end of school Word Searches

school 2024-04-28

16 Items: copycarryenjoystudycopiescopiedenjoyscarriescarriedcopyingstudiedstudiesenjoyedcarryingstudyingenjoying

School 2025-02-21

16 Items: gymdeskmathchalkpaperrulerappleclassfriendpencileraserteachersciencecomputernotebookcalculator

School 2025-06-02

16 Items: PEBEEMATHBOOKSLUNCHPAPERPENCILMARKERLIBRARYREADINGAMPLIFYHOMEWORKDIVISIONFRACTIONSCLASSROOMMULTIPLICATION

School 2026-04-28

16 Items: ArtTestSportPencilEraserSchoolScienceEnglishHistoryCanteenClassroomSharpenerWhiteboardPencilcaseMathematicsKindergarten

Years End 2023-09-25

11 Items: icetimepastwaterlakesfrozenfuturewinterfragilepresentnewyears

school 2024-04-10

17 Items: thatshipwhenchatthanwhipshedthischipthenthemthatcheckchillshellshackthink

school 2024-11-26

16 Items: gymartworktestreadmathtablelunchstudentlockersteacherslearningbuildingprincipalclassroomswhiteboard

School 2025-08-20

16 Items: GymMathLunchRecessMrSinghScienceSchutteMsMullenMrRaymondMrBurdickMsCheatemElectivesEagleTimeMrsFichtelLanguageArtsSocialStudies

school 2024-09-09

18 Items: JudMiaMiaLiamBrodyClarkClarkGarinLollyBrycenPaytonSophiaSophieChelseaKinsleyMatthewPrestonSavannah

School 2026-01-19

16 Items: mathbandlunchbooksdesksrecesschairstypinglockerTeacherreadinggrammarwritingsciencestudieslibrary

The End of the Cold War 2026-03-19

14 Items: WarWallUnionReaganSummitReformDetenteweaponsGlasnostCollapseGorbachevH.W. BushDiplomacyPerestroika

February 2025 Edition 2025-02-03

14 Items: Wintersport.Not allowed.Back in Badness.Owowowowowowowowow!What lovely ____works!Second head of school.Creativity and Writing.Unleash your creativity.Oh No Petey's at it again!Something that can be told.Where does Rabattz come from?You talk to someone publicly.International School of Hamburg.A season that is filled with snow.

Football Season 2025-09-08

37 Items: EndOffEndDownZoneFairGoalHandLinePuntZoneSackSnapDriveExtraPointCatchFieldGuardTeamsCenterFumbleHuddleReturnSafetyTackleKickoffRushingFullbackHalfbackReceiverBackfieldCornerbackLinebackerQuarterbackIncompletionInterception

Week 12 Word Search 2025-10-31

10 Items: Sufficient; enoughBasic; forming the foundationAct of making laws; law-makingReached its highest point or climaxAccumulation and storage of suppliesEncourage; contribute to the growth ofAccepting; free from bigotry or prejudicesEnd of separation of cultural and racial groupsSomeone who takes the most hopeful view of matters...

Fall 2025-11-24

20 Items: SPORTFRUITCANDYLEAVES.LEAF COLORON A HOLIDAYKINGS ISLANDON A HOLIDAYGROWN IN FALLSTARTS IN FALLMADE OF APPLESINVOLVES LEAVESCOLOR OF LEAVES.NAME OF A HOLIDAY.STARTING DAY OF FALLAPPLES OR CRANBERRY'SSTARTING MONTH OF FALLHAVE SOMETHING FALLING OFFBOUNCES WHEN RIPE AND FLOATS IN A BOG WHEN RIPE...

le week-end 2025-11-13

17 Items: nulvélofêtestadevidéochevalbasketdevoirscoursesamusantennuyeuxépuisantordinateurcommercialpassionantintéressantdivertissant

The Nightingale and the Rose 2024-07-25

11 Items: all but one: _____to look like: _____a precious stone: _____to know something: _____to leave or go out: _____to choose or select: _____the cost of something: _____at last or in the end: _____feeling of being alone: _____to push with your hand: _____having the color of lemon or banana: _____

Look for the past forms of these verbs 2026-04-22

38 Items: past tense of 'is'past tense of 'run'past tense of 'eat'past tense of 'get'past tense of 'buy'past tense of 'fly'past tense of 'cry'past tense of 'ski'past tense of 'row'past tense of 'live'past tense of 'come'past tense of 'sing'past tense of 'draw'past tense of 'play'past tense of 'stop'past tense of 'look'past tense of 'ring'past tense of 'swim'...

