end of school Word Searches

AMERICAN CULTURE 2024-10-17

19 Items: PIEDAYDAYROLLFOODFOODCREAMHOTDOGSTATESFREEDOMJULY4THBASEBALLBASEBALLHAMBURGEROF LIBERTYTELEVISIONAND STRIPESOF THE BRAVETHANKSGIVING

Stages of Life 2024-10-08

7 Items: neophobiafear of aginggerascophobiafear of deathstages of lifefear of changemetathesiophobia

Harrisonburg Word Search 2024-10-09

24 Items: Bride’s birth monthGroom’s birth monthHoneymoon destinationBride’s favorite showColor of bride’s eyesColor of groom’s eyesGroom’s favorite hobbyWhere the couple livesCouples favorite liquorBride’s favorite cookieThe couple’s dog’s nameBride’s favorite singerMonth the groom proposedCity where the couple metType of dog the couple has...

Burrell College Word Search 2022-10-13

8 Items: bearschooldoctorCrucesfutureburrellcollegemedical

wed 2025-08-26

8 Items: liamsuitringlovedressschoolbouquetmackenzie

The Reign of Terror 2025-11-23

15 Items: XVIReignTerrorDantonFranceJacobinsTribunalculottesGuillotineexecutionsAntoinetteRevolutionRobespierreof Suspectsof Public Safety

Where is this Event? HARD 2026-02-05

14 Items: 1873170218671989RihannaJunkanooGod of WineZulu and RexSamba SchoolsTwelfth Night16 hours a dayDaniel GarfieldCarnival of IvreaCarnival of Viareggio

Health Word Search 2025-03-28

12 Items: C of DECIDE1st D of DECIDETop cause of death in the US.Your relationships with others.Achieving health in all three areas.____ Stress: An impact on our mental health.The health of your body & how well it functions.The things that you believe are important in life.The ability to deal with emotions, health of the mind....

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

Photosynthesis Word Search 2025-03-23

20 Items: A large, slow-moving mass of iceA dry region with little rainfallThe layer of gases surrounding EarthEarth’s spinning movement on its axisThe second layer of Earth’s atmosphereThe path a planet follows around the sunA mountain that erupts with lava and gasesA piece of land nearly surrounded by waterRain, snow, sleet, or hail falling from clouds...

Exam Revision Word Search 2025-11-15

24 Items: A nerve cellA mental categoryThe fear of being without ones phoneTaking pleasure in someone else's painThe acronym for the Fear of Missing OutNon-biased information that is measuredVygotsky's Zone of _________ DevelopmentThe image used to represent an emotion onineThe positive outcome of Piaget's first stage...

“Difficult Choices in Poland” from Facing History and Ourselves 2026-03-19

30 Items: Nazi secret policeDangerous or unsafePeople living nearbySmall rural communityPersonal benefit or profitSilent or unspoken approvalWoman who hid Jewish childrenKilling of many people at onceReporting others to authoritiesKilling of individuals or groupsCooperation with the Nazi regimeActs of retaliation or punishment...

Mr. Kaiser's Georgia Studies Review 2026-04-29

20 Items: Elected President in 1860Trustee who founded SavannahGeneral who Marched to the SeaThe only president from GeorgiaUsed the New Deal to create jobsThe bomber plant in Marietta during WWIIJewish man who was lynched by a Marietta mobThe period of rebuilding following the Civil WarA type of WWII ship built in Savannah & Brunswick...

Holy Word Search 2024-09-27

24 Items: BEGODARKSOULMARYMASSLOVEGIFTSJESUSJOSEPHOF GODCHURCHNOVENAFATHERTRINITYCREATORAND EVEBELIEVEALMIGHTYCREATIONGENEROUSDISCIPLESGENEROSITYOF CONTRITION

LA 2023-10-25

21 Items: Poor balance and coordination:________Involuntary, uncontrolled movement:__________This type of spina bifida is the most severe:________Pre-, peri- or post-natal brain hypoxia:________ ________Velocity-dependent resistance to passive stretch:________Joint stiffness and deformity as a result of fetal akinesia...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

Citystate Word Search 2026-01-07

24 Items: God of war(战争之神)God of the sea(海神)The exchange of goods(贸易)God of the underworld(冥界之神)Rule by wealthy landowners(贵族统治)Traveling and trading by sea(航海)Goddess of love and beauty(爱与美之神God of the sun and music(太阳与音乐之神)Government where citizens vote(民主)Land almost surrounded by water(半岛)Rule by a small powerful group(寡头政治)...

