end of school Word Searches

Unit 2.1 Word Search - art, photography 2025-12-01

28 Items: a quick photoa public show of arta picture of a personlooking good in photosa very great work of arta book for quick drawingsa picture made with paintthe light used in a photoa small part of somethinga large painting on a wallthe border around a picturehow a surface feels or looksa photo you take of yourselfto make something look closer...

STEM Chronicles 2025 Word Search 2025-12-14

20 Items: The planet 55 Cancri is made up of…First Asian to receive a Nobel prize in physicsThe process through which your brain eats itselfFounder of the Indian Space Research OrganisationTiny particles of pollutants suspended in the airAn amphibian that vomits out its stomach to clean itThe environment which stores majority of carbon underground...

Adaptations and Survival pt.2 2026-04-15

23 Items: Any living thingIs warm year-roundA behavior that is not learnedA behavior that has to be taughtWhat you see on a plant or animalClimate zone that is cold year roundThe type of adaptation camouflage isThe place where a plant or animal livesThe place where the ocean meets the coastany characteristic that helps an animal survive...

Science Review 2026-04-16

28 Items: Landmark's mascot.Name of the element H.The capital of France.Water in it's solid state.Heat transfer through fluids.What is the basic unit of life?Mrs. Hadfield's favorite color.Liquid water becomes water vapor.What is the powerhouse of the cell?What is the only even prime number?The process by which plants make food....

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

CV Aging Cl 5 2024-12-09

15 Items: Reestablishes blood flowOcculsion of LAD leading to MIRoto router of coronary vesselsAbbre for Coronary Artery Bypass GraftTroponin levels establish myocyte injuryDamage to all levels of the heart muscleCombines PCI and CABG to improve outcomesLack of adequate oxygen for cell metabolismSupply a list of these if you come to the ED...

END: Seizure 2023-10-13

5 Items: drugsseizureepilepsyseizuresseizures

Word Scramble 2022-11-15

40 Items: the ability to carry out a taskthe cost of operating a businessa natural ability to do somethinga business owned by a singular persona mental position with a fact or statethe worth or value of a good or servicemoney recieved on a regular basis for workNike is an example of an _____ (business type)the percentage of the industry's total revenues...

Inbestigators 2020-05-29

7 Items: SAMDYLANCASESSOLVEMARGOTSCHOOLINBESTIGATORS

Library Word Search 2023-02-14

7 Items: pehomelunchdinnerschoolenglishbreakfast

School Word Search 2023-07-02

7 Items: readdesksbooksschoolteacherlessonsgrammer

teams 2025-02-04

7 Items: wordexcelschoolonenotebusinesscomputerassements

Peter Foley 2025-04-07

7 Items: SchoolTeacherPointerAdvisorHelpfulThomastonTypewriter

Internet Safety 2025-09-03

7 Items: busnamephotoschooladdresspasswordphonenumber

Elk Rolling in Water Month 2025-09-09

7 Items: elkwaterschoolautumnforestantlersseptember

Children Word Search 2025-10-21

7 Items: schoollessongluingpictureteacherchildrenclassroom

GCS TEA Wordsearch 2026-02-04

7 Items: DramaSchoolRespectPeelersFriendsCottonCandyMiddleSchool

Soccer Word Search 2026-02-25

7 Items: GOALSOCCERFRIENDSCHOOLPRACTICEWEDNESDAYPLAYGROUND

School Word Search 2026-03-05

7 Items: CFAMallBeachSchoolTargetSaiyforruhBarnesAndNoble

3rd 2026-04-13

7 Items: homeparkbeachschoolsportscenterdoctorsofficegrandmashouse

Draw Word Search 2026-04-16

7 Items: arthowdrawaboutcomicschoolswimming

Tommi’s Game Night 2025-12-19

31 Items: AjaKimJadaJujuDUPRNCAAParisJesseNadiaJeromeLinseyWinnerJasmineMarissaShakirahAdrienneKimberlyAnaliciaChristinaCapricornMamaTommieMy hometownMy favorite colorMy favorite pastimeMy undergrad mascotMy favorite accessoryCutest pug in the worldMy favorite sneaker brandStreet name of my new homeSport Tommi played in college...

