end of school Word Searches

Saturday Night Puzzling 2025-11-15

14 Items: crosslikefkin uglyout of timenot effectiveof lower statusa little yiddish townan intricate imitationsymbol of luck or fatea small child, urchinlikehaving ones curiousity picqueda terrible car/bad deal, a ripoffornamental artstyle of the 18th centuryarchetype of an unsophisticated young womanan uncontrollable convulsion, response to fear or cold

Equilibria Word Search 2025-08-14

10 Items: the amount of a substance produceda reaction that does not go to completionYield oppose direction and an explanation.The equilibrium constant given in units of concentrationthe moles of reactant/product divided by the volume in dm3the amount of reactants/products at the start of a reaction....

Annuities 2023-07-19

29 Items: the property of a deceased individualbe "appointed" to sell a specific company's productsA legal binding agreement between two or more partiesThe basic amount of investment, exclusive of earningsRefers to the monthly anniversary of the "day" of issue for a Policythe person whose age is used to determine the amount of annuity income...

Balkanization Word Search 2023-12-01

37 Items: - a force that divides people and countries- A nationality that is not represented by a state.- state with more than one nation within its borders- A country who's population share a common identity.- nation that stretches across borders and across states- A strong feeling of pride in and devotion to one's country...

Clothing 2026-02-04

25 Items: – a warm knitted top– a casual top with a hood– open shoes worn in summer– clothes worn for sleeping– a short coat worn outdoors– something worn on the head– clothing worn for swimming– a soft hat with a hard front– a casual top with short sleeves– footwear for walking and running– a smart top worn mainly by women– strong shoes that cover the ankle...

Genesee Lake School Goats 2025-10-17

18 Items: GusGertBillygrassEugeneGatsbyfridayherodayMsMeganmascotdayspiritweekholidaydayrainbowdaylifeskillsdaregreatlyindependenceleisureskillstransitionclassroom

toy and school things 2026-05-13

18 Items: toycarbuspenboxbagballkiteboatdollbookdeskplanerulerchairpapereraserschoolbag

4th quarter at school 2017-03-27

18 Items: WinPushTestsFocusStudyFinishStrongGradesSummerSportsRewardStriveFreedomClassesBehaviorSwimmingStrategyConsequence

Rooms at a School 2025-03-31

18 Items: GYMMAKERLIBRARYARTROOMSTORAGEHALLWAYKITCHENRESTROOMRECEPTIONCAFETERIACLASSROOMMUSICROOMSCIENCELABPLAYGROUNDAUDITORIUMSPORTSFIELDCOUNSELORSROOMPRINCIPALSOFFICE

Sunshine Word Search 2024-03-01

16 Items: beachrelaxbloomPLATESCHOOLA BOOKsmoresflowerssunshinebarbequecampoutsCLEANINGvacationrelaxingmosquitosgardening

Keywords related to American Revolution and Declaration of Independence 2026-01-30

37 Items: ActLifeActsActsActsRightsRightsBritainLibertyTyrannyProtestBoycottby JuryFreedomColoniesTaxationMassacreCongressSoldiersEqualityColonistsTea PartyJeffersonRebellionRevolutionParliamentGrievancesGovernmentand ConcordSovereigntySovereigntyIndependenceof HappinessRestrictionsRepresentationof Independenceof the Governed

Guinea pigs! 2025-06-15

19 Items: An orange vegetableThe act of eating faecesAn animal that eats plantsTerm for a male guinea pigThe technical name for pooTerm for a baby guinea pigTerm for a female guinea pigA type of hay from oat grassCaused by a lack of Vitamin CA type of faeces to be consumedThe genus guinea pigs belong toA breed known for their spiky fur...

DNA & Cell Cycle 2025-10-23

12 Items: Unzips DNA helixDNA is in the shape of aGuanine always pairs withIn DNA, Adenine always pairs withCondensed DNA, humans have 46 of themAdds nucleotides to the new DNA strandThe process of cells growing and dividingA section of DNA, controls cell differentiationSugar found in DNA, makes up the sides of the ladder....

Hannah & Allen 2025-08-21

27 Items: Allen’s hometownAllen’s first carAllen’s first nameCouples dog’s nameCouples cat’s nameHannah’s universityMonth Allen proposedGrade the couple metLast name they shareHannah’s maiden nameCouples favorite beerHoneymoon destinationLocation of engagementCouples favorite liquorName of elopement venueHannah’s favorite seasonCouple’s favorite TV show...