Patti's Word Search 2023-01-20

24 Items: Involved animalCommitted animalPredicting effortTemporal limitationA weird water carafeAKA Leonardo of PisaPenultimate ceremonyDelta x over delta tShort consistent cycleBefuddled interrogativeHow much can we completeBreaks down into storiesEvery morning, with a rockPrioritized work to be doneWe do this with the backlogSlows or hinders productivity...

summer 2019-06-13

7 Items: notansunbeachschoolvacationsunscreen

HAWK HEIST CLUE 2023-01-06

7 Items: hawklockblueheistschoolfearfullakeridge

Parkingzone Word Search 2022-12-23

7 Items: parkschooltheatrehospitalparkingzoneswimmingpooltrainstation

City 2024-11-03

7 Items: caféshopbankmuseumschoollibraryhospital

TAI CRUNCH SEARCH 2025-05-08

7 Items: flagTaiwanschoolcrunchCherrytreebluemagpielandofsmiles

September Word Search 2025-06-10

7 Items: mathfallhereclassapplewatchschool

School Life in Yeşilbayır 2025-09-11

7 Items: SchoolGardenCanteenLibraryLunchhallSportshallPlayground

University Word Search 2025-10-11

7 Items: beachschoolmuseumchurchtheaterlibraryuniversity

Fersen 6/3/2026 2026-03-06

7 Items: MEDIAHOBBYCHURCHFAMILYSOCIALSCHOOLFRIENDS

Anatomical Tooth Definitions - Equine Dental 2025-03-31

20 Items: Towards the root tipUn-Erupted Portion of the toothPortion of the tooth that is ExposedInner layer, softest material of the toothTeeth situated behind the premolars used for grinding forageNormally buried in bone as they serve to anchor the tooth in positionPermanently damaged area in the tooth that develop decay of the Tooth...

Clinicalreasoning Word Search 2026-01-28

25 Items: The mathematical average of a set of scores.The science of measuring mental capacities and processes.A single piece of information used for analysis or graphing.A measure of how much scores vary or deviate from the average.A consistent and organized method for tracking clinical outcomes....

Word Search Choice Board 2026-03-13

28 Items: BoringOsculumSpawning(sponges)Encrustingas a thin crust on a surface.large opening in a sponge through which water exits.surface the surface of an organism opposite the mouth.release of eggs and sperm into the water by aquatic animals.that bore into hard substrates such as coral, shells, or rock....

Kate's Sky Science Word Search 2023-12-18

20 Items: rocks in spacerederection of lighta belief about the starsthe galaxy where we livegroups of stars in the skyan object orbiting the suna human that travels to spaceanother way to say big dipperthe study of anything in spacewhen something gives off lightanother way to say little dipperwhen a rock safetly lands on earth...

Emma & Oliver 2025-06-21

27 Items: Brides middle nameName of couple's dogName of couple's catColor of grooms eyesGrooms Favorite ShowBrides Favourite showBrides favorite colortop tier cake flavourCity the Groom is frombrides favorite animalBrides favorite holidayCountry the Bride is fromCouples favorite cocktailcouples go to coffee ordergemstone on the brides ring...

A Spring Word Search 2026-02-20

25 Items: A baby duckA newbie treeA spring hobbyRed Breasted BirdA colorful insectMarch 20th EquinoxHow a Tulip startsA story of Kafka fameA Day to celebrate treesShowers bring May flowersA classic yellow raincoatA thatched home for birdsFirst signs of plant growthPink or White blooming treeThe first prankish day in AprilThe warming up from ice and snow...