Nutrition 2022-12-13

35 Items: Blood sugarFruit sugarStart of digestionIndigestible starchComplex carbohydratesVitamins and MineralsGetting enough to eatPre-cursor to Vitamin ACarbs, fat, and proteinOne of the macronutrientsNeeded for blood clottingBuilding blocks of proteinIron found in animal foodsVitamin B12 is stored hereNatural source of Vitamin D...

Elizabeth Word Search 2024-07-11

35 Items: Tom’s middle nameTom’s zodiac signKelly’s middle nameKelly’s zodiac signState they eloped inCity Tom was born inThe clear favorite catCity Kelly was born inKelly’s Hogwarts houseSeason they got engagedWebsite the couple met onFavorite video game systemCity of their first apartmentName of Kelly’s oldest siblingName of Tom’s youngest sibling...

cell terms 2025-11-24

28 Items: more than one cellcell with a nucleuspreforms photosynthesissimple cell, no nucleus“the powerhouse” of a cellconsisting of one single cellbasic unit of all living thingshooke discovered the first cellgreen pigment implants used to make food“the brain” of a cell, the control centerprocess used to convert light into energy...

Centenary Word search Complete the Title 2024-04-03

23 Items: _____-22Open _____I Am ______White _____Cloud ___________ ZhivagoEye of the ______Things Fall _____The ________ BrideThe Story of _____A Passage to _____Midnight's ________The _________ StormA ____ of One's OwnLessons in _________Long Walk To ______________ Jones's DiaryWhere The Crawdads ____A Brief _______ of TimeFive Go Adventuring _____...

Averroès 2024-11-26

20 Items: EnergyImmuneBiologyCultureSurgeryMoleculeResearchMythologyTraditionDiagnosisDiscoveryExperimentPhotosynthesisThe smallest unit of matterThe study of disease causes and effectsA monumental structure from Ancient EgyptThe protein in red blood cells that carries oxygenA tool used by doctors to listen to the heart and lungs...

(Chase horne ) andrewclements  2014-12-04

25 Items: readmoanlakeswimfishBookssixthCamdenschoolguitarstudiosisterpoetrysummerOaklandwritingEnglishcollageChicagobrotherfriendleIllinoischerryhillcraftpresspublishing

Congratulations, Great Oak Graduates 2015! 2015-06-05

25 Items: samcapoakpromgownhightestsgreatonwardschoolbriannaanaliseanthonybrandonnataliespeakerdiplomaceremonytemeculagraduationdisneylanduniversitycelebrationcommencementannouncements

10FA5 Integrated Studies Word Find 2018-09-24

25 Items: LEVITINAEMMAARIKIDYLANTERRIETHANJULIAMAORICHOZENRUEBENTIARAHSCHOOLBOSSTYNMICHAELMANAAKICULTUREHERITAGEFLAXMEREKAILIZANETYLAHROSEOSHYEANNAHINTEGRATEDNEWZEALANDENDANGERED

Dragon Hoops 2020-07-13

25 Items: winoutteamslamdunkgametimeboyshoopscoachgirlsclockdragonsportsjammedschooljumpingathletevarsityhalftimesneakersbasketballscoreboardchampionshipsportsmanship

thème  2020-11-07

25 Items: catdogcarredboyliongoodnineeasygirlbikelovezebrahippohousebrowntablewomenfridaystrongyellowschoolfatherelephantteatcher

lilys favorite things word search 2020-11-30

25 Items: tviceartdogscatsfarmcreamgameshorsesadroitschoolanimalsfriendsbeakingkittensunicornsbabyyodaChristmasHalloweencornmasesdecoratingclaudmonaybuildabearstuffedanimalshorsebackriding

Go Straight and Turn Left 2021-05-23

25 Items: leftturnbankcafemallparkwhererightblockbeachcornerschoolbakerypalacetemplemuseumlibrarybusstopstadiumtheaterembassystraighthospitalrestaurantpolicestation

Go Straight and Turn Left 2021-05-23

25 Items: leftturnbankcafemallparkwhererightblockbeachcornerschoolbakerypalacetemplemuseumlibrarybusstopstadiumtheaterembassystraighthospitalrestaurantpolicestation