Kenny’s Great Big Word Search! 2026-02-13

10 Items: Your car name“Will you be my…?”Your favorite colorYour favorite artistYou say this word a lotYour (OUR) school mascotOur favorite meal to cook together“You make me feel like I’ve been locked out of…”Where I had Indian food with you for the first timeThe name of the cafe we had our first date location in Oxford

Derivative Word Search 2025-12-08

15 Items: carelessgreat carea human upper limba fleet of warshipfor the reason thatcare taken in advanceexpressing or indicatinga formulated thought or opiniona reason for an action or conditionthe quality that appears to the possessor as dignitythe quality or state of being worthy of honor or respect...

Welcome Back To School 2025-08-08

18 Items: RonBri'NoahAltanChloeRandyKarisNesiahOliviaLamariRaiquanDesireeRayshaunChristianJohnathanSemVictorMainaichaHeavenleigh

Back-to-School Balance 2025-08-19

18 Items: PlanSleepFocusEnergyDinnerUnwindMindfulCarpoolRoutineLaundryLunchboxScheduleOrganizePatienceHydrationGratitudeGroceriesPrioritize

Secondary school (JCS) vocabulary 2026-03-31

18 Items: FORMTUTORTUTORGROUPRESPECTFULUNIFORMCARDMEDICALROOMRESPONSIBLERECOGNITIONHOMEWORKCLUBBESAFEBEKINDREADYTOLEARNCONSEQUENCESGOOGLECLASSROOMSCHOOLCOUNSELLORNOSEENOHEARNOUSEATTENDANCEOFFICERHOMESCHOOLAGREEMENTSTUDENTSUPPORTOFFICERSLEARNERSUPPORTDEPARTMENT

2023 LEONARD UIL ACADEMICS - REGIONAL BOUND 2023-04-10

26 Items: hightorijettwillgabeabnerjessebrodykylahtrentsadiekaylischoolalexisshelbybrookexavierrachelsydneegreggoleonardbrielleobbdelytrinitycrawfordsavannah

Emily's Birthday Wordsearch 2024-07-06

26 Items: emilybeachindiaforestschoolswalessummerlondontennisholidaybelfastteesideenglandirelandsixteenfifteenpresenthartburnfootballstocktonfourteenbirthdaynewcastleaustraliapaperclipselectricity

Ms. Parr's Class 2025-05-14

26 Items: PARRAPEXISAACEMILYELIELKEIRACOLTSPEYTONKAINOAHAILEYJULIANESAMEYCARTERNATHANHARPERRAEGANKARINASCHOOLMARLOWEGERARDOMICHAELCAMILLELINCOLNELEMENTARYMIDDLECREEKHOLLYSPRINGS

PYP4B WORD SEARCH 2025-05-19

26 Items: GODELIDAVEEMMYNOORAKKADANITAANTONELENAISAACMIRELSMARTTATIABRONELDANIELLILIANMARYAMMSANNESCHOOLSHANYASHIBLAADRIANEMANUELMarqardakhMOTHERMARYINTERNATIONAL

Review 2025-06-23

26 Items: bedflytimelateplayletsbikeridelunchclasshurrygetupdronesorryworrydinnerschooleleventwelvethirtysoccertennisbaseballbreakfastbadmintonbasketball

Heart Words - Year 2 2025-08-19

26 Items: allputwhosawwantballcalloversomewereyourwhattherecouldwouldsmallotheraftershouldmotherschoolpeoplefriendbrotheranotherbecause

JHS1 SDG16 2025-11-22

25 Items: mapyoucitytownfoodtripflaggamedrinkmusicdancevisitphotohellopeacefriendfamilyschoolcountrycultureteachertouristlanguagefestivalfriendship

TB3 U4 2025-12-14

26 Items: labvetchefnursepilotgardenofficeschoolstudiodancerdoctorwaiterfactoryhospitalgardenerarchitectastronautdetectiverestaurantaccountantfirefighterbuildingsitespacestationphotographerpoliceofficerflightattendant

UNIT 1 VOCABULARY 2026-02-13

26 Items: boymapseegirlhearhelpnametimecounthellosmelltastetouchcirclecivicsfamilyleaderschoolshapesgoodbyehistorymeasurestudentteachereconomicsgeography