Surtees Secrets 2025-09-01

30 Items: Their local pubDid somebody say…Brides maiden nameOur new Mr & Mrs...Grooms football teamBrides go to takeawayItalian word for wineGrooms go to pub drinkBrides favourite drinkRiver through FlorenceGrooms favourite takeawayName of the wedding venueCity closest to the venueSparkling wine from ItalyFamous Italian pasta dishWhere the couple first met...

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

Word Word Search 2025-08-17

10 Items: Superspeed calculationsCan be held by your handComputers for personal usePowerful computer for high-end workServes other computers in a networkPortable PCs housed in a single unitSmaller processing power than a laptopPCs in a permanent location, like a deskProcess millions of transactions per dayCan be worn or integrated to other devices

Aren's silent consonant word search 2025-11-07

15 Items: RelaxedNot a rowWhat you knowSign of old ageA part of your handMoving out of the wayThe look of somethingSomebody's personalityTwo of them make a wholeWhen you owe someone moneyPut something in its placeWhat you say for a questionMany things happening simultaneouslyWhen you are not sure about somethingWhen you have negative feelings towards someone

Cuspairean-sgoile | School Subjects 2026-04-28

18 Items: CeòlSpòrsEòlasBeurlaEalainDachaighGàidhligCreideamhFraingaisSaidheansTeicneòlasMatamataigEachdraidhGearmailtisNuadh-eòlascruinn-eòlasis SòisealtaComimpiutaireachd

Christmas and more 2022-12-16

27 Items: elfpolestarjudekerrcarolgravysantaangeljesuscaroljamieturkeypotatocarrotsleighjumperskiingchickenpuddinglaplandsproutsscroogereindeerchristmasof new Yorkghosts of Christmas past

Chapter 2 Vocabulary 2025-08-21

10 Items: ModifyClimateLocationLatitudeGeographyLongitudeCoordinatesof LatitudeDistributionof Longitude

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

Vocabulario - Auténtico 1, Capítulo 2B Tu Sala de Clases 2026-02-17

16 Items: ofmyyoutheheresometherebehindWhere?in, onon top ofit's a...underneathin front ofthere is/areWhat is this?

WORD SEARCH (50 WORDS – CMU CS 1.2 & 1.3) 2026-04-12

49 Items: ENDTOPRGBREDFILLLEFTBLUEPINKGRAYRECTOVALLINEDRAWCOLORSTARTRIGHTGREENBLACKWHITESHAPEWIDTHPIXELBORDERBOTTOMORANGEYELLOWPURPLECIRCLEHEIGHTCANVASOPACITYTOPLEFTPOLYGONCENTERXCENTERYGRADIENTTOPRIGHTVERTICALDIAGONALSEAGREENPOSITIONDIRECTIONLIGHTBLUEBOTTOMLEFTHORIZONTALLIGHTGREENBORDERWIDTHTRANSPARENTBOTTOMRIGHT

Art Functions, Media, Elements of Art, and Principles of Design 2025-01-29

17 Items: FiberPaintMarkerPencilPastelsWatercolorThis element is 3D.This element is 2D, or flat.The degree of lightness or darkness.Materials used for the expression of ideas.Line, Shape, Color, Form, Space, Texture, ValueWhich function of art is made to help meet day to day needs?Balance, Contrast, Emphasis, Pattern, Rhythm/Movement, Unity...

You & I 2025-06-11

30 Items: where I liveseries we watchingforever and ______your favourite babywhat I feel for youyour to be step babyyour favourite flowerwe watch it on Mondayswhere we going to livemovie series we watchingyour other favourite babyI think third favourite babymy second favourite body parttime limit on my love for youyou call me your little ______...

Literary Devices Crossword Grades 11-12 MA ELA Standards 2025-12-22

30 Items: an author’s word choicea word that imitates a sounda comparison using like or asthe emotional atmosphere of a textdeliberate exaggeration for effectlanguage that appeals to the sensesspecial importance given to an ideaa recurring idea, symbol, or subjectthe sequence of events in a narrativegiving human traits to nonhuman things...

