current events Word Searches

M2L9 - Vocabulary 2025-01-07

15 Items: Godlike.Universal.Error; mistake.Very wise person.On a grand scale.Honesty; morality.Devious; underhanded.Reaching very far; long.Protection from loss or damage.Able to be hurt; open to attack.Cause to wake up; make conscious.Likely to be followed by fortunate events; promising.A story that is part of a culture’s traditional knowledge....

Characters in Insignificant events in the life of a cactus 2025-12-02

10 Items: MomDadAvenZionLandoHenryConnerArizonaJosephineSpaghetti

Orange Word Search 2026-03-19

10 Items: - clothing worn on the body- being nice and caring to others- treating people fairly and gently- helping and caring for one another- to understand new ideas and stories- a place where children learn together- people who love and care for each other- paying attention when someone is speaking- a bright color worn to show care and support...

types of movies 2024-07-19

10 Items: Aims to evoke fear or suspenseIntended to make audiences laughBuilds suspense and excitement .Centers around love and relationshipsFocuses on serious themes and emotionsUses animation techniques to create the filmPresents factual information or real-life eventsInvolves magic, mythical creatures, or imaginary worlds...

Heritage Plantation Word Search 2025-08-29

11 Items: the name of our communitythe name of our communitya street name in the communitya street name in the communitya street name in the communityan amenity located at the clubhousean amenity located at the garden parkthe type of homes our residents live ina place where community events take placepeople who live together in a neighborhood...

The Veldt 2025-10-25

12 Items: power to give orders; controlability to make choices; powerhints about events to come; cluesplace for caring for young childrenuse of machines to do work; roboticsrelying on others for help; reliancepermission to do something; agreementoverseeing work or people; managementauthor's attitude toward the subject; mood...

Documentary Conventions Word Search 2024-09-10

9 Items: Original footage of real events that have occurredFootage where the presence of the camera is unacknowledged by the people in the shot (e.g. two people having a real conversation)The inclusion of authentic, original footage that captured a past event in the real world (e.g. recordings of police interrogations)...

Adjectives 2022-12-05

13 Items: adept - very skilledfrank - direct in speechlustrous - brilliant; shiningample - sufficient or more than enoughsleek - vigorous or energetic; stimulatingvibrant - vigorous or energetic; stimulatingdiligent - consistent in effort; hard-workinggenerous - freely giving and sharing; unselfishgleaming - giving off light or brightness; radiant...

A Level Physics 2026-01-28

93 Items: WorkMassWaveFluxForcePowerEnergyScalarVectorWeightChargePhotonStressStrainTorqueGravityDensityElasticCurrentVoltageCircuitIsotopeHookeanDampingQuantumNucleonMomentumVelocityDistanceFrictionPressureActivityEmissionRedshiftResultantExtensionHookeslawFrequencyAmplitudeInsulatorConductorRadiationHalf-lifeInductionResonanceWavelengthReflectionRefraction...

100 Word Monster 2026-03-26

93 Items: atommassdatacellplotrootmodelcycleorbitforceinferadapttradethemegenreenergymattervolumesystemgalaxyplanetmotionsamplefossiltissueimpactchangeregionmodernrightssymbolauthorprefixsuffixmagnetdensityerosionweatherclimategravityinquiryobserveanalyzepredictcompareexplainpatterncontrolmixtureelementmineralspecieshabitatsurvivebalanceprocessfeatureculture...

Electricians 2025-04-16

50 Items: HotFanWireLevelPowerMeterHammerSpliceBrakerGroundWirenutPigtailHomerunVoltageCurrentCircuitNeutralOhms-lawTravelerDoor-bellTool-pouchLight-bulbResistanceSwitch-legSafety-vestTransformerPush-switchLow-voltageCable-ripperJunction-boxHigh-voltageLight-fixtureWire-strippersSafety-glassesFour-way-switchGFCI-receptacleLong-nose-pliersThree-way-switch...