:) 2026-03-23

25 Items: TOBOYBLUEBOOKGIRLUNDERAUTUMNFRIDAYJACKETMONDAYMONKEYSCHOOLSPRINGSUMMERSUNDAYWINTERYELLOWTEACHERTUESDAYPULLOVERSATURDAYTHURSDAYTROUSERSWEDNESDAYPLAYGROUND

things around me 2026-04-21

26 Items: gumdesksinkshowowalaboardchairconesposterlaptoptowelsiphonegrapeslightsswitchschoolairpodspoptartstoargestanleyredbullsciencetextbookbackpacknotebookclassroom

Words 2026-04-28

26 Items: pinkbluenextgreenpurpleyelloworangemondayfridaysundayschoolsocceracrosstuesdaybetweenthursdaysaturdaycafeteriabathroomswednesdayfreezetaghopscotchplaygroundhideandseeknursesofficeprincipalsoffice

random 2026-05-18

26 Items: hardworkruddstudyboardminorbraggjcclcschoolcountypinsonrespectmcadorywarrioredmentumdistrictoakgrovejeffersoneducationdisciplinegardendalefultondalecounselingalternativeclaychalkvillemortimerjordan

Cobie EOW4 2026-05-21

26 Items: badgoodbestcoolhobbysportworseactorfunnygreatmovieschoolTVshowwriterbetterfamouspersoncircusjugglesubjectamazingathletepopularacrobatfunniestgreatest

Word Search 2026-06-01

26 Items: avacookfivesafemathclasslunchcraftsiennaschoolmoussarecesschelseafriendsplayingengagedwilliamgeorgiescienceenglishhistorylearningvictoriaemmanuelrespectfultechnology

Discern Word Search 2023-12-20

10 Items: parishbishopdiscernmandateof Faithcelibacyseminarydalmaticof bishopsinfallibility

Have you earned your tomorrow 2024-07-17

10 Items: What is almost over, according to the poem?What is "slipping fast" according to the poem?What informal greeting is mentioned in the poem?What does the poem suggest you might have earnedWhat emotion might someone feel for a deed you did today?What word describes the type of greeting given to a friend?...

Voca 6000 Lesson 15 & 16 Review 2026-05-06

14 Items: probablyin place of; ratherpleasant toward othersthe time of life when you are youngclose to what is usual, average, or standardsomething that is done for a specific purposeto get more of something that you already havea person who rents his or her property to othersdifferent, better, or more important than the usual...

Key Terms chapter 18 2023-04-14

27 Items: walkinglying face downstyle of walkingfluid-filled sacsside-lying positionlocal death of tissueresting on their backHOB is at 60-90 degreesHOB elevated 30-45 degreesDense, hard connective issuepatient resting on their sideis Also known as body mechanicsoccur from pressure on the skinfibrous connective tissue-cushion...

Silberquit 1/27 2025-01-27

25 Items: hugerelating to birdspeople that came beforethings that came beforesavagely intense, fierceat the beginning; first.a cruel, oppressive rulerextremely large or great.not appropriate or fitting.a comparison using like or asa collection of valuable items.able to move quickly and easily.words that imitate natural sounds....

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

English for Engineering Review 2025-12-09

28 Items: not easily bentSI unit for massmoney that is lenta five-sided polygonthe bottom of a wavethe shape of a columna unit for measuring anglesthe simple machine that is a rampa tool for turning screws by handto decrease the speed of somethingdetailed list of all the items in stockrelating to numbers; expressed in numbers...

CH 12: Pancreas 2026-04-08

27 Items: HORMONE THAT LOWERS BLOOD SUGAR.HORMONE THAT RAISES BLOOD SUGAR.MOST COMMON CAUSE OF PANCREATITISENZYME RESPONSIBLE FOR FAT DIGESTION.THIS ENZYME RISES FIRST IN ACUTE PANCREATITISCELLS THAT PRODUCE PANCREATIC DIGESTIVE ENZYMES.CLASSIC IMAGING FINDING IN CHRONIC PANCREATITIS.INFLAMMATORY SPREAD ALONG FASCIAL CAUSING EDEMA....

Music Appreciation 2026-04-20

15 Items: Why did Bach write music?Composer of The 4 SeasonsDisatance between two notesDistance between a G and a GComposer of Peter and the WolfWhere Water Music was preformedSeveral single notes that can be sungdescribes how long a note should lastseveral notes together that form chordsThe closing section of a piece of music...