Word Search 2023-03-21

24 Items: foodtipsPlusrugbyDecorsleepskiingsophiesophiehockeymoviesschoolsportsjewleryfriendscluelessskincarehomeworkstudyingteenagerspagehttiactivitestravelingentertainment

summer 2023-07-26

25 Items: funartlovegamefoodmusiclaughbooksdancepartybeachmemessquadschoolsportstravelmoviesselfiesocialsummerfriendsfashionfitnessadventuretechnology

Jaxson's Word Search 2024-05-15

25 Items: reddogkindnineblueknoxnicecoolsmartbravesportfunnyhockeystaffyschoolteacherfishingicecreamdirtbikecreativeconfidentchocolatemeatballswritingjournalcurriedsausages

,tk 2024-05-20

26 Items: nohimeusyayyeswhynowwhowhybyeboymanmenyouwhenbookgirlmalehandfoothorsewherehellowomenschool

4° ano 2024-12-12

25 Items: catdoghenlionmallfarmzebrahipposheepbeachhorsenightschoolsoccerbakerycinemaroostermorningelephantdrugstorevideogameafternoonvolleyballbasketballsupermarket

Our Town 2025-02-19

24 Items: zooparkbankfarmhousehoteltowermuseumofficetemplecastleshrinechurchschoollibrarystationstadiumtheaterairporthospitalaquariumbookstorerestaurantsupermarket

Ms. Bernstein's Class 2025-03-21

26 Items: SkyeRemiZoeyJojoAdamBowieImaniAyronKeeganAustinJanuszCaedenMatiasAubreeSchoolsecondspringMadisonBarrettMathewsSantiagoChristianChristianBernsteinElementaryTimbertrace

Fourth Grade 2025-04-14

25 Items: betelaKEStestslaymathbuzzsigmaAprilspringpreppybaddiehornetsummerschoolfourthrizzlerskibityMissFolkKirtlandMrsGodinabutterflyMrsCovelliMrsMcBrayerMrsLafferty

Congratulations Word Search 2025-04-29

24 Items: CAPGOWNCLASSPARTYSCHOOLALUMNIAWARDSFUTUREHONORSSENIORCOLLEGEDIPLOMAFRIENDSSUCCESSTEACHERCEREMONYCELEBRATEEDUCATIONGRADUATIONUNIVERSITYCELEBRATIONCOMMENCEMENTACCOMPLISHMENTCONGRATULATIONS

SEVENTH GRADE 2025-05-07

25 Items: GYMNOUNFACECRUSHSCOWLHAPPYCLASSSCHOOLLINGERTRUDGECLEVERSUMMERFRIENDSTEACHERANXIOUSNERVOUSSEVENTHEMBARASSELECTIVEFEROCITYHOMEROOMPOPULACEMOTIVATECATECHISMPROPELLED

Welcome Word Search 2025-05-20

25 Items: DeskRulesGoalsSchoolLockerWelcomeTeacherStudentRespectRoutineScheduleSuppliesHomeworkLearningBehaviorTeamworkKindnessClassroomQuestionsFriendshipAssignmentExpectationsInstructionsCommunicationResponsibility

Unit 1 Week 6 Spelling 2025-07-21

25 Items: motorheavynovelappealshovelschoolcoasterhighwayfreedomrailwaycookoutreadingwritinghistorypencilswildlifeneighborlearningbackpacksuppliesclassroomcafeteriaplaygroundclassmatesdictionary

random 2025-08-05

25 Items: redcupbluepinsdoorpinspenssunnydesksrulerwagonwaterglobeschoolchairsiphonepassesfolderphoenixarizonapencilsvacationfootballchromebookhighlighter

Tricky Word Challenge 2025-09-25

25 Items: anyhomelosemanyaboutbuildgreathouseotherthesewhereanimalcaughtpeoplereallyschoolthoughanotherdecidedFebruaryremembersurprisetomorrowdifferentsomething

Fun Friday 9/26 2025-09-25

25 Items: sawputouroutdoesmanyworkveryonlybeenhouseagaincouldtheirswiftgradeanswerfathermotherpeopleschooltaylorsecondbecausewilliams

Starsandstripes Word Search 2025-09-30

25 Items: FlagSchoolFamilySmoresAmericaCookoutFriendsHotdogsPeanutsSunsetsBarbequeBaseballVeteransFirefliesNutritionFireworksPatrioticSparklersHamburgersWatermelonIndependenceCrackerJacksFirecrackersNationalAnthemStarsandStripes