Ocean Motion 2025-04-01

23 Items: Ocean waves areThese ocean bulges are known asEach particle moves up and down called anThe area of ocean away from the Moon are the_______________ waves need a ________________Currents flow in the shape of the basin called- When a wave reaches shallow water, it slows downaffect water up to a depth of several hundred meters....

Acronyms for Medical Coding Governing Organizations 2025-03-15

35 Items: Nurse PractitionerPhysician AssistantOffice for Civil RightsElectronic Health RecordAdvance Beneficiary NoticeCurrent Dental TerminologyEvaluation, and ManagementAmbulatory Surgical CentersOffice of Inspector GeneralAmerican Medical AssociationCertified Professional CoderLocal Coverage DeterminationNational Provider Identifier...

Test 2024-08-04

4 Items: logical unit at stores datacontainer for files and directoriespack pattern it starts from the systems root directorypot pattern that begins from the current working directory

Module 7 2025-12-09

11 Items: When an offender is court ordered to refrain from actions that breach the contractCourt ordered remedy for Breach where the offender must complete their obligations (two words)When a party indicates that they no longer consider themselves bound to the contract this is ____....

Thermal Energy 2023-11-08

6 Items: hot goes up, cold goes downusing heat waves to cook foodtransfer of heat through touchconduction casing water to vaporizetransfer of heat electro-magnetic through wavesall substances in a system reach the same temperature

Electrical Circuits 2025-04-21

11 Items: batterieslight blubsflows in one directionchanges multiple directionsclosed path electricity follows.has a break, stops the electric flow.a mix of series and parellel circuit.electric parts are connected in a loop.something that is part of electrical current.all components are complete, electricity can flow....

Lesson 15 2025-12-01

10 Items: extremely large or vast.unproductive; nonproducing.to overturn or cause to overturn.to bear up under or function in spite of.a calamity with widespread effects; disaster.to meet or face without evasion or avoidance.to give pleasure or satisfaction to (someone).causing or involving great danger; risky; hazardous...

Lesson 2.1 2026-03-03

10 Items: without motion; fixed.extremely dry or parchedto divert the attention of.bright; brilliant; intense.having a complicated structure; not simple.to cause positive results for; be helpful to.to believe in the honesty of something or someone.apt to share with or sacrifice for others; generous.the story line or sequence of events in a novel, play...

Mexico Word Search 2026-03-14

10 Items: - people who celebrate together- moving the body to music for fun- bright shades used in decorations- to enjoy a special day with others- being able to live and choose freely- a march with people, music, and flags- songs and sounds played at celebrations- a cloth with green, white, and red colors- a country where this holiday is celebrated...

Vocab Words 2024-11-19

10 Items: Break down, faint.Without the basic necessities of life.Not securely held, likely to collapse.Making a disturbingly loud or harsh noise.Bad-tempered, uncooperative, argumentative.Showing a critical or disrespectful attitudePersuading someone through coaxing or flatteryA surface shaped into alternating ridges/grooves....

CCR Word Search for Extra Credit 2025-05-01

11 Items: Central bank of the United States:Current secretary of the treasury:Current chair (leader) of the Federal Reserve:A government-issued bond that lasts for 30 years:A government-issued bond that lasts for 1 year max:A government-issued bond that lasts for 2-10 years max:If a bond you buy is rated AAA, then this is that bond's:...

Unit 4 2025-12-06

16 Items: CovereddeliciousVery angryTo rememberVery unpleasantRunning away from a place;A large amount of somethingAnnoying or causing troubleA particular attitude or viewThe person suspected of a crimeSomething to do with literatureTo work very hard for a long timeTo try and find out the facts about somethingThe speaker who tells all the events in a story...

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

Cru 2025-10-14

12 Items: to happenat the same timenot confident, anxioussomething done quicklysafe, locked, confidentmoney or system of moneycorrect, free from errornow, at the present timeto heal or restore healthto reduce or limit somethinga person who oversees a museum or other place with exhibitssomething that happens or exists that leads to another thing

POSTIES 0219 Big Read 2024-02-07

6 Items: Gary Wong works as a video _____.How many folders are for Hong Kong films?What are hanging on the walls of the Moviemarks shop?Many Japanese cinemas give out film fliers for ______.In what language are most of the fliers at Moviemarks?In addition to selling posters, Moviemarks also organises _____.

