end of school Word Searches

/oo/ as in look and /oo/ as in food 2026-03-22

20 Items: lookfoodstewflewcuterudehoopgrewbookgoodmooncookstoodtoothbroomspoonwoodenschoolsmoothfootball

Exam Review 2026-03-23

22 Items: blewawayhelpsoongrowgrowbowlangrytouchtrickbeganlaughbraidjellyfriendwindowschooltwentybelievechildrensurprisesurprise

My Digital Footprint 2026-04-02

20 Items: AGESAFENAMEGAMESHAREPHONEVIDEOHOBBYSCHOOLONLINETABLETPRIVATEADDRESSDIGITALPICTUREBIRTHDAYINTERNETFAVORITECOMPUTERFOOTPRINT

Cooperative Word Search 2026-04-09

20 Items: CocoaLeagueBayoilSchoolSavingsTrainingBusinessDirectorsFisheriesEducationDemocracyBeekeepersMembershipGovernancePrinciplesCooperativeAgricultureMultipurposeNonfinancialAgroprocessing

Jacob Word Search 2026-04-14

20 Items: SeatTestJacobMeanySmileVoiceLunchLaughCassieSchoolFridayPoliteMichaelTeacherScowledMonsterEyebrowsClassroomNicknamesSubstitute

3 2026-04-22

20 Items: beeMONObookMESAABEJALIBROLÁPIZtableSILLAchairPAPELpaperCONEJOrabbitturtlemonkeySchoolpencilTORTUGAEscuela

Attire Word Search 2026-04-27

20 Items: DateGownKingLimoSuitCrownDanceHeelsPartyQueenAttireFormalSchoolSeniorSocialBanquetCorsageFriendsCelebratePromposal

Hilda 2026-05-03

20 Items: ELFMAPTWIGHILDAFRIDADAVIDTROLLGIANTFORESTSCHOOLSCOUTSSAILORSTROLBERGMOUNTAINCREATUREADVENTURESTORYBOOKWILDERNESSKETTLESTONENORTHWINDKING

Goodbye Word Search 2026-05-02

20 Items: BYESEEYOUSOONMISSCARELOVEKINDYEARNEXTMOVESTEPGROWTHANKCLASSGRADELEARNFRIENDSCHOOLGOODBYE

ESP2 - We Real Cool by Gwendolyn Brooks 2026-05-05

20 Items: wesingindiecoolpoolleftlatelurksingthinjazzjunesoonsevengoldenschoolstrikeplayersstraight

Highlight the word that corresponds to the definition in the search. Then write the word that matches the definition above the written definition. 2025-04-07

16 Items: flaw or imperfectionHarmful or poisonousfriendly and generoussuperior to all otherscheerful and full of joy.To bring something to an endExtreme tiredness or exhaustionTo treat someone unfairly or cruellyTo irritate or annoy someone intensely.Not authorized by law or custom; illegalthe ability, skill, or power to do something....

Thermal Energy Word Search 2025-10-30

16 Items: the energy an object has because of movingtransfer of energy by electromagnetic wavesthe energy required to change a solid to a liquidthe temperature at which a solid changes to a liquida material through which thermal energy moves slowlyincrease in the volume of a substance when the temperature is increased...

CH1 - Thermal Energy 2022-12-19

15 Items: The expansion of matter when it is heated.________________________The transfer of energy by electromagnetic waves.________________________A state of matter with no definite shape or volume.________________________The rule that energy cannot be created or destroyed.________________________...

Cestodes and Trematodes 2025-02-25

15 Items: Equine tapewormSalmon poisoning fluke in dogsFeline tapeworm with IH of miceIntestinal flukes of dogs and catsCanine schistosome and a blood flukeRuminant tapeworm with IH of grain mitesHyatid disease tapeworms and very zoonoticBroad fish tapeworms with IH of fish and frogCanine taenid with IH host pf rabbits and hares...