Nutrition and Fitness 2025-04-02

37 Items: How often you do the exerciseGood health or physical conditionHow long you perform the activityThe specific activity you are doingA warning sign of chronic dehydrationAn improved benefit of physical fitnessMovement that results in expending caloriesThis can reduce soreness and risk of injuryThis can change without overall weight changing...

Year 6 Grammar Revision 2026-05-09

26 Items: SVOOVSa, an or theto own somethingdescribes a verbdescribes a nounintroduces a nounintroduces a listused to avoid repeating a nounbegins with an imperative verbaction words that tell us the tenseseparates two main, related clausestense which uses verbs ending in ~ingjoins words, phrases or clauses togethera clause that does make sense on its own...

Word of the Day - Word Seach 1-12 2025-08-20

13 Items: Not clear or certainTo run out of energyTo have a bad reputationAntonyms: Trivial, minorControlled by the governmentSynonyms: Labor, strive, plodAntonym: Significant, importantCreatures related to apes or monkeysOpposite meaning: words that make perfect sense"Everyone was so excited to see Kendrick's concert...

Jobs and Future 2025-11-11

40 Items: joblawcareerdegreeskillsmaturerightsnatureto earncapablecarefulto applyto buildto attendto traveleducationambitiousefficientto donateuniversityto improveto achieveexperiencereferencesto provideto protectto supportscholarshipto graduateenvironmenttrade schoolentrepreneurto fundraiseto contributeto get marriedto take care ofdetail oriented...

Noah M 6th grade science 2024-05-16

15 Items: We live hereMade of ironDwarf planetBiggest planetClosest to the sunMars has ___ moonsRoman god of the seaFirst layer of the earthCold winds that blow eastcore 4th layer of the earthSteady winds in 30N and 30SForce that keeps us to earthMost recent rover sent to marsUnderwater quickly cooling lavaMeasure of an objects reflectivity

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Cardiovascular Systems 2025-11-24

9 Items: incision into a veinoriginating in the heartcondition of fast/rapid heart (rate)inflammation of the muscle of the heartabnormal reduction of (all) blood cellsabnormal reduction of white (blood) cellsabnormal reduction of (blood) clotting cellsPhysician who specializes and treats blood disorders...

Roman Numerals 2025-03-24

10 Items: 300 ______39 _________408 __________5,000 _________the current yearfourteen _______XLV __________________ (English word)XV + XV = ________________ (English word)the year of the founding of Rome _________the year of the Declaration of Independence ____________

Emotional Intelligence 2017-02-01

27 Items: JoyFearLoveAngerHappyGuiltPrideShameBoredCryingReliefFamilySchoolGloomyDisgustLaughterSaddenedStressedPleasureSurpriseInterestContemptAmusementDepressedFriendshipsFlirtatiousEmbarrassment

find the animal 2020-11-19

27 Items: catdogcowsadfunlionpigscalfwordhavezebrahippotigerhappyenjoykittentoucanspidermonkeysearchboringschoolelephantconfusedorangutanfelling'sfrustrated

Welcome to First Grade 2025-09-03

27 Items: AxelColeKnoxRowanHenryMabelPennyMasonJacobfirstVioletBiancaCarsonLarkinAdrianElaynaHadleyschoolCharlieGeorgiaEverettMichaelTristanMadelineMaverickPetersonChristian

¡HOY ES SU DÍA! 2025-09-17

27 Items: PENAULABOOKBUCHHEFTLIBROSTIFTLÁPIZSCHOOLSCHULEPENCILESCUELATEACHERMAESTRASTUDENTSCHÜLERLEHRERINLAPICERANOTEBOOKCUADERNOCLASSROOMBLEISTIFTESTUDIANTEKLASSENZIMMERHAPPYSTUDENTS'DAYFELIZDÍADELESTUDIANTEALLESGUTEZUMSCHÜLERTAG