Planets 2022-05-31

15 Items: Our planetAn icy planetThe red planetOrbits our planetThe brightest starOur is the Milky WayThe planet with ringsDemoted from a planetOld number of planetsGod of the Sea's planetGoddess of Love's planetThe planet closest to the sunCurrent official number of planetsThe largest planet in our solar system...

Third Word Search 2025-05-26

100 Items: GumDayGymFunMathMuchGuggParkAreaTimeBestPensThirdWorldLunchMusicTalesNounsVerbsBonesJointGamesPartyHappyProudBooksPaperGoalsShalomMertonArcadeRecessFablesPoetryMotionTraitsHeroesEventsGrowthPencilReadingWritingStudiesScienceCursiveBretzelBittmanLibraryFictionFictionOpinionAdverbsWeatherClimatePelletsMusclesFriendsPost-itCrayonsPencilsMarkers...

Study Word Search 2025-08-18

105 Items: keyfunartwifiexamnapscooklockclubchattidygoalgrowstudycleanmusicpartyquietbillsnotesalarmpatiofloordecorrelaxfocusshareunitysmilehellotrustgamesplantlightpeacecoffeefinalsfridgesnacksloungemovieschoresdishesbudgetgradescampusenergybuzzerpostercreatehealthsafetyeventssportssignuplistenengagevisionlaundrykitchenrecycleweekendnetworkrespectfriends...

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

FAST Test Review 2024-04-16

29 Items: sound wordsan exaggerationthe lesson in a storyexplains steps in orderthe problem in the storyhow the text is organizedhow the conflict is solveda group of lines in a poemthe key events in the storywhat the text is mostly aboutexplains events in time orderwords that mean the same thingwords with the same ending sound...

28 2025-08-17

15 Items: Firearms.Illegal goods.Illegal substances.Alternative to prison.Release under conditions.Secretly transporting illegal items.A schedule of planned motorcycle routesThe flag representing a motorcycle clubA small flag featuring the club’s emblemAnthem sung or played at club gatheringsA popular drink to fuel riders during stops...

Evangelion 2024-07-18

7 Items: A translucent liquid used in Evangelion cockpits.The organization responsible for combating Angels.Mysterious and enigmatic pilot of Evangelion Unit-00.Mysterious beings that threaten humanity in the series.The main protagonist, a reluctant pilot of Evangelion Unit-01.Chief Operations Officer at Nerv and surrogate guardian to Shinji....

vocabulary 2023-10-27

18 Items: to decideto be luckyto be reasonablerelated to seeingdevotion; fondnessrelated to movementmissed; didn't havenot balanced; unevenlook toward; confrontdifficulties; barriersrelationships between peopleinside a person's mind or selfmany things, people, or eventsmore important than anything elsethe imparting or exchanging of information or news....

Night of the Ninjas Chapter 8 2023-06-05

10 Items: What can't they see?What knocked Jack over?What is the mouse's name?What is the sister's name?What water did they go to?What is the brother's name?What do they have to follow?What did Jack try to be like?Who were on both sides of them?What was the mouse using to cross the water?

President Word Search 2026-01-11

10 Items: - the leader of a country.- the right to live and speak fairly.- to remember a special day or person.- a person who guides and helps others.- to show respect for important people.- to choose a leader by making a choice.- a cloth with colors that stand for a country.- showing care and good behavior toward others....

100 2024-03-23

103 Items: ohmloadfusecoilnodewirewattpowerdiodemotorjoulehenryfaradhertzrelayohmicseriesswitchamperegroundbranchjoulesdipolecurrentohmslawnetworkvoltagebatterycircuitammeterfaradaymaxwellcoulombkineticheatingthermalelectronparallelresistorterminalkirchoffnonohmicohmmetermagnetismconductorgeneratorrectifierinsulatorisolationelectrodevoltmeterpotential...