CR Chemical Reactions Challenge 2024-08-02

28 Items: the thickness of a liquidsolid, liquid, gas, or plasmaanything that has mass and volumethe amount of matter in a substancethe amount of space a substance takes upthe amount of mass within a given volumetwo or more elements that are chemically bondedthe ability of a substance to catch fire and burnthe ability to easily transfer heat or electricity...

: The Consequences of the Industrialization 2022-12-01

26 Items: The action or process of appeasing.Centralized control by an autocratic authorityTreaty that ended the first Opium War in China.A law that restricting Chinese immigration in the U.S.A law that restricted non-European immigration in Australia.A German philosopher that came up with the theory of Communism....

April Word Search 2026-04-29

13 Items: What does GTM stand for?Name of our smallest watchAprils townhall safety topicWho won last month's word search?The largest trade-only event for divingWhat is the third word? Powerful, Simple,...Full FIRST name of our Sun Run team 1st place winnerName of our product that is used to monitor air levels...

Stock: Word Search 2024-08-25

22 Items: The financial deficit that occurs when expenses exceed revenue.The potential for loss or the variability of returns on an investment.The practice of spreading investments across various assets or sectors to reduce risk.Money earned from various sources, such as wages, investments, or business operations....

Huldrych Zwingli 2025-03-20

10 Items: AffairsDialogueInfluenceand Theologyof Educationin Political andof Church Practicesof a New Communion Theologyof the First Protestant Churchin the Reformation Biblical Preaching

Tommi’s Game Night 2025-12-19

31 Items: AjaKimJadaJujuDUPRNCAAParisJesseNadiaJeromeLinseyWinnerJasmineMarissaShakirahAdrienneKimberlyAnaliciaChristinaCapricornMamaTommieMy hometownMy favorite colorMy favorite pastimeMy undergrad mascotMy favorite accessoryCutest pug in the worldMy favorite sneaker brandStreet name of my new homeSport Tommi played in college...

Nikola Tesla 2024-10-30

20 Items: – Tesla’s famous rival– Device Tesla improved– The basis of Tesla's work– Tesla’s numerous creations– Key concept in Tesla’s studies– Type of current Tesla developed– Tesla’s workplace for experiments– Part of Tesla’s famous Tesla Coil– A device Tesla used in experiments– Tesla explored this type of radiation– Key concept in Tesla’s electrical work...

gg no re 2026-02-17

35 Items: timecellatomvirusfungiplanetquasarprotonorgansbananaphysicsneutronorganicjupiterbiologyelementgeneticasteroidelectronmoleculevelocityskeletalbacteriaastronomychemistrylymphaticaminoacidEquipment used to measure volume of a liquidA cylindrical glass container for laboratory usePiece of equipment used to hold multiple test tubes...

USH2 Semester Exam Review 2026-05-13

20 Items: - 37th President— a very powerful bomb— fee required to vote— a fast military attack— a ruler with total control— limited amounts of supplies— mob killing without a trial— mass murder of Jews by Nazis— competition to explore space— separation of people by race— alliance of Western countries— stopping the spread of communism...

Chapter 7, Part 3: Digestive Terminology 2026-05-13

26 Items: THE SLIMEAN ENZYME OF FATRESEMBLING MUCUSTHE ACT OF CHEWINGENLARGED ESOPHAGUSPERTAINING TO MILKYPERTAINING TO BLACKPERTAINING TO MUCUSPERTAINING TO DEATHA CONDITION OF DEATHTHE MOUTH AND THROATVIEWING OF THE ABDOMENTO CUT INTO THE ABDOMENFIXATION OF THE OMENTUMPERTAINING TO THE TONGUEA BLOOD CONDITION OF FATPERTAINING TO THE MIDDLE...

Biodiversity word search 2025-10-08

9 Items: The cross-breeding of two different species.The number of different types of species in an ecosystem.The physical appearance and characteristics of an organism.All the individuals of the same species living in an ecosystem.Individuals of any given species can have subtle differences or traits....

jajshajjsjs 2023-05-31

10 Items: Pairs with thymineOrganic compounds used to store energyIn the double helix pairs with cytosineConverts the instructional genetic information stored in deoxyribonucleic acidEach nucleic acid has this, a 5-carbon sugar as a part of its polymer backbonePortion of the DNA double helix that provides structural support to the molecule....