gfjyghd 2025-11-24

22 Items: rugbedlampwalluglysamelargesmallprettybedroomcurtainspaintingimportantto the lefttelevision setown, one's owncloset, wardrobeto the right (of)clock (alarm clock)night table, end tabledresser, chest of drawersmirrorelestante shelf, bookshelf

​🇨​​🇦​​🇷​​🇸​​🇴​​🇳​ ​🇼​​🇴​​🇷​​🇩​ ​🇸​​🇪​​🇦​​🇷​​🇨​​🇭​ 2024-05-16

15 Items: What humans BreatheThe end of A long boneAre ocean currents related to windHow Carbon moves out of the atmosphereThe process were liquid turns into gasZone of the ocean that has a lot of sunlightA flexible material found on the ends of bonesThe less muscular of the two types of blood vesselsThe more muscular of the two types of blood vessels...

Y4 spellings summer week 1 2025-05-09

20 Items: like1,2,3completedreally meanreally happyrule as monarch:a bug that bitesa bit in your bodyfind the meaning ofready for adventurethe bit before cakequestions to a testunfortunate situationacting without thinkingwhen you are in a planea vehicle with 2 wheelsof or affecting the facethe end part of a sleevepiece of writing or music...

Spelling List 2: Silent Letters 2025-08-29

20 Items: cargo _________________people _________________to shine _________________to hurry _________________struggle _________________to attach _________________to bow down _________________a bony fish _________________understanding _________________a sharp twist _________________soft limestone _________________a female child _________________...

Revision 2026-01-14

31 Items: past form of 'be'past form of 'be'past form of 'go'past form of 'do'past form of 'buy'past form of 'get'past form of 'eat'past form of 'hop'past form of 'cry'past form of 'fly'past form of 'ask'past form of 'see'past form of 'have'past form of 'come'past form of 'draw'past form of 'sing'past form of 'ring'past form of 'swim'past form of 'walk'...

Freak the Mighty Word Search 2025-11-18

21 Items: (my name)Kevin's MomMax's GrandpaMax's moms nameTony D's nicknameAmerican ____ ____A type of explosionA bird-like aircraftA tending to cause rustUnable to read or writeMax's nickname in daycareAnother word for nickname______,Vinegar, and Curry PowderLoretta broke a bone in her ____Kevin's age at the end of the book...

past simple 2026-04-28

20 Items: past simple of runpast simple of flypast simple of saypast simple of putpast simple of comepast simple of drawpast simple of fallpast simple of givepast simple of havepast simple of makepast simple of takepast simple of tellpast simple of wearpast simple of sellpast simple of buildpast simple of drivepast simple of learnpast simple of steal...

Keepers of the school. Reem 2015-01-09

19 Items: BenTomHmsFearJillTreeKeanDockSnakeClockLymanBenchAndrewSchoolCodicilClementsLongitudePaperclipChronometer

Science Word Search 2025-11-21

14 Items: Everything.Transfer of heat in a fluid.Movement of air due to convection.Heat source for convection on Earth.Daily conditions of the air around us.Last stage of a main sequence star's life.Average weather conditions over a long period.Movement of water in the ocean due to convection.Area of gas and dust in space where stars can form....

Sweet Word Search 2024-07-10

15 Items: Deeply lovedTo hug or hold closeAwe-inspiringly grandElegant beauty or poiseGoes beyond the limits ofFor eternity, perpetuallyBoundaries or restrictionsEach one, without exceptionLasting forever, without endHaving a pleasing taste/smellHaving a pleasant degree of heatSomething kept hidden or concealedThe spiritual or immaterial essence...

Anti-Antarctica Word Search 2025-07-29

8 Items: "What's ____ you say?""Summerbridge _ what?"From a time before WiFiWritten to prepare for the endProgram and College Access ManagerSecond letter of what you can't ridePut an end to the existence of something by damaging or attacking it.Belonging to or associated with the person or people that the speaker is addressing.

First day of school! 2025-07-08

13 Items: FunDeskCandySummerSnacksPencilEraserTeacherFriendsPlayingBackpackColoringMs.Kaynes

school 2024-05-13

16 Items: snowmanbookmarksunlightdowntownsnowballcookbookbookcasesnowplowsnowflakemoonlighttouchdowncountdownscrapbooksnowstormflashlightdownstairs

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

Look for the past forms of these verbs 2026-04-22

38 Items: past tense of 'is'past tense of 'run'past tense of 'eat'past tense of 'get'past tense of 'buy'past tense of 'fly'past tense of 'cry'past tense of 'ski'past tense of 'row'past tense of 'live'past tense of 'come'past tense of 'sing'past tense of 'draw'past tense of 'play'past tense of 'stop'past tense of 'look'past tense of 'ring'past tense of 'swim'...