JHS 1 - SDG 10 Word Search 2025-11-06

25 Items: rampliftexitopensignenterleavecarrybuildwheelstickschoollessonfriendtravelstairsstreetbridgepublicsafelyfamilyhelperaccessteacherstudent

Set45 2025-11-20

25 Items: RoofShopTreeDecorLightHouseGableFenceVisitMarketBridgeWindowSchoolChurchPeopleSquareStreetCottageVillageMailboxChimneyHolidayPostcardFriendlyNeighbor

Thirteen Reasons Why 2025-12-05

25 Items: MapTapesStarsBlamePillsStereoSchoolSuicideReasonsStalkerThirteenCourtneyTylerDownChloeRiceClayJensenSkyeMillerHannahBakerBryceWalkerJustinFoleyZachDempseyTonyPadillaAlexStandallJessicaDavisSherryHollandKatherineLangford

THE FINAL WORDSEARCH 2025-12-15

25 Items: FoodCityLongOceanMusicKerryAnimalPeopleTravelNaturePlanetForestFriendSchoolFamilyExploreCultureCountryPictureJourneyLanguageScotlandAdventureIDONTKNOWEnglishonly

word search 2026-02-07

25 Items: booklakeboatkingearthmusicsmartmovieyoungschoolsundayanimalcastleplanetsclothesmysterysweaterhistorypromiseapologyperfumeelephantsandwichnecklacefavourite

Vocabulary Words 50-75 2026-02-10

25 Items: penrunsadsayseemoonneedopenparkrainreadriceroadsaltmonthnightpaperphoneproudrivershortsleepminuteschoolmorning

The Austrian Apporach 2026-02-11

25 Items: FULLFAIRESTATEHUMANSCHOOLMETHODACTIONTYRANNYLIBERTYLAISSEZUTILITYFALLACYRESERVEAUSTRIANAPPROACHPERSONALMARGINALDECISIONSDISCOVERYCOLLECTIVEPRAXEOLOGYINDIVIDUALSLIBERTARIANRESPONSIBILITYINTERVENTIONIST

Tricky words - Term 1 2026-03-15

25 Items: WasAreWhyHomeSomeWereWantVeryHereWalkHaveFindOverLoveFastOpenDidntAgainWaterWomanFriendSchoolFamilyFebruaryDifferent

silent sounds 2026-04-29

25 Items: echoghostguesskneesthumbwouldwronganswerassignballetcastlehonestislandlistenmusclesalmonschoolthoughtongueknowingfebruaryscissorswednesdaypsychologypterodactyl

Chrysanthemum 2026-04-30

25 Items: grewlongmouseloveddresssmilemusicdaisymotherfatherlookedschoolflowerwiltedperfectjealousteachertwinklehappiestdreadfulbirthdaymarigoldbeautifulnightmarefairyqueen

Mason Stealing Air 2026-05-01

25 Items: AirMaxflyAlexshedworkfarmPlaneBrianwingsmotorbuildschoolsummerskatingMrDavisGrandpafictionMrsDavisjoystickweekendsfreetimeknowledgeTrentReedyFirstperson

Stargirl 2024-05-10

9 Items: leokevinschoolhillariarizonaukulelestargirlcinnamonSpinelli

Correct uniform and attendance 2025-07-27

9 Items: hattimeteamproudbelongschoolClancyuniformlearning

NEW KID WORD SEARCH 2026-05-01

9 Items: kidArtDrewLiamJordanschoolnewkidalexandraMiddleschool

DNA & Cell Cycle 2025-10-23

12 Items: Unzips DNA helixDNA is in the shape of aGuanine always pairs withIn DNA, Adenine always pairs withCondensed DNA, humans have 46 of themAdds nucleotides to the new DNA strandThe process of cells growing and dividingA section of DNA, controls cell differentiationSugar found in DNA, makes up the sides of the ladder....

Guinea pigs! 2025-06-15

19 Items: An orange vegetableThe act of eating faecesAn animal that eats plantsTerm for a male guinea pigThe technical name for pooTerm for a baby guinea pigTerm for a female guinea pigA type of hay from oat grassCaused by a lack of Vitamin CA type of faeces to be consumedThe genus guinea pigs belong toA breed known for their spiky fur...