4B Back to School 2025-08-15

18 Items: JoiLilyKaliZskyaKyleeJyrahPaytonJeRyahAmiyahMarcusJordanAaliyahDerionaJaliyahMadalynKacsidyLadaishaCherrish

American high School Clubs 2025-11-09

18 Items: clubartschessdancesportmusiccookingkeyclubfootballwrestlingnewspapercommunityjuniorROTCHighschoolleadershipcheerleadingstudentcouncilexchangeprogram

28. High School Sports 2026-02-15

18 Items: TRACKCOACHTROPHYHELMETGLOVESJERSEYSPIRITWHISTLEUNIFORMSTADIUMVICTORYFOOTBALLBASEBALLTEAMMATEBLEACHERSBASKETBALLSCOREBOARDCHEERLEADER

Chapter 20 Word Wise 2026-04-20

12 Items: When two air masses meetWhirling tropical cycloneA front that does not moveThe center of the hurricaneA cold front that overtakes a warm frontA storm that generates lightening and thunderA dome of water of about 65-80 kilometers wideWhen warm air moves into a region of cooler airDoughnut-shaped wall that surrounds center of storm...

KVCS Zoology Week 1 Vocab Quiz 2023-09-02

20 Items: The study of plantsPlants that live for two yearsPlants that grow year after yearPlants that live for only one yeartype of adjective that modifies nounsFlowers that have both stamens and carpelsTakes the place of common and proper nounsA mature ovary that contains a seed or seedsFlowers that have either stamens or carpels, but not both...

NUR155 Miss Brown Exam 2 Vocabulary 2024-11-05

41 Items: Low SodiumIrrigationFiltering UnitLoss of appetiteInflammation of a veinCan cause renal calculiWound Ostomy Care NurseDifficulty in swallowingCauses cellular swellingAny fat found in the bodyPulls water from the cellShould look red and beefyMalignant growth in colonNarrowing of blood vesselsSurgically created openingInability to control urine...

ELIZABETH AND JACE 2025-05-31

40 Items: Jace's hometownJace's first carWhere Jace proposedMonth Jace proposedElizabeth's hometownMonth of the weddingHoneymoon destinationJace's degree programJace's favorite colorElizabeth's favorite foodJace's favorite accessoryElizabeth's favorite bandElizabeth's favorite colorElizabeth's favorite craftThe best box brownie brand...

Medieval Europe 2025-10-01

50 Items: Same thingSimilar to SerfsThe Last KingdomByzantine EmperorHome to the MonksLatin for KingdomSomeone who fishesFormer Roman EmpireNo one expects thisSimilar to PeasantsUnited Western EuropeReferring to the PopeTitle "Caesar" - GermanAnother term for a kingPunishment used by PopesLand granted to a VassalTitle "Caesar" - Russian...

Flowers 2024-03-25

30 Items: irisrosedaisypoppyglorypansytulippeonyvioletorchidjonquilfreesiadaylilydaffodilsweetpealarkspurgladiolamarigoldprimrosemagnoliahyacinthcarnationwaterlilysunflowerdandelionbluebonnethoneysuckleof paradiseof thevalleychrysanthemum

Have fun 2024-04-26

12 Items: Egregioussweet or musical pleasant to hear.hazy, vague, indistinct, or confuseda group of people that make decisionspleasant odor that is associated with rainexisting or being everywhere at the same timefull of, marked by, or causing complete happinessgood luck in making unexpected and fortunate discoveries...

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

BF130 Chapter 10-17 Review 2025-10-13

13 Items: an intentional misrepresentation of a material factBreaking into a building with the intent to commit a felonyA legal doctrine indicating that parties meant to do what they did.Written defamation, or defamation published over radio or televisionan artificial, intangible entity created under the authority of a state’s law....