WWI TImeline 2023-05-03

20 Items: February 21, 1916: The Battle of _____ begins.July 1, 1916: The Battle of the ______ begins.August 10, 1914: _______ ______ invades Russia.June 28, 1914: ________ _______ was assassinated.September 9, 1914: The First Battle of the _____.June 24, 1917: U.S. combat forces arrive in ______.May 23, 1915: _______ declares war on Austria-Hungary....

Figurative/ Rhetoric Word Search 2026-04-02

22 Items: an extreme exaggerationa comparison between two thingsa reference to something well knownwords that describe nouns or pronounsgiving inanimate objects human like qualitiesa comparison that continues over several linesa comparison between two things using like or asPlacing two contrasting ideas/images side by side...

Vocab U2 II 2026-01-20

15 Items: TagfunlesenTafeltragenSchlussGeschäftBleistiftunhöflichvergessenMittagessenSüßigkeitenSchulranzenSchüler/SchülerinUnterrichtsstunde

LANDS END TO JOHN O GROATS 2026-04-09

18 Items: WalkHikeBillHillsTrailTrackBristolGlencoeRunningLandsendSignpostCornwallScotlandPathwaysHighlandsInvernessMountainsJohnogroats

Sean and Madeline OO 2024-12-16

20 Items: Proposal MonthSean's birth monthMadeline's eye colorMadeline's maiden nameMadeline's middle name?Sean's military branch?City the couple met in?How did the couple meet?State of Sean's college?Country Sean proposed in?Madeline's hometown (3,5)Sean's most dangerous hobbyCountry the couple lives in?Couple's favorite date food?...

Spelling practice English 2023-10-11

19 Items: The _______ of a owlThe _______of a snakeOpposite to many ________A baby horse ____________Rhymes with wish___________Opposite of few____________A shark is ______ (large) a man.The horse is kept in a ___________He can hear the buzz of the _________The kitten is kept in a _____________The puppy is kept in a _______________...

AP Gov Word Search 2025-12-05

25 Items: The legal right of an individual or entity to bring a lawsuit in court.The party who initiates a lawsuit by filing a complaint against another party, known as the defendant.The process of manipulating the boundaries of electoral districts to favor one political party over another....

