondevileeriefairyfangsgenieghostghoulhauntmagicmummynightninjapartyprankrobotscaryskullspelltiaratricktrollweirdwitchafraidautumncacklecasketcobwebcoffincorpsecowboycreepygoblingrislymakeupmorbid...

PE2 2025-09-30

64 Items: inpendaymaybookdeskyearweekJuneJulyfallmonthtodaymarchAprilfolderpencilMondayFridaySundayaugustpleaseseasonwinterspringsummerTuesdayJanuaryoctoberyou sayits hotnotebooktomorrowThursdaySaturdayFebruarynovemberdecemberhow manythere isit meansits coldclassroomWednesdayseptemberits sunnyits windyits spelledits rainingits snowingmale studentmale teacher...

Spanish vocab 2 2025-09-30

65 Items: inpendaymaybookdeskyearweekjunejulymonthtodaymarchaprilfolderpencilmondayfridaysundayaugustseasonwinterspringsummertuesdayJanuaryfebuaryoctoberyou sayits hotnotebookthursdaysaturdaynovemberdecemberhow manyit meansits coldclassroomtommorrowwednesdayseptemberits sunnyits windyIts the ofits spelledits rainingits snowingmale studentmale teacher...