Fall Fun 2025-09-30

27 Items: CORNCOZYFALLSHEASOUPBROWNNYLESAUTUMNCHILLYHEATERJACKETKIANNAKIERRALEAVESNAAMAHORANGESCHOOLYELLOWFOLIAGEHARVESTHAYRIDEPUMPKINSWEATERFESTIVALFOOTBALLCORNELIUSJRTHANKSGIVING

Clio Homecoming 2025-09-30

25 Items: KingBandGameFansRallyBlackDanceQueenRallySpiritParadeBannerOrangeSchoolTrophyMustangCostumeFootballGoalpostTeamworkHalftimeBleachersTouchdownHomecomingCheerleaders

graduation 2026-03-19

25 Items: jobgparingclassgoalsawardhonorschooldreamsspeechresumetasselfuturediplomacollegeand gowngraduateadultingcelebrateacademicsgraduationcommencementbaccalaureatevaledictoriancongratulations

vocab for november 2025-11-12

25 Items: HateAngryDetailedInfamouscheerful; geniala very poor person.Masked ball, disguiseshow or prove somethingharm someone permanentlystrong sense of facinasionA temporary fail in thoughtObstruct someone or somethingCombine one thing with anotherlacking in quantity or qualityconfidence of a person or groupDisfigure or injure beyond repair...

citizenship and responsibility 2024-12-10

12 Items: lawJudeovirtuecitizenreligionmoralityauthorityof powersprovidencecitizenshiprepublicanismof association

Force and Motion 2023-11-27

20 Items: Unit of ForceA push or pullDistance over timeThe amount of matter in an objectDistance over time with a directionAn object's resistance to change in motionthe measurement of paths taken by an objectthe action or process of moving or being movedSpeeding up, slowing down, or changing direction...

Acute Word Search 2024-11-21

20 Items: willful, stubbornto prove incorrectto make peaceful or calm; to sootheoverly self-satisfied, self righteousgreedy; very hungry; eager for satisfactiondeep and painful regret for one's past misdeedsthe lenght of time that something continues or lastscausing fear because of strangeness; weird, mysterious...

Parliament Triumphs Over England 2024-12-17

20 Items: The belief that monarchs are appointed by God to ruleThe army led by Oliver Cromwell during the civil war.One of the charges against Charles I during his trial.The supporters of Charles I during the English Civil War.A serious crime that Charles I was accused of committing.The supporters of Parliament during the English Civil War....

The town 2024-11-25

10 Items: shopstoppoolcaféschoolstreetcinemastationhospitalplayground

Nitrogen Word Search 2026-02-09

18 Items: Harmful substances that pollutes the air.Such activities are not advisable during a haze.haze can cause ________ to our eyes, nose and throat.A method to reduce the number of vehicles on the road.Burning of ______ fuels release pollutants into the air.What acid rain can do to statues and buildings over time...

Indigenous Word Search – Kamloops History 2025-10-09

15 Items: ParkTruthTradeSchoolGravesPowwowKukpi7HistoryTkemlupsCeremonySecwepemcResilienceColonialismAssimilationReconciliation

Car Trivia Table Top Challenge 2025-10-10

10 Items: What does MPG mean in terms of fuel?What is the most popular car colour?Which country is home to the automaker Hyundai?What is the luxury car division of Toyota called?Who is credited with inventing the first automobile?What car brand uses the slogan “The Ultimate Driving Machine”?Which car brand is known for its distinctive diamond-shaped logo?...

PYL3 - Unit 10 - Reading 2026-01-07

16 Items: With a lot of sun. (Nắng)With a lot of rain. (Mưa)With very low heat. (Lạnh)With very high heat. (Nóng)Start something new. (Ra mắt)Find something new. (Khám phá)With a lot of wind. (Gió nhiều)A planned piece of work. (Dự án)With strong wind and rain. (Bão)The level of heat or cold. (Nhiệt độ)Put a file on the internet. (Tải lên)...

Tidals and Waves 2026-03-23

16 Items: an oval-shaped pathlowest point on a wavehighest point on a waveshore area of a body of watersand bars attached to a mainlandtwo high levels and two low levelssun and moon are in a straight linea large wave with a long wavelengthenergy that moves through the ocean;wave that collapses/ destroys the wavegraphic record of rise and fall of tide...