Extra Class License Study 2024-11-19

25 Items: Signal synchronizationSignal wave orientationAntenna signal coverageSignal strength reducerSignal mixing distortionFrequency range expansionSignal phase relationshipReceiver signal conversionMultiple antenna alignmentSignal reception techniqueSignal transmission methodTransmission line techniqueElectrical flow measurementSignal frequency stabilizer...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Science Olympiad Word Search 2026-02-20

100 Items: LawDNAAtomMassCellDataLensWaveAcidBaseForceOrbitModelGraphPrismSoundLightVirusVolumeEnergyMotionFossilGalaxyTheoryCarbonOxygenHeliumProtonEnzymeElementMixtureDensityGravityCircuitCurrentVoltageHabitatNucleusErosionVolcanoClimateControlNeutronIsotopeNeutralMoleculeCompoundSolutionFrictionVelocityOrganismMembraneSedimentRotationVariableSpectrum...

18 2025-08-16

15 Items: Controls speed.Round brake component.Old way to start engine.Gauge displaying engine RPMRear light signaling brakingEngages and disengages power.Keeps bike upright when parked.Blinking light indicating a turnInstrument showing current speedFront light used for night ridingProtective sticker on the fuel tankThe motorcycle’s main fuel container...

Goal 7: Affordable and Clean Energy (100 Words) 2025-11-17

100 Items: AidAirGasPaySunUseCostHeatHelpHomeIdeaNeedSafeTeamWindWorkMoveRiseFlowRateCityCleanGreenHydroLightOfferPowerSolarTrashWasteTrustShareSolveCycleGoalsFullyAccessEnergyNatureSourceSwitchInformDesignImpactEvolveSafetyPolicyBatteryBiomassInstallNuclearThermalBatterySupportConnectEducateImproveAdvanceDevelopPurposeCurrentExploreProtectBelieveJourney...

the ocean 2025-02-06

100 Items: SeaBayReefWaveTideSandClamTunaCrabRaysKelpSealGulfDockPierBoatShipOceanCoralBeachShoreShellSquidWhaleSharkSquidAlgaeStormCanoeYachtScubaDiverMusselSalmonShrimpDugongWalrusTurtleLagoonHarborStraitIslandVesselCruiseCurrentOctopusScallopDolphinLobsterSeaweedManateePenguinSeaLionTsunamiCycloneTyphoonEstuaryChannelSnorkelAquaticSeafoamSandbarStarfish...

100 Word Science Monster 2026-03-26

98 Items: atommassrockcelldatamodelcycleforcespeedorganorbitinfermatterenergyvolumesystemmotionmagnetfossiltissueoxygencarbonrunoffplanetgalaxydensityelementmixturegravityinertiacurrentcircuitvoltagethermalweatherclimateerosionmineralcrystalspecieshabitatsurvivefoodwebeclipsecontrolobservepredictanalyzecompoundsolutionparticlemoleculefrictionpressuremagnetic...

100 Word Science Monster 2026-03-26

98 Items: atommassrockcelldatamodelcycleforcespeedorganorbitinfermatterenergyvolumesystemmotionmagnetfossiltissueoxygencarbonrunoffplanetgalaxydensityelementmixturegravityinertiacurrentcircuitvoltagethermalweatherclimateerosionmineralcrystalspecieshabitatsurvivefoodwebrevolveeclipsecontrolobservepredictanalyzecompoundsolutionparticlemoleculefrictionpressure...

National 4 Physics Wordsearch 2025-04-01

20 Items: The rate of change of velocity?The number of waves per second?The emission on alpha, beta or gamma?Another term for Potential Difference?The rate of flow of charge in a circuit?The name given to the Sun and the planets?Component used to measure the temperature?The only particle in an atom that can move?Quantity that is often simplified to speed?...