Prefix Suffix Level 3 2026-05-26

18 Items: Tell beforeWarn beforeAct betweenBeing loyalBeing royalPart formalChange formMade of woolBehave wrongDoing talkingBetween statesFull of courageHigher level heroCause to be in dangerHaving to do with artAct or process of pollutingAct or process of discussingHaving to do with electricity

Les quantités - au marché 2024-06-20

15 Items: merci: t_a_ksde rien:it's n_th_ngs'il vous plaît: p_e_sedouze oeufs: t_el_e e_gsde la salade: so_e s_ladcinq citrons: fi_e l_m_nsje voudrais: I wo_l_ li_evingt oignons: t_enty o_io_sdix chou-fleurs: t_n ca_l_flo_ersun kilo de poisson: a ki_o of fi_hune tranche de jambon: a sl_c_ of _amune bouteille d'eau: a bo_t_e of w_ter...

word search 2025-12-11

12 Items: taxLara2025darcyBuddyArianaHarperfamilySchoolmayfieldphillpotCharlotte

Quaker Word Search 2026-04-30

11 Items: pewmarylighthouseQuakerbonnetfriendschoolplainnessmeditationmissionary

First Day of School WAP 2025-09-11

6 Items: gluebluelearncrayonpencilfriend

Chapter 3 2023-05-25

47 Items: digcowwinoldendleozoetubebodydusttinywaitexitclawroomsafecavelandgamewallemmaryansmellsweatsharpstoneemptycountboardusefulburrowtunnelpickupplayerbernieconnectbreatheexplorelanternjessicaquintuspaintingtreasurescientistmysteriousbellybuttonunderground

Curling 2024-01-08

47 Items: endwcfpadcasacurlgaratiromiracavamanoskipzonalatofisgpuntisassiscopastoneperthcampodiscorossofallolineaforzacolpianellilanciopietrescoziacanadatorneostaffapebblegiallocoronagallestreforgranitoscacchispiralesquadraopenairbottoneghiacciostrategiaavversario

Chronic Illness and Acquired Disability: Quality of Life 2025-11-26

11 Items: MSK chronic conditionMental health chronic conditionResponding adaptively to chronic disabilityLoss of this can involve a grieving process and adjustmentsWhat a patient might set themselves as part of their recoveryWho else is involved in improving their quality of life (inits.)(Something), psychological and social functioning needs to be addressed...

The Universe - Vocab Review 2026-04-29

24 Items: is the current leading theory as to the origins of the universe.the large dust cloud that surrounds the accretion disk in a quasarthis galaxy type will be a flattened disk with a central bulge and spiral armsthis galaxy type will be spherical or oval shaped, older with very little gas/dust...

Series 3, Unit 2 mid-review 2025-10-24

15 Items: an exact replicathe study of lifethe study of skinthe outer layer of skinmakes small sounds loudera text about someone's lifea small piece of technologya device that measures stepsan image recorded using lightsame measures opposite one anothera device that sends sounds a distancea device used to see very small things...

Months of the year facts 2025-08-19

12 Items: In this month, the sandwich was created.This month was named after a Roman purification ritual.This month has never seen the death of a U.S. President.The diamond is the birthstone associated with this month.The Anglo-Saxon’s name for this month was “Winterfylleth”.This tends to be the warmest month in the northern hemisphere....

community places 2025-11-21

10 Items: mallshopparkbanksalonchurchschoolstationhospitalsupermarket

Judith life 2025-04-04

11 Items: winefaithtrustJudithstrongsixteentestamentHolofernesplan of attackoverindulging,hymn of Deliverance

Ekev2024 2024-08-17

18 Items: עֵקֶבA carved image.Lack of success“Commandments” Hebrew“do” “build”, Hebrew.Written on the tablets“The fruit of the vine”This fruit has 613 seeds“food” in the wilderness.“Staff of Bread” Leviticus 26:26The ark was made from this wood.All who live by this have success.This tree is said to have no wasteThe sight of the Temple, Jerusalem....

(Chase horne ) andrewclements  2014-12-04

25 Items: readmoanlakeswimfishBookssixthCamdenschoolguitarstudiosisterpoetrysummerOaklandwritingEnglishcollageChicagobrotherfriendleIllinoischerryhillcraftpresspublishing

Congratulations, Great Oak Graduates 2015! 2015-06-05

25 Items: samcapoakpromgownhightestsgreatonwardschoolbriannaanaliseanthonybrandonnataliespeakerdiplomaceremonytemeculagraduationdisneylanduniversitycelebrationcommencementannouncements

10FA5 Integrated Studies Word Find 2018-09-24

25 Items: LEVITINAEMMAARIKIDYLANTERRIETHANJULIAMAORICHOZENRUEBENTIARAHSCHOOLBOSSTYNMICHAELMANAAKICULTUREHERITAGEFLAXMEREKAILIZANETYLAHROSEOSHYEANNAHINTEGRATEDNEWZEALANDENDANGERED