Have you earned your tomorrow 2024-07-17

10 Items: What is almost over, according to the poem?What is "slipping fast" according to the poem?What informal greeting is mentioned in the poem?What does the poem suggest you might have earnedWhat emotion might someone feel for a deed you did today?What word describes the type of greeting given to a friend?...

Discern Word Search 2023-12-20

10 Items: parishbishopdiscernmandateof Faithcelibacyseminarydalmaticof bishopsinfallibility

ELIZABETH AND JACE 2025-05-31

40 Items: Jace's hometownJace's first carWhere Jace proposedMonth Jace proposedElizabeth's hometownMonth of the weddingHoneymoon destinationJace's degree programJace's favorite colorElizabeth's favorite foodJace's favorite accessoryElizabeth's favorite bandElizabeth's favorite colorElizabeth's favorite craftThe best box brownie brand...

Derivative Word Search 2025-12-08

15 Items: carelessgreat carea human upper limba fleet of warshipfor the reason thatcare taken in advanceexpressing or indicatinga formulated thought or opiniona reason for an action or conditionthe quality that appears to the possessor as dignitythe quality or state of being worthy of honor or respect...

Hannah & Allen 2025-08-21

27 Items: Allen’s hometownAllen’s first carAllen’s first nameCouples dog’s nameCouples cat’s nameHannah’s universityMonth Allen proposedGrade the couple metLast name they shareHannah’s maiden nameCouples favorite beerHoneymoon destinationLocation of engagementCouples favorite liquorName of elopement venueHannah’s favorite seasonCouple’s favorite TV show...

Favourite things 2025-05-30

8 Items: bikehomesportphonemusicjeansschooluniform

H1 2025-10-20

8 Items: PenbagGlueBookRulerPencilCrayonEraser

Key Terms chapter 18 2023-04-14

27 Items: walkinglying face downstyle of walkingfluid-filled sacsside-lying positionlocal death of tissueresting on their backHOB is at 60-90 degreesHOB elevated 30-45 degreesDense, hard connective issuepatient resting on their sideis Also known as body mechanicsoccur from pressure on the skinfibrous connective tissue-cushion...

Silberquit 1/27 2025-01-27

25 Items: hugerelating to birdspeople that came beforethings that came beforesavagely intense, fierceat the beginning; first.a cruel, oppressive rulerextremely large or great.not appropriate or fitting.a comparison using like or asa collection of valuable items.able to move quickly and easily.words that imitate natural sounds....

Eli's word search 2025-12-13

15 Items: AJARLONEWSEMILYCUDDYANDREACOOPERCOOPERGRANITELAVAMANMILLIONMENTARYMENTARYLIBRARIANWEIRDEST SCHOOL

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

English for Engineering Review 2025-12-09

28 Items: not easily bentSI unit for massmoney that is lenta five-sided polygonthe bottom of a wavethe shape of a columna unit for measuring anglesthe simple machine that is a rampa tool for turning screws by handto decrease the speed of somethingdetailed list of all the items in stockrelating to numbers; expressed in numbers...

CH 12: Pancreas 2026-04-08

27 Items: HORMONE THAT LOWERS BLOOD SUGAR.HORMONE THAT RAISES BLOOD SUGAR.MOST COMMON CAUSE OF PANCREATITISENZYME RESPONSIBLE FOR FAT DIGESTION.THIS ENZYME RISES FIRST IN ACUTE PANCREATITISCELLS THAT PRODUCE PANCREATIC DIGESTIVE ENZYMES.CLASSIC IMAGING FINDING IN CHRONIC PANCREATITIS.INFLAMMATORY SPREAD ALONG FASCIAL CAUSING EDEMA....

jajshajjsjs 2023-05-31

10 Items: Pairs with thymineOrganic compounds used to store energyIn the double helix pairs with cytosineConverts the instructional genetic information stored in deoxyribonucleic acidEach nucleic acid has this, a 5-carbon sugar as a part of its polymer backbonePortion of the DNA double helix that provides structural support to the molecule....

CR Chemical Reactions Challenge 2024-08-02

28 Items: the thickness of a liquidsolid, liquid, gas, or plasmaanything that has mass and volumethe amount of matter in a substancethe amount of space a substance takes upthe amount of mass within a given volumetwo or more elements that are chemically bondedthe ability of a substance to catch fire and burnthe ability to easily transfer heat or electricity...