Year 10 Physics, Term 1 - Measurement 2026-02-15

16 Items: Mass × velocity (8)SI unit of force (6)Slope of a graph (8)Push or pull on an object (5)Estimated range of error (11)Rate of change of velocity (12)The “strength” of a battery (7)How close repeated values are (9)Cannot be created or destroyed (6)International standard unit system (6)Important digits in a measurement (11)...

Hayden's Waves Word Search 2022-11-28

10 Items: areas of maximum displacementareas of maximum displacementfrequency is measured by hertzlocation of maximum displacement upa distance of one complete wave cyclelocation of maximum displacement downmeasurement of of maximum displacementa number of waves or vibrations per secondwave, moves the medium parallel to the wave motion...

Courthouse Word Search 2023-10-18

18 Items: Lying in courtPerson who is on the juryPromise to tell the truthAn expression of disapprovalLawyers examination before trialThe official decision of a courtRepresents the defendant in courtThe decision of a jury or a judgeAn invalid trail, caused by big errorA claim that someone has done somethingAsk a higher court to review a decision...

Week 11 hard 2023-11-08

23 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinga main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Voices of Strength 2024-07-20

20 Items: legal entitlements.relating to the home or family.the right to express an opinion.action taken to improve a situation.the quality or state of being strong.public support for a cause or policy.a safe place for those escaping abuse.knowledge or perception of a situation.a condition of being safe or sheltered.the state of being free within society....

Globalization 2025-08-19

27 Items: RejectRelated to homeTesting somethingUsing something upTiring someone outThe buildings of a cityIn relation to somethingTo make sure of somethingThe opposite of inconvenienceTo erase or eliminate somethingThe increase of prices over timeTo leave something or someone outHistorical network of trade routesSomething you are good at is your......

Final Practice 1 2026-03-26

25 Items: more than enoughto feel satisfiedprovide evidence forleave out or excludepertaining to beautyto aid the progress ofclearly express in wordsthe writer's word choicesubtle difference in meaningnot important or significantnon-literal meaning of a wordapparently contradictory termswhen something is about to happenmultiple possible meanings of a text...

Parshat Shemini 2024-04-05

15 Items: Hebrew for "Tabernacle"Moshe gets upset with himHebrew for "Divine presence"Another word for split hoovesKosher fish need _ and scalesHebrew for "impurity" (not found on Chabad)The Torah lists the kosher version of this insectAaron's sons died after bringing this type of offeringKohanim are told not to drink this before doing the avodah...

1989 (Taylor's Version) 2023-10-27

16 Items: This Love: Your smile, _______Style: Could end in _______ or paradiseBad Blood: _______ don't fix bullet holesBlank Space: Grab your _______ and my handOut of the Woods: _______ in a hospital roomNew Romantics: _______ is the national anthemYou Are In Love: Small talk, he drives, _______Shake It Off: My _______ brought his new girlfriend...

Data Rep 2026-02-04

18 Items: the dimensions of an imagethe number of samples recorded each seconddiscreete data that only uses the values 0 and 1a base-10 number system that uses the values 0-9a base-2 Number system that uses the values 0 and 1a continuous stream of data that is processed by humansA base-16 number system that uses the values 0-9 and A-F...

properties 2025-03-10

13 Items: windsillwidthdepthlengthheightweightwindowwindowstrengththicknessof an objectof and object

words 2022-01-26

26 Items: hisisbroeyeredbuscarpanheybabycakekneepinkdeerbluebellpure2022lanelinemilkwhiteblackpaperschoolrights

Vocabulary 2023-11-23

26 Items: gympigbeefatparkpinkcrabpeachlemontigerwatchclerkblacksnakebakergreendirtyhorseclockschoolstrongelevenmonkeypigeonpainterelephant

Eesti Keel 2025-01-31

26 Items: catdogsunredlionmoonstarfallbluepinkzebrahippoMartacloudmusichappygreenschoolsummerwinterspringorangeyellowpurplerainbowelephant