Animal Camouflage 2014-01-06

13 Items: hoopmoodsoonfoodroompooltoothigloobloompoochnoodleschoolrooster

best friends 2014-06-04

13 Items: fun5th3rdjakeevanbestjessimaleacrazyschoolfriendsneighborkingerton

Mr. Miller's Class 2020-06-18

13 Items: WordExcelInletGamesSchoolDigitalSyllabusMicrosoftSchoologyPowerPointTechnologyClasscraftInformation

Backpack Word Search 2024-07-20

13 Items: gluechalkclasseraserfriendmarkerpencilschoolyellowcrayonsstudentteacherbackpack

Hundred Word Search 2025-01-28

13 Items: DayMathDrawLearnCraftSchoolFriendHundredTeacherStudentProjectCountingCelebrate

Growing up in Port-au-Prince, Haiti 2025-04-08

13 Items: songHaitiblocksschooltailorfatherCreolemuseumEnglishboardinglaboratorystepmotherPortauprince

WELCOME BACK 2025-08-06

13 Items: FUNTRIPSWIMBOOKHOTELCLASSFAMILYTRAVELSCHOOLPENCILTEACHERFRIENDSBACKPACK

Nine Word Search 2025-09-12

13 Items: OneTwoOldNineFourNameHelloSevenEightThreeHouseAlmostSchool

8A autumn 2025-09-17

13 Items: piebookwarmtreebrownghostschoolorangeleavescoffeepumpkinhalloweenbilastqyz

College Word Search 2025-11-04

13 Items: PayMoneyIncomeSportsSchoolCollegeAthleteCoachesPassionStudentFairnessEqualityEquipment

Spelling Words 2.6 2025-11-05

13 Items: cityinsideschoolweekendsnowmanmailboxbathtubfireflycountrybackyarddrivewayraindroprailroad

Places around town 2025-11-21

13 Items: mallcafeMuseumbarberschoollibraryairporthospitalapartmentfirstationrestaurantsupermarketpolicestation

Ryan and Riley 2025-11-22

14 Items: RyanDeskTeddyChipsRileyColorChairLunchSchoolTeacherCrayonsTeacherChocolatePlayground

Fun, Word Search 2025-12-02

13 Items: Fun,Owl,Ball,Hero,Mind,Olly,Smart,Beach,Think,Super,School,Holiday,Routine,

sophia 2026-04-29

13 Items: dogscandydancesoccerschoolcraftsbarbiesglitterdressesshopkinsswimmingloldollstocaboca

Third Word Search 2022-11-28

36 Items: believable; reliablea story that is not true or is made uprepetition of initial consonant soundsa story written to be performed by actorsa word that imitates the sound it representsthe writer's position on an issue or problema story containing unreal, imaginary featuresthe primary position taken by a writer or speaker...

Sit-In Word Search 2025-03-14

20 Items: very large or impressivevery hot and uncomfortablea small village or communitymethods used to prevent pregnancymaking a ringing or clanging soundinvolving people of different racesto cut or shape something with a toola medical procedure to end a pregnancythe idea of canceling or ignoring a law or rule...

Academic Vocab 2026-04-21

14 Items: An exaggerationA comparison using like or asWhat the story is mostly aboutHow the character thinks or feelsEvents in order using dates/yearsThe message or lesson of the storyA comparison without using like or asThe beginning, middle and end of a storyEvents in order, 1st, Next, Then, FinallyTo write about a topic with lots of detail...

Mont Y8 Statistics 2023-10-10

15 Items: The process of collecting data.Entities that collect different types of data.Selected without a particular order or pattern.A series of questions used in a survey or census.Information collected for the purpose of analysis.Data collected from a selection of a larger group.Data collected from the entire group being studied....

WEDDING WORD SEARCH 2025-09-08

17 Items: GroomBrideBest ManMaid of HonorWedding MonthProposal DateFirst Dance SongHoneymoon LocationWedding Cake FlavorFather of the GroomMother of the BrideFather of the BrideBride's Maiden NameMother of the GroomBride's Married NameKody & Emma's BulldogKody & Emma's Golden Retriever

Linear Relation Vocabulary 2026-03-20

20 Items: axisFormSlopegraphLinearoriginlinearoppositeparallelof valuerelationvariableconstantequationgradientof changeinterceptreciprocalcoefficientperpendicular

Landforms & Bodies of Water 2024-11-26

20 Items: Florida for exampleLike the Hawaiian IslandsMaine sits along one of these featuresTampa Florida has one of these featuresThe Caribbean & Norwegian are two examplesShapleigh School sits atop of this featureAn area of wet land with grasses and few treesThe Urals, Carpathian and Alps are good examples...

English Term 2 Exam Word Search 2025-12-15

16 Items: Loves HermiaTrouble makermarried to LindoFather of HermiaHead is a donkeyQueen of fairiesDaughter of Lindomarried to Suyuanmarried to An meiDaughter of SuyuanDaughter of An meiMarried to Ying Yingdaughter of Ying yingIn love with Lysandervery insecure and needs validationLove potioned to be in love with Helena

summer school 2022-07-07

11 Items: noahdavidnorbyjacobhanselemanuelmirandamadylendayanethkevinsoncaptaingerald

School Dance 2023-01-19

12 Items: seniorsschedulecommitteeattentionvalentineclassicalattentionlimousinemicrophoneopportunityinconvenientaffectionate