April Word Search 2026-04-29

13 Items: What does GTM stand for?Name of our smallest watchAprils townhall safety topicWho won last month's word search?The largest trade-only event for divingWhat is the third word? Powerful, Simple,...Full FIRST name of our Sun Run team 1st place winnerName of our product that is used to monitor air levels...

Huldrych Zwingli 2025-03-20

10 Items: AffairsDialogueInfluenceand Theologyof Educationin Political andof Church Practicesof a New Communion Theologyof the First Protestant Churchin the Reformation Biblical Preaching

: The Consequences of the Industrialization 2022-12-01

26 Items: The action or process of appeasing.Centralized control by an autocratic authorityTreaty that ended the first Opium War in China.A law that restricting Chinese immigration in the U.S.A law that restricted non-European immigration in Australia.A German philosopher that came up with the theory of Communism....

Stock: Word Search 2024-08-25

22 Items: The financial deficit that occurs when expenses exceed revenue.The potential for loss or the variability of returns on an investment.The practice of spreading investments across various assets or sectors to reduce risk.Money earned from various sources, such as wages, investments, or business operations....

Unit 7 Vocabulary 2026-02-19

15 Items: Same structures used in different waysFertilized egg/early developing organismWhen a species is no longer present on earthStudy of early stages of development in embryosDifferent structures used for similar functionsNewly adapted/evolved traits used on a cladogramTwo closely related species evolve together over time...

Keywords related to American Revolution and Declaration of Independence 2026-01-30

37 Items: ActLifeActsActsActsRightsRightsBritainLibertyTyrannyProtestBoycottby JuryFreedomColoniesTaxationMassacreCongressSoldiersEqualityColonistsTea PartyJeffersonRebellionRevolutionParliamentGrievancesGovernmentand ConcordSovereigntySovereigntyIndependenceof HappinessRestrictionsRepresentationof Independenceof the Governed

Les quantités - au marché 2024-06-20

15 Items: merci: t_a_ksde rien:it's n_th_ngs'il vous plaît: p_e_sedouze oeufs: t_el_e e_gsde la salade: so_e s_ladcinq citrons: fi_e l_m_nsje voudrais: I wo_l_ li_evingt oignons: t_enty o_io_sdix chou-fleurs: t_n ca_l_flo_ersun kilo de poisson: a ki_o of fi_hune tranche de jambon: a sl_c_ of _amune bouteille d'eau: a bo_t_e of w_ter...

SPELLBINDING SCHOOL SEARCH 2022-12-22

12 Items: usajapanbrazilugandauagadouhogwartsscotlandilvermonydurmstrangmahoutokoroscandinaviacastelobruxo

Back to School 2025-07-29

12 Items: IvaAnnaTomiRosieIsaiahCalvinVivianHannahHunterElliottEmberlyZachary

Back to school :))) 2025-08-29

13 Items: lunchpencileraserfriendsreadingwritinglibraryteachersbackpackprincipalclassroomcafeteriaclassroom

Chapter 20 Word Wise 2026-04-20

12 Items: When two air masses meetWhirling tropical cycloneA front that does not moveThe center of the hurricaneA cold front that overtakes a warm frontA storm that generates lightening and thunderA dome of water of about 65-80 kilometers wideWhen warm air moves into a region of cooler airDoughnut-shaped wall that surrounds center of storm...

First Day of School WAP 2025-09-11

6 Items: gluebluelearncrayonpencilfriend

School uniform 2020-01-12

8 Items: tieshirtshoesskirtsocksblazerjumpertrousers

School Subjects 2021-02-01

8 Items: MathsMusicRussianHistoryEnglishGermanyGeographyLiterature

school subjects 2021-06-15

8 Items: PEartmathmusicscienceChineseEnglishsocialstudies

School subjects 2023-01-26

8 Items: gymmathhealthsciencepathwayslanguageinventionlabsocialstudies

SCHOOL 4 2023-10-11

8 Items: frogdooropenclosewindowteacherstandupsitdown

School bag 2024-12-17

10 Items: vihikkriididpastakasjoonlaudteritajapastakasbox pinalkustukummbag koolikottbook tööraamat