End of the Year Word Search 2023-06-05

14 Items: lazypooljunejulybeachbreaksleepsummeraugustfreedomcampingfriendsvacationswimming

The End of the Cold War 2026-03-19

14 Items: WarWallUnionReaganSummitReformDetenteweaponsGlasnostCollapseGorbachevH.W. BushDiplomacyPerestroika

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

T5 2025-08-01

35 Items: oflongbearpoorrichhandsshortrainywindywatchpianounderChinaJapanbehindcloudymonkeywalletguitarviolinofficeschoolTaiwanteacherkitchenexcitedbetweenlibrarypictureEnglandstudentshomeworkmagiciansdiningroomsupermarket

minecraft 2020-09-25

16 Items: endcowpigmodghastsheepnetherdragonzombieplayerpickaxediamondskeletenminecraftoverworldcraftingtable

Exceeding Word Search 2022-08-03

16 Items: endamenabovepowergloryjesusages,worldchurchchristworkethwithoutexceedingaccordingabundantlythroughout

faigy 2024-11-05

16 Items: endnextcampsanksinghuntlongpondjumpleftdrinkstandstampbringyoungfriend

Adverbs and Verbs 2025-11-14

16 Items: begoyetpayeatbuyendlastjustlosesincebreakarriveuploadalreadyyesterday

Unit 15 2026-01-12

16 Items: endsawleftnextbothwindalongwhilemightsoundbelowbehindcannotletterthoughtsomething

Rube Goldberg - Vocab 2025-12-05

22 Items: Exact and accurate.Energy of something in motion.A thing that starts an action.To perform an action again and again.A push or pull that acts on an object.To move or change from one to another.The resistance to motion that slows an object down.Amount of movement of an object as related to its mass....

MINECRAFT 2022-04-12

17 Items: endpigcatwolftableswordnetherzombiecreeperpickaxefurnacevillagerdiamondscraftingendermanredstoneskeleton

Week 2 2024-07-11

17 Items: letgetyesmenendredledwentthenthembestfelthelpnextkeptreadlead

Bridges 2020-03-10

15 Items: endspanpierdeckblockhatchbeamsbearingtendonspiercapgirdersabutmentstringersstiffenersdiaphragms

Manejo del Teclado 2020-10-04

15 Items: endhomeshiftenterdeletepageupescapecontrolwindowspagedowncapslockfunctiontabuladorbackspacealternate

51 2023-09-08

15 Items: endusesilkjoinunitjewelgoogleacidicsaunterdidacticdoubtfulauthorityconstructattentionrighteous

STADIUM 2020-03-02

16 Items: ENDGATEHOMEBENCHSTANDPITCHGROUNDTUNNELGROUNDTERRACECLUBSHOPMIDFIELDLUXURYBOXSCOREBOARDDRESSINGROOMCOMMENTARYBOX

Manejo del Teclado 2020-10-04

15 Items: endhomeshiftenterdeletepageupescapecontrolwindowspagedowncapslockfunctiontabuladorbackspacealternate

Great Word Search 2025-01-13

15 Items: GoEndGreatJesusTeachEarthPreachGospelNationsBaptizeObserveMissionDisciplesCommissionCommandments

Minecraft Word Search 2025-07-02

15 Items: AxeEndSwordSteveZombieNetherPickaxeCreeperDiamondVillagerSkeletonEnderdragonCraftingtableTotemofundyingEnchantmenttable

Spelling week 2 2025-09-02

15 Items: letgetyesredledmenendwentthenthembestfelthelpnextkept

Bowling Word Search 2025-04-04

18 Items: endlanefoulholehooksplitshoesframespareanchorbaggergutterstrikearrowsdoubleturkeyblockerapproach

Endermen 2025-05-12

18 Items: MobEndShyTallMineBlackBuildNightPurpleNetherNeutralEndermanEndermenTeleportOverworldTalkativeEnderPearlAquaphobia

Puzzle 10: End of Day 2025-07-22

10 Items: CupLampPeaceCouchSmileCloseQuietBreathGentleBlanket

End of Argument on Argument Unit 2022-08-11

14 Items: mlatopicethoslogospointthesispathoscounterargumentrebuttalevidencecitationsstatisticscommentary

Capital Cities Word Search 2025-04-01

22 Items: The capital of CubaThe capital of HaitiThe capital of ChileThe capital of BelizeThe capital of BrazilThe capital of PanamaThe capital of EcuadorThe capital of UruguayThe capital of HondurasThe capital of BarbadosThe capital of DominicaThe capital of ColombiaThe capital of NicaraguaThe capital of ArgentinaThe capital of St. Lucia...