SWEtacular Word Search 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

Technician Class License Study 2024-11-19

24 Items: Radio signal measurementPower output measurementElectrical pressure unitComplete electrical pathNoise reduction mechanismTwo-way communication modeSignal transmission methodCommunication signal rangeSignal frequency generatorFrequency measurement unitSignal transmission boosterSignal strength measurementSignal information encoding...

your sanity 2026-03-03

100 Items: ifrubtipjamdruglandsolobaldkillsafelampraidslowtermbootstepskipcallmazepoemburstgraceidealshocklimitratiocleanheavytermsspellproudfeastshinedraftlightshowersellersleeveprayeradvicesermonmurderrocketrejectrotatepoetryignoremarginpleasenaturechancepocketstrolltemplemiserydignitycurrentfantasyvolcanoglassesfeelingoutlinedivorceexpressmusicalprinter...

Spring fling 2026-03-17

99 Items: EGGNESTLAMBTHAWKITEBLOOMROBINTULIPMUDDYBUNNYCHICKCROSSSEDERMATZOCOMALFLOATTEXANAGGIEMULCHPORCHPUDDLEBREEZEPOLLENPASTELEASTERBASKETBONNETEXODUSTASSELTUBINGRAPIDSCOOLERGRUENERAIDERBOBCATFIESTAWARMTHSPROUTGARDENTROWELFEEDERCOCOONPICNICBLOSSOMALLERGYDIPLOMACURRENTSANDBARUNICORNMUSTANGBEARCATEQUINOXSAPLINGCOMPOSTMONARCHTADPOLERENEWALREBIRTHFRISBEE...

Unit 3: Spelling Quiz 2 2022-11-08

25 Items: to fill with lifeto exert the musclesto hypnotize; to enthrallto treat as less than humanto describe the qualities ofto catalog as separate itemsto fill with energy; invigorateto decompose by electric currentto place something under pressureto make helpless or unable to moveto put to use for a certain purposeto become completely aware of something...

#NotCom Word Search 2015-08-24

112 Items: .DOG.RUN.BIKE.CAFE.CAMP.CARE.CITY.COOL.FARM.FISH.FUND.GOLD.GOLF.GURU.LAND.LIFE.PLUS.TEAM.TIPS.TOYS.ZONE.COACH.GIFTS.GLASS.GUIDE.HOUSE.LEASE.LEGAL.MEDIA.MONEY.PARTS.PIZZA.PLACE.SHOES.SOLAR.STYLE.TIRES.TODAY.TOOLS.WATCH.WORKS.WORLD.AGENCY.CAMERA.CENTER.CLAIMS.CLINIC.COFFEE.DENTAL.ENERGY.EVENTS.EXPERT.HOCKEY.PHOTOS.REPAIR.SCHOOL.SUPPLY.TENNIS.VISION...

HOMOPHONES 2014-12-14

97 Items: besoarkbuyduedyeewefluforlednewwonseesumtoewaraideislebearbeatburyblewbuoyseedsellcordfarefeethairheelliarmademaleneedpailpeekpourpreywrapringrollroseseemsoresoultalewailwaitwornaloudaltareightbirthbreakbreadbuildsensesightqueuedoughflourgrownwholepeaceplanereignwritesteeltheretongswastewitchborderbrowsechoosecorpsecourseelicitgreaselessonceiling...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Goal 7: Affordable and Clean Energy (100 Words) 2025-11-17

100 Items: AidAirGasPaySunUseCostHeatHelpHomeIdeaNeedSafeTeamWindWorkMoveRiseFlowRateCityCleanGreenHydroLightOfferPowerSolarTrashWasteTrustShareSolveCycleGoalsFullyAccessEnergyNatureSourceSwitchInformDesignImpactEvolveSafetyPolicyBatteryBiomassInstallNuclearThermalBatterySupportConnectEducateImproveAdvanceDevelopPurposeCurrentExploreProtectBelieveJourney...

Freedom Word Search 2026-02-06

10 Items: - a happy feeling about the future- to understand new ideas and facts- being kind and sharing with others- being able to live and make choices- a march with people, music, and smiles- people who love and care for each other- people who live, work, and help together- to have a happy day for something special...