School Objects 2023-05-17

11 Items: penbagbookdeskgluerulerchaireraserpencilnotebookscissors

At School 2024-01-24

11 Items: bagpenbookdeskrulerrubberpencilfriendteachernotebookpencilcase

SCHOOL OBJECTS 2025-03-23

11 Items: PENGLUERULERPENCILRUBBERMARKERSCISSORSNOTEBOOKSCHOOLBAGSHARPENERPENCILCASE

School supplies 2025-06-07

12 Items: PENBAGGLUEBOOKCASERULERPENCILERASERCRAYONSSCISSORSNOTEBOOKSHARPENER

School Supplies 2025-07-15

11 Items: TapeClayChalkPaintCrayonsStaplerScissorsGluestickPaintbrushStickynotesColoredpencils

School subjects 2025-10-07

11 Items: ArtMusicBreakScienceEnglishHistoryGeographyTimetableMathematicsPhysicalEducationInformationTechnology

School subjects 2025-12-18

11 Items: MATHSDRAMASCIENCEASSEMBLYCHILDCAREENGLISHLANGUAGEFOREIGNLANGUAGEENGLISHLITERATUREPHYSICALEDUCATIONRELIGIOUSEDUCATIONDESIGNANDTECHNOLOGY

School Objects 2026-03-18

12 Items: bookcasegluerulerpencilrubberpencilcrayonsbackpackscissorsstickerssharpener

School Supplies 2026-03-26

11 Items: pengluebookrulerpencilmarkercrayoneraserscissorsnotebookpencilcase

School supplies 2026-04-08

11 Items: GLUEBOOKRULERPENCILERASERMARKERNOTEBOOKSCISSORSBACKPACKSHARPERNERPENCILCASE

Ether 1-5 2024-11-17

19 Items: VeilJaredEtherFaithBargePrayerSpiritshelemMoroniChastenof Babelof JaredGentilesJareditesWitnessesRevelationConfoundedWildernessMoriancumer

La Escuela 2022-08-25

11 Items: school"I talk"schedule"favorite"Fourth PeriodEighth periodscience class"I like it more"subject prounoun for "we"How you would address a teachersubject pronoun for a group of all boys

Bio Study Word Search 2025-09-22

30 Items: A living thingAbility to do work.Smallest unit of life.energy Energy in motion.energy Energy of positionprotein A protein that spans the lipid bilayer.The ability to conduct metabolism and reproduce.backbone Spine of DNA where nucleic acid connects.Large molecule made up of strings of covalently bonded monomers....

Epoxy Attach Training 2025-04-10

16 Items: What residue if found on a bonding pad is rejectable?______ and Cure Temperature is specified in the process.What is caused by smeared or excess epoxy and is rejectable?If found in an operation it is necessary to remove and document.What type of tweezers should never be used to pick up components?...

Informatika 2023-06-05

39 Items: mišendhomewordfontrobotikonaentershiftteamslaptoptabletdeleteinsertabakuskanaliscratchkućištemonitorprogramnaredbalajkatilozinkatablicaračunalointernetcapslockautodrawkopiranjebackspacepoveznicatipkovnicarazmaknicapametnisatčavrljanjepowerpointinformatikapremještanjeprogramiranje

Don't be shy 2025-11-12

39 Items: SinLawCutEndHolyYearsMercyWrathBuildTruthDanielDariusPrayerVisionPrinceSeventyGabrielMessiahRestoreJeremiahIniquityCovenantProphetsAnointedOfferingDesolateJerusalemSanctuarySacrificeDesolationConfessionDeterminedForgivenessAbominationCommandmentsSupplicationTransgressionRighteousnessUnderstanding

Unit 7 2026-03-02

34 Items: termformzerocubicdegreelineardivideevenlymethodquarticquinticleadinggeneraldivisorproductvariablemonomialbinomialconstantfactoredbehaviordividendquotientpropertytrinomialquadraticremaindernumeratorpolynomialcoefficientdenominatorplaceholderdistributivedivision algorithm

Economics Unit Word Search 2026-03-11

16 Items: The using of goods and services.Type of resource that occurs in natureMerchandise that is bought by consumersActions performed in exchange for moneyThe money left over after all expenses have been paid.The amount of money that is given for a good or service.Factors of production used to produce goods and services....