Advent Word Search 2025-11-24

20 Items: Who was Jesus's mother?The First Sunday of AdventThe Third Sunday of AdventThe Second Sunday of AdventThe Fourth Sunday of AdventWhose birth do we celebrate?What city was Jesus born in?An animal you'd find in a barnJesus is the _____ of the WorldWho was Jesus's earthly father?Who announced the birth of Jesus?Another word for the manger scene...

Hicimos Word Search 2026-02-13

20 Items: nosotros form of oirEllos form of leernosotros form of hacervosotros form of deciryo form of tenerEllos form of hacernosotros form of decirvosotros form of tenertu form of decirEl form of tenertu form of hacerEllos form of deciryo form of hacertu form of tenerEl form of decirnosotros form of tener...

Unit 6: Giving directions 2023-09-11

31 Items: togymleftturnwalkbankparkshopsright,besideacrossbehindofficecentreclinicschoolchurchstationstadiumgallerystationlibraryoppositestraightfront ofhospitaljunctionbuildingroundaboutcrossroadshypermarket

Max The Mighty Word Search 2026-03-18

20 Items: The place where Rachel's dad had died.Appears in front of Max and flies away.The town Rachel thinks her father is at.Max's old friend that sadly passed away.What Max becomes at the end of the book.What Dip gives Max and Rachel as a treat.Beginning of book what Max calls himself.Dip wears this type of shirt while driving....

SS and Christmas 2025-12-17

27 Items: African holidaygiven to naughty kids____ branch creates lawspopular Christmas balletlack of government systempopular eggy festive drinkname of the third reindeername of an electoral districtgrouchy green Christmas charactergiven on the 5th day of Christmasname of the current Prime MinisterAppointed by the PM with portfolios...

Thoughts Word Search 2022-08-02

20 Items: gomeyounotendlordevilgiveprayseekfindshallhearttowardpeace,searchhearkenthoughtsthoughtsexpected

Computer 2024-06-12

14 Items: keytabendcordcapshomespacemouseshiftenterscreendeleteinsertbackspace

oo exceptions 2026-01-13

14 Items: youendshoetrueflewbluesoupcluegroupfruittruthmiddleChibizoubeginning

School 2018-03-06

15 Items: GymBookMathPaperLunchPencilEraserMarkerRecessReadingScienceLibraryTeacherComputerPrincipal

school 2020-03-31

15 Items: directcommonmannereffectalreadypurposediamondfeaturearticledirectortogetherincreaseattentioneducationconvention

school 2020-11-17

15 Items: penbagbookglueclassboardrulerschoolpencileraserteacherstudentscissorssharpenercolorpencil

School 2022-08-25

15 Items: mathdeskgluerulerchairtestspencilmarkercrayonrecesssciencescizzorsnotebookprojectorsocialstudies

School 2023-01-17

15 Items: penbookreadpapershirtdresspantspencileraserschoolblouseuniformnotebookmaterialsraise your hand

School 2023-04-17

15 Items: rulerpaperdeskspencileraserposterchairsstaplerchargerdrawingwritingnotebookcomputerchalkboardwhiteboard

School 2023-03-30

15 Items: penmathdeskpaperchairpencilerasermarkercrayonsciencereadingwritingnotebookcomputersocialstudies

School 2025-09-02

15 Items: BusRulerPencilTeacherUniformLessonsLibraryScienceClassroomTimetableSchoolbagRefectoryComputingGeographyAttendance

School 2026-01-14

15 Items: penbagdeskbooktestchairpaperboardclassschoolpencillessonteacherstudenthomework

School 2026-02-16

15 Items: mathlessonpencileraserteacherstudentsubjectsciencehistoryenglishlibraryhomeworknotebookclassroomgeography

school 2020-11-17

17 Items: penbagbookglueclassboardrulercolorschoolpencilschooleraserpencilteacherstudentscissorssharpener

school 2021-09-28

15 Items: PEartbusbagmathmusiclunchwalkerrecesssciencespanishlibrarylearninghomeworkclassroom

School 2022-10-10

15 Items: mathbooksTripsbiologyteacherenglishcomputerstudentsfootballStudentshomeworktechniqueGeographybasketballhomecoming