Beyond Agents 2024-11-07

20 Items: LegalDelinquencyStipulationRemove DebtsAdding DebtsFunds requiredBetter Life PlansName of a CreditorName of a CreditorPayments in ProgressSystem to take chatsRequired DelinquencyAbove Graduation LoanResolution In ApprovalAuthorization to communicateCrossroads Financial TechnologiesResource to use to open client's programs...

SWEtacular Word Search_1 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

SERIAL VOCAB 2025-11-12

16 Items: Clear and makes sense.Wanting to get revenge.Lasting for a long time.To break someone’s trust.To record events in order.Impossible to prove wrong.Full of problems or stress.A strong feeling of worry or fear.To make up or lie about something.To show that something isn’t true.When something gets dirty or unsafe.A person or thing that causes danger....

Chettinadu Puzzle 2026-01-03

16 Items: Simple onion gravy side dishFinely woven palm-leaf basketStainless steel coconut slicerOrnate and proud doorway designTiny silver rattle for childrenCrispy and soft white snack itemAuthentic crunchy rice flour snackHand-box used to keep money safelyCentral open courtyard of the homeUnique address for a sister-in-law...

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Greek Roots Week 3 2025-09-09

10 Items: join togetherextremely activeof the same kind; alikegather into a crowd or massdiverse in character or contentan organism that cannot produce its own fooda group organized for purposes other than generating profitexaggerated statements or claims not meant to be taken literally...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Vocabulary - Kids Box 6 | Page 78 2024-10-05

11 Items: They spoke Latin.An ancient language from Rome.A way to show events in order.The Normans spoke this language.A tribe whose name starts with "J."To enter and take control of a country.The name 'England' comes from this group.People from France who invaded England in 1066.Areas of land with their own names and leaders....

Remember Word Search 2025-12-30

10 Items: – a symbol of hope and remembrance.– being caring and gentle to others.– to gain knowledge so we can do better.– to look after others and show concern.– a time when people live without fighting.– showing care for people and their feelings.– to think about people and events from the past.– believing good things can happen in the future....

Energy Science Efficiency & Systems 2026-03-31

15 Items: What element is the primary component of coal and oil?Which Law of Thermodynamics states that energy is conserved?What is the unit of energy often used to measure heat in food?What is the unit used to measure the flow of electric current?What is the ratio of useful energy output to total energy input?...

The World on the Turtle's Back 2025-08-27

9 Items: Truffles are considered a ________ .The new deck of cards wasn't very ________.The woman __________ searched for her missing dog.___________ the literary devices used in this poem.___________ the author's meaning in this paragraph.The knights swore to __________ the enemies of the king.Authors often employ ____________, to hint at future events....

4과 단어 2022-07-07

3 Items: board steponto become calm events visible weightnecessarily particular culture lasting effect impression swelltraditional trip national impressive huge princess appear destiny geton servant setoff wave pourdown calmdown faraway soon shore

English Discovery Words 2025-09-22

15 Items: an animal who barksthe king of the junglea white drink from a cowsomething you use to drinkto move your body in watera place where the doctor worksa place in school with many booksa big room for meetings or eventsa long yellow fruit that is sweetsomething you use to sweep the floora place where children playing around...

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

29 2025-08-17

15 Items: Illegal tradingOrganized drug group.Addictive opioid drug.Crystal methamphetamine.Another name for Marijuana.Anthem or theme sung by a motorcycle clubA ride exclusively for female club membersSweet treat often shared at biker gatheringsA celebratory cheer shared among club membersA group motorcycle journey organized by the club...

Non-Fiction Text Structures 2025-01-28

5 Items: / Topic word,explanations,and fact of a topicand Contrast / Same and different between two topicsand Solution / Something that's wrong and how to solve it& Effect / Reason something happens and,or the result of somethingChronological / Events told in the order they later(F,S,T,etc order), one after the other

7.11 Spelling Words 2025-04-15

10 Items: An animal that eats only meat.To make someone lose hope or confidence.Unable or unwilling to believe something.The right to vote in political elections.The state of being unsure or not knowing.Living by killing and eating other animals.To be too much to handle; to crush or overpower.Made or done without method or conscious choice....