END: SEIZURE 2023-10-24

5 Items: drugsfocalseizureepilepsygeneralized

Genetics Word Search 2026-02-25

13 Items: father of geneticsthe study of hereditydifferent versions of a genehaving two different alleleshaving two of the same allelesthe genetic makeup of an organismobservable characteristic show from the geneheterozygous individual is a BLEND of the two traitsthe allele that is masked or covered by the dominant allele...

Tracksuit Word Search 2024-11-21

11 Items: A subject that includes algebra, geometry, and calculus.Garments worn to cover your feet and ankles, often in pairs.A large piece of cloth or fabric that covers part of the floor.A sweatshirt with a hood, often worn for casual or sporty looks.A sweatshirt with a hood, often worn for casual or sporty looks....

MATH 2025-12-19

15 Items: To plotWhole NumberSeveral TermsBreaking DownSpread of DataCombo of NumbersNumber By itselfHighest Exponent+ Side of Number- Side of numberPart of ExpressionPossible Input ValuesRemovable discontinuancesAssigns a Output and InputLine that goes on for infinity

Dept. Education and Early Childhood Development 2016-05-18

16 Items: earlyyearsschoolofficegrowthstressbranchsubsidydaycarecenterscubiclelearningfamilieseducationchildhooddepartment

A Baker's Dozen 2023-01-14

16 Items: eggsteamdiaryextraicingsugarflourschoolbakingtwelvecupcaketeacherhomeworksprinklesencouragefriendship

Week 3 Spelling Words 2023-05-30

16 Items: savekeepsafeeasygraderaisethemeoceanschoolfatherscreamtravelreachedhighwaynavigatedirection

Back To School 2023-07-26

16 Items: deskbooksclasspaperpencillockerschoolaugustteacherstudentfriendsbackpackcomputerhomeworklearningknowledge

Girls Group Crossword 2024-01-04

16 Items: safeannahazylslimechloetiannabaileyschoolmikaylarespectdanielafriendsjaylynnkindnesscoloringpositivity

School Sample Puzzle 2024-01-16

16 Items: testquizmathstudysmartschoolsubjectcontentscienceenglishhomeworkeducationacademicsschoologyassessmentsocialstudies

5th Grade Ancient American Civilization 2024-10-01

16 Items: erafunparkmoundschoolrespecthistorybuildersancestorartifactnotebooktraditionmigrationevergreenelementaryexplorations

Where We Live 2024-10-17

16 Items: parkbankschooltunnelbridgeairportbusstopcarparklibrarymonumenthospitalplaygroundrestauranttrainstationshoppingmallpetrolstation

Immortal Word Search 2024-11-14

16 Items: LineGageColorHeartSchoolDiagramKubistaLiteralImmortalSelflessComponentEssentialTransportTransplantCompositionConcentrate

Hundred Word Search 2025-01-29

16 Items: TenFunDayBigHatGiftJumpPlayCountSmartHappyClassPartyDanceSchoolHundred

找到英文詞 2025-03-09

16 Items: mancarTimeworkroomfoodnightwomanchildhousewatermoneypersonfamilyfriendschool

Kidd-O's 2025-05-13

16 Items: JaPatArtLynnHollyKiddoLeslieArtistSchoolJarrettGrandmaGrandpaFriendsCartoonAddictionCartoonist

Mr. Henke is Missing 2025-05-23

16 Items: HelpHenkeRulesAbsentDangerPoliceReturnSchoolMissingReadingTeacherWritingLearningStudentsClassroomSubstitute

Rhyming words 2025-08-01

16 Items: cookbookhairfineminehourcoolmoondressguesschairsoundspoonflowerschoolground

Welcome To Grade 3! 2025-08-10

16 Items: MATHSCHOOLWELCOMEPENCILSGRAMMARHISTORYSCIENCEVIRTUESCOURAGERESPECTSPELLINGPATIENCEKINDNESSNOTEBOOKSFRIENDSHIPHELPFULNESS