School 2025-11-01

15 Items: bookdesktestmathexampaperboardclasspencillessonteacherstudentlibrarysciencehomework

school 2025-12-04

15 Items: peemathbabyuhhhcrazyblackjeanscannonschoolperoidhannahvisualcreatevalleykaydence

School 2026-03-17

15 Items: PEICTArtMathsDramaMusicNatureSchoolEnglishHistoryScienceSubjectsGeographyComputersRoleplays

School 2026-05-07

15 Items: Dayfunreadlunchbooksclasswritecolorhaggagsummerrecesssportsteacherfriendslearning

Max Celebrates Ramadan 2020-12-09

20 Items: MaxNotEatEndOmarFastFoodGiveMonthIslamDrinkQuranShareLearnFamilyMuslimHungryRamadanHolidayCelebrate

91 2022-12-10

20 Items: heendhereuponsmartorbitroutecheerbabiesearthybasketwesternproduceseparatehappenedpreservealcoholicremarkableinauguratecoordinated

WORD SEARCH 2014-08-11

20 Items: ENDLINEFORMSTARTINPUTLABELSHAPEFRAMEOUTPUTTOOLBOXPOINTERTEXTBOXMENUBARTOOLBARSTITLEBARCONNECTORSCROLLBARFLOWCHARTPSEUDOCODEPREPARATION

Sight Words 2 2025-05-19

20 Items: dayeatendcallcomedoesdonedoordowneyescarryclimbcolorcouldearlyeighteverycaughtenoughchildren

Flowcharts, Algorithms & Programming Languages 2025-11-24

20 Items: ENDSTARTINPUTOUTPUTSYMBOLREPEATFINITEPYTHONCLARITYPRECISEPLANNINGANALYSISSEQUENCELANGUAGECOMPILEDDIRECTIONEFFICIENTVERSATILEEFFICIENCYPROGRAMMING

Newfoundland Word Search 2026-02-04

20 Items: ICEENDDRAWBRIERSTONEHOUSESHEETBROOMGUARDCANADAGUSHUEBUTTONHAMMERSLIDERCURLINGHOGLINETAKEOUTLABRADORMONTANASNEWFOUNDLAND

School 2017-01-17

15 Items: DeskBusyMathBooksSmartHallsSportsBoringScienceSpanishHomeworkTeachersStudentsLanguageChallenging

school 2020-11-30

16 Items: funhardpensmathbookspaperbookschromepencilswritingreadingfriendsplayingrunninginterviewshandwriting

School 2022-12-14

15 Items: elaartmathworkbooksmarkerpencilStudiessciencepartnerlibraryhallwayteacherbackpackprinciple

School 2023-02-22

15 Items: artdesktestquizmathclassbooksstudymusicteacherstudentsciencehistoryhomeworklanguage

SCHOOL 2024-03-11

15 Items: rulerpaperbookspaintshoeswritepencilerasermarkersnacksfolderartworktumblerprojectbackpack

School 2025-10-21

15 Items: ArtMathsMusicPDHPEEnglishScienceHistoryLanguagesGeographyTechnologyHighSchoolUniversityKindergartenMiddleSchoolPrimarySchool

school 2023-03-27

15 Items: gymartbookmusicpencillibraryhallwaycomputerstudentsteachersscissorscafeteriaclassroomtechnologyenrichment

Chemistry Full Year Vocab 2026-04-22

20 Items: 6.022*10²³A charged atom"The Box Method"An END of 0.0-0.3The best subject!A.K.A Sodium ChlorideReflectivity of a materialChemical translation of H20An atom that gives electronsAn atom that receives electronsThe ability to attract electronsIs equal to mass divided by volumeHydrogen+Nonmetal(or polyatomic ion)Digits of a number to display accuracy...

Rythem/Meter 2026-03-19

14 Items: One basic unit of meterPauses that occur within the linesHas an unstressed, unstressed, stressedHas both stressed and stressed syllables;Has an unstressed, stressed syllable; a-BOVEHas a stressed, unstressed syllable; GAR-denstresses often used to make intentions clearHas an stressed, unstressed, unstressed syllable;...

First Day of School Search! 2024-08-25

18 Items: AJLiamNovaMajaJackErenZakirBlakeChaseNeveahHadleyKaydenRitvikOliviaSkacelNatalieAlegriaJonathan

Oliver Word Search 2026-04-15

13 Items: - Setting- Moms job- first wish- Great Aunt- Book title- Magical Item- kid he fought- Main character- Items obtained- Name of school- Main characters enemy- Main characters friend- What the main character makes