0331wordsearch 2025-03-31

26 Items: zoohourhomeparkfrogblackplaneclockglassgrasstrashschoolmuseumdrivermorningminutesairportlibraryyesterdayrestaurantpostofficesupermarkettrainstationmovietheateramusementparkdepartmentstore

0401wordsearch 2025-03-31

26 Items: zoohourhomeparkfrogblackplaneclockglassgrasstrashschoolmuseumdrivermorningminutesairportlibraryyesterdayrestaurantpostofficesupermarkettrainstationmovietheateramusementparkdepartmentstore

ROBOT MOTHERS 2025-05-25

26 Items: leaveownedrobotbeingmotherattendschoolfamilyeasierchorescryinghungrysomedaycookingwashingclotheschildrenweekendspossibledifficulthouseworkexpensivesometimeshouseholdbabysitterunfortunately

ROBOT MOTHERS 2025-05-25

26 Items: leaveownedrobotbeingmotherattendschoolfamilyeasierchorescryinghungrysomedaycookingwashingclotheschildrenweekendspossibledifficulthouseworkexpensivesometimeshouseholdbabysitterunfortunately

The Code List 6 Heart Words 2025-10-06

26 Items: putwhoallsawballwantovercallsomewereyourwhattheresmallcouldafterwouldotherfriendshouldschoolmotherpeopleanotherbecausebrother

Chapter 2 2025-12-13

26 Items: ACEFARMTOWNCLASSHENRYLIVEDMILANFAMILYMARNEYRAISEDSCHOOLSISTERSQUAREEVENINGGRANDMAGRANDPAOLDAKERWALKINGMISSOURITWILIGHTVISITINGAPARTMENTCORABELLEUNIONVILLERESTAURANTSSTREETLIGHT

Community Unit Verbs and Nouns 2025-12-16

26 Items: gousebuyaskwalkhelpworklivewaitstopmeetfindcomeparkbankvisitcrossstorehouseschoolstreetlibrarybusstophospitalrestaurantpolicestation

EMMA SAYS OOPS! 2026-04-20

26 Items: JUGBALLPASSHANDWHATOOPSBESTPETERTEACHTABLEBINDIPEASYAGAINCLUMSYSCHOOLCAUGHTCIRCLECAREFULDROPPEDSTARTEDJUGGLEDBIRTHDAYBREAKFASTNEWSPAPEREVERYWHEREBUTTERFINGERS

Word Search - Elijah Smith 2023-09-12

31 Items: Moving airair that surrounds Earthtoo much water in one placeThe distance above sea levelHow hot or cold something isthe current outdoor conditionsbuilding up of something overtimeInformation that has been collectedThe amount of water vapor in the airthe continuous flow of water on earthwater water found in lakes and glaciers...

Pakistan 2024-08-27

14 Items: desertcurrencycapital citynational gamelargest rivernational poetcity of lightsnational fruitnational dressmountain rangecity of saintsnational animalnational flowerheart of Pakistan

Fun trivia about the birthday girl 2026-02-04

21 Items: Alma materFavorite movieHer Dad’s nicknameCity where she grew upHer animal hobby as a kidHer Mom’s “grandparent” nameHer Dad’s “grandparent” nameHer favorite alcoholic drinkWhat city did she work in FL?Her favorite non-alcoholic drinkHer favorite cable movie channelWhere did she first live with Ted?Her 3 siblings' names concatenated...

Around 2026-04-29

11 Items: schoolcornertheatrefactoryfountaincar-parkroundaboutcrossroadszebra-crossingpolice-stationtraffic-lights

Week 11 easy 2023-11-08

24 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinginventive, imaginativea main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Kenzie's Science Wordsearch 2023-12-18

20 Items: Is earths GalaxyA group of stars making a shapeIt must be big and orbit a starA path that a planet is stuck inThey study of everything in spaceWhen light bounces off the objectA piece of rock floating in spaceDischarged gas air and other stuffA rock that enters earths atmosphereBelief of that signs tell our personality...