Pencil Word Search 2025-09-14

16 Items: penbookrulerpaperpencilschoolerasercolorsliquidcrayonsmarkerscompasssuppliesnotebooksharpenerhighlighter

Dict one 2025-09-21

16 Items: PENBAGBOOKCASEGLUENAMESTICKCLASSRULERSCRAYONSCHOOLERASERPENCILFRIENDNOTEBOOKHIGHLIGHTER

Ryan Word Search 2025-11-22

18 Items: BusFunRyanDeskBearRileyBooksBooksTeddySchoolSchoolCookieMannersTeacherParentsColoringDiscoverPlayground

Welcome to Year 2 2025-12-02

16 Items: funstemsportmusicschoolchangeyeartwolibraryrespectgrowingnorthernlearningkindnesschristianchallengesresilience

esd 2025-12-10

16 Items: gymbusmathtardynurseschoolexcusesocialabsenceteachersciencestudiesscheduleclassroomprincipalattendance

Tall Word Search 2026-01-06

16 Items: bigtallreaddishforkmeathandangerschooljanuaryeyebrowamericancharacterbreakfastdisgustedrestaurant

1️⃣8️⃣ Classroom Memories 2026-02-08

16 Items: DESKREADTIMECLASSBOARDBOOKSCHAIRWRITELEARNQUIETSMILEPENCILLESSONMEMORYSCHOOLFRIENDS

2️⃣1️⃣ Homework Nights 2026-02-08

16 Items: DESKREADLAMPTIMERESTBOOKSWRITESTUDYPAPERQUIETLEARNNIGHTPENCILSCHOOLMEMORYHOMEWORK

1️⃣9️⃣ School Supplies 2026-02-08

16 Items: PENBAGBOOKNOTEDESKCASEDRAWPAPERRULERWRITELEARNTOOLSCLASSPENCILERASERSCHOOL

2️⃣4️⃣ School Friends 2026-02-08

16 Items: FUNDAYPLAYDESKTALKTIMEBONDCAREHELPCLASSLAUGHSHARESMILESCHOOLMEMORYFRIENDS

Happy Valentine's Day 2026-02-12

16 Items: ElaJojoRemyLoveColinLillyHappyRachelAsaiahHeartsSchoolGriffinCarrollValentineMrsKiernanFourthGrade

The Boy in the Back of the Class : Word Find 2026-02-26

16 Items: TomJoyHopeAhmetJosieAlexaQueenGuardMr.FrySchoolPalaceMicheleBrendonKindnessFriendshipPomagranates

In the lesson 2026-03-18

16 Items: penbagLizbookMikerulerpupilclassMaximpencilrubberschoolteacherclassroompencilcaseexercisebook

Pen Pal Word Search 2026-03-19

16 Items: JapanpunchtokyoschoolsocialmonkeySpokaneAcademyenglishorigamistudentmukogawalaughterRiverfrontfriendshipInternational

Lemuel Word Search 2026-04-08

16 Items: abelhesdanyalianitamickybreaklemuelnaihershalomdivoraschoolbarberlillianmercedesrangeroverlandcruiser

J’aime / Je n’aime pas 2026-04-19

16 Items: jaimeIlikemusicbookssportslécoleschoollesportlesamisfriendslamusiqueleslivreschocolatejenaimepasIdonotlikelechocolat

all about me 2026-04-22

16 Items: pinkkindfallpizzahappysisterelevenschooleasterpenguinyoggiesoctoberHigginssmartiesDr.peppercantaloupe