Dragon Hoops 2020-07-13

25 Items: winoutteamslamdunkgametimeboyshoopscoachgirlsclockdragonsportsjammedschooljumpingathletevarsityhalftimesneakersbasketballscoreboardchampionshipsportsmanship

thème  2020-11-07

25 Items: catdogcarredboyliongoodnineeasygirlbikelovezebrahippohousebrowntablewomenfridaystrongyellowschoolfatherelephantteatcher

lilys favorite things word search 2020-11-30

25 Items: tviceartdogscatsfarmcreamgameshorsesadroitschoolanimalsfriendsbeakingkittensunicornsbabyyodaChristmasHalloweencornmasesdecoratingclaudmonaybuildabearstuffedanimalshorsebackriding

Go Straight and Turn Left 2021-05-23

25 Items: leftturnbankcafemallparkwhererightblockbeachcornerschoolbakerypalacetemplemuseumlibrarybusstopstadiumtheaterembassystraighthospitalrestaurantpolicestation

Go Straight and Turn Left 2021-05-23

25 Items: leftturnbankcafemallparkwhererightblockbeachcornerschoolbakerypalacetemplemuseumlibrarybusstopstadiumtheaterembassystraighthospitalrestaurantpolicestation

Word Search 2023-03-21

24 Items: foodtipsPlusrugbyDecorsleepskiingsophiesophiehockeymoviesschoolsportsjewleryfriendscluelessskincarehomeworkstudyingteenagerspagehttiactivitestravelingentertainment

summer 2023-07-26

25 Items: funartlovegamefoodmusiclaughbooksdancepartybeachmemessquadschoolsportstravelmoviesselfiesocialsummerfriendsfashionfitnessadventuretechnology

Jaxson's Word Search 2024-05-15

25 Items: reddogkindnineblueknoxnicecoolsmartbravesportfunnyhockeystaffyschoolteacherfishingicecreamdirtbikecreativeconfidentchocolatemeatballswritingjournalcurriedsausages

,tk 2024-05-20

26 Items: nohimeusyayyeswhynowwhowhybyeboymanmenyouwhenbookgirlmalehandfoothorsewherehellowomenschool

4° ano 2024-12-12

25 Items: catdoghenlionmallfarmzebrahipposheepbeachhorsenightschoolsoccerbakerycinemaroostermorningelephantdrugstorevideogameafternoonvolleyballbasketballsupermarket

Our Town 2025-02-19

24 Items: zooparkbankfarmhousehoteltowermuseumofficetemplecastleshrinechurchschoollibrarystationstadiumtheaterairporthospitalaquariumbookstorerestaurantsupermarket

Ms. Bernstein's Class 2025-03-21

26 Items: SkyeRemiZoeyJojoAdamBowieImaniAyronKeeganAustinJanuszCaedenMatiasAubreeSchoolsecondspringMadisonBarrettMathewsSantiagoChristianChristianBernsteinElementaryTimbertrace

Fourth Grade 2025-04-14

25 Items: betelaKEStestslaymathbuzzsigmaAprilspringpreppybaddiehornetsummerschoolfourthrizzlerskibityMissFolkKirtlandMrsGodinabutterflyMrsCovelliMrsMcBrayerMrsLafferty

Congratulations Word Search 2025-04-29

24 Items: CAPGOWNCLASSPARTYSCHOOLALUMNIAWARDSFUTUREHONORSSENIORCOLLEGEDIPLOMAFRIENDSSUCCESSTEACHERCEREMONYCELEBRATEEDUCATIONGRADUATIONUNIVERSITYCELEBRATIONCOMMENCEMENTACCOMPLISHMENTCONGRATULATIONS

SEVENTH GRADE 2025-05-07

25 Items: GYMNOUNFACECRUSHSCOWLHAPPYCLASSSCHOOLLINGERTRUDGECLEVERSUMMERFRIENDSTEACHERANXIOUSNERVOUSSEVENTHEMBARASSELECTIVEFEROCITYHOMEROOMPOPULACEMOTIVATECATECHISMPROPELLED

Welcome Word Search 2025-05-20

25 Items: DeskRulesGoalsSchoolLockerWelcomeTeacherStudentRespectRoutineScheduleSuppliesHomeworkLearningBehaviorTeamworkKindnessClassroomQuestionsFriendshipAssignmentExpectationsInstructionsCommunicationResponsibility