Lesson 24 2026-02-09

10 Items: to manage to avoid or evade,the location of any action or event.a complete, often detailed list of thingsestablished by custom or usage; traditional.income obtained from investment or property.an undertaking or enterprise that involves risk orsuitable and easily turned to one's needs, purposesnot marked by interesting or unusual events; routine....

Lender Placed 2023-10-25

12 Items: Who is the insured on an LP Policy?LP insurance covers protection for what?The Level numbers help us identify the ______ on the loanIf the coverage for LP shows WO that means it's for what risk?What's the acronym of the agency that regulates LP requirements?The status of the LP when there's no current preferred coverage on file...

Posties 1016 Kongcept 2023-09-26

6 Items: Kowloneon is a _____ light workshopthe art or practice of designing buildingsdescribes something different to everything elsea record of past events of a particular period or placethe habits, traditions, and beliefs of a country, society, or group of peoplean event at which a group of people meet to learn more about something by discussing it

National Word Search 2026-03-30

4 Items: GDP measured using current pricesGoods Products used to make other productsThe total value of all goods and services made in a countryIncome Accounting A system that tracks a country’s total economic activity

ELD-2 Unit 1 2025-09-12

17 Items: writingaction wordsthe events of a storythe problem in a storythe words a, an and thea person, place or thingwords that describe nounsa type or class or writingthe time and place of a storythe people or animals in a storythe lesson or main idea of a storywords that show emotion like "Wow!"a type of story about a person's life...

Physics Challenge 104 words 2025-07-14

104 Items: ohmlawsungastimeAtomBetaloopheatmarsstardustraysForcespeedForceWavesHertzAlphaGammavoltsgraphspaceearthvenusplutopolesNewtonProtonGMtubeampereseriesEnergyjouleschargesaturnuranusnebulacometsgalaxyGravityDensityNeutronIsotopecurrentvoltagecircuitkineticnuclearelasticaveragecoulombdisgrammercuryjupiterneptunemagnetsVelocityMomentumdistanceFriction...

Pencils, Papers and Puzzles 2025-06-12

12 Items: Assignments done after schoolThe person who leads the classThe class you use a calculator inA place full of books and researchOne of the school's primary colorsThe school's top-level sports teamThe mascot of Wayne Hills High SchoolTime off from school where you can relaxThe ceremony marking the completion of HS...

Mysteries and Investigations 2022-10-19

24 Items: lowlyaboutsectionsomewhatrecordedpanickedcompletepresent daylooking afterpeople in chargelet out blood fromarea under controlhung in one positionstayed close togetherin direct contact withperson serving militaryone-celled living thingstowns without people leftspoke without making sensesubstance that kills germswidespread attack of a disease...

Literary Terms 3 2025-12-07

25 Items: Brief overview.Hinting future events.Using humor to criticize.Systematic investigation.Asking questions to learn.irony Unexpected outcome.Speed and rhythm of a text.Combining multiple sources.Distinctive way of writing.Scene set in an earlier time.Restating in different words.Line continuing without pause.Revising text for correctness....

Sorry Word Search 2026-02-05

10 Items: - being kind and gentle to others- treating people nicely and fairly- to understand new ideas and lessons- people who care for and love each other- the ground and places where people live- to pay attention when someone is speaking- stories about people and events from the past- being kind and helping one another as a group...

301a Magnetic Particle Inspection 2023-12-07

22 Items: Portable electromagnetic __________Ability of a material to RETAIN magnetismNumber of flux lines per cross-sectional areaPass electricity directly through a ferrous partImaginary lines used to visualize magnetic fieldsForce required to reduce flux density to near zeroEvery part subjected to magnetism must be ___________...

ELIZABETH AND JACE 2025-05-31

40 Items: Jace's hometownJace's first carWhere Jace proposedMonth Jace proposedElizabeth's hometownMonth of the weddingHoneymoon destinationJace's degree programJace's favorite colorElizabeth's favorite foodJace's favorite accessoryElizabeth's favorite bandElizabeth's favorite colorElizabeth's favorite craftThe best box brownie brand...

Eight Months 2025-06-26

26 Items: catreaddrinkdiscordboardgameice creamcurrent dayyou make me?overachieverour call timefast hedgehogyou live in..the one i loveHappy birthdayi see that townwhere you going?explosive expertyou do that oftenyou say that oftenhope you get it todayfrom that friend bookin my restless dreamsyour favorite activitythey give us items to do...

Latin and Greek Word Roots 2025-04-14

10 Items: Soph : Wisdom, knowledge, and insight.Anthrop : Human, relating to humans or mankind.Phil : Love, affection, or fondness for something.Bibli : Book, pertaining to books or written works.Chron : Time, relating to time or chronological events.Metri : Measure, relating to measurement or dimensions....

Flag Word Search 2026-02-02

10 Items: - words used to show appreciation- a place where a person is buried- to show respect and say thank you- a march with people, music, and flags- being strong and not afraid to help others- a person who serves and protects the country- a time with no fighting and people feel safe- to think about people and events from the past...

electrical circuits 2025-04-21

11 Items: measures resistanceelectricity flows one way onlymix of parallel and series circuitsmeasures how much energy is flowingmeasures how much energy is being useda particle that carries electric chargewhat circuit is it when the switch is onwhat circuit is it when the switch is offthe circuit is connected with single loop...

Iya, the Camp-eater 2025-08-27

10 Items: "Wazzup?" is an example of __________.The house was built ________ the ocean.The Air BnB the family stayed in was a _________.The camel carried his _________ across the desert.The doctor will ________ what disease the patient has.Authors often use ___________ to hint of future events._________ the types of literary devices used in this poem....

Senior spelling list 2 2025-12-11

8 Items: A rodent with a fluffy tailTo adapt to someone's needsA person who works in an officeAn adverb with a clear and determined mannerHaving a mark left by a healed wound, sore or burnAn object or weapon for throwing, hurting or shooting at a targetknowledge gained from doing/feeling things or specific events that happen...

JCAHO Readiness- General Info 2026-03-24

14 Items: Code blackCode red procedureSevere weather threatWho is Kathy Wareham?Hostage or active aggressorWhat does a code yellow mean?Esclatation of concerns first stepNo food or drink at the __________.Reporting system for colleague injuryProcess for using a fire extinguisherYou must wear your badge above your __________....

Journalism Vocabulary Words 2024-09-25

15 Items: believabletrustworthythe most up to dateone's personal opinionPersuade Inform Entertaininformation that isn't truewhy the author wrote the text itselfsources that aren't direct or originalthe goal or purpose of an organizationthe website domain ending of a companysources directly from the original sourcethe website domain ending of an organization...

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Word Search ELA 1/7/25 2025-01-08

15 Items: to keep saferefuge, sanctuarycareful, meticuloushaving little to no rain; drykind, generous, compassionateto complete or to end somethinga close friendship; companionshipa time when a country isn't at warsetting someone or something separately from otherscombine something with another so they become a whole...

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

23 2025-08-17

15 Items: Rules bikers live by.Serious loyalty pledge.Ink showing club loyalty.Process of proving loyalty.Common outlaw biker symbol.Seasonal ride to welcome warmer weatherTribute ride held to honor a fallen riderYearly organized motorcycle ride or eventGroup ride organized to raise funds for a causeHigh-speed motorcycle competition on a paved track...

Word Search 2026-03-03

7 Items: Extremely great in amount, scale, or intensityEasily perceived or understood; clear, self-evidentPertaining to the preparation, use, or sale of medicinal drugsCapable of persuading others of the truth or validity of somethingIn the end, especially after a long delay, process, or series of events...