country music Word Searches

Earth Day Review 2024-04-30

10 Items: reduce, reuse, and _________month where we celebrate Earth Daythese cover more than 70% of our planetcountry where the first Earth Day was celebratedthe largest civic celebration to protect our planetinstead of buy water bottles you should use a _________one of our main problems are air, water, and ground _______...

Answer Key -Summit International Schools - Spelling List for Grade 3 - Week 6 2025-10-01

10 Items: – very, very big or heavy.-water that falls from the clouds in drops.– something big, special, or very impressive.– really good, wonderful, or big in size/importance.– the number that comes after seven and before nine.– something that belongs to or is about a whole country.– a sweet baked food, often eaten at birthdays or celebrations....

Fa Mulan Vocabulary 2025-10-10

12 Items: Buildings where soldiers live.To accompany someone as protection.Great courage in the face of danger.The people from whom one is descended.Respect for one's parents and ancestors.Regions or territories within a country.To give or present an honor right or gift.Close companions, especially fellow soldiers....

Mr Curran's Word Search 2023-10-05

10 Items: Choice of wordsAble to be seen or known in advanceWhat a jury says is true after a trialTo say the opposite of what someone saysto charge with a crime by finding of a juryReference that provides the definition of wordsA leader who has complete control over a countryThe student with the highest rank in a graduating class...

Famous Places Word Search 2.0 2024-05-17

10 Items: It is the capital of Japan.The Taj Mahal is in ________.Old San Juan is a city in ___________.Is an old and very big temple in Cambodia.The Big Ben is in a city called __________.The Great Pyramid of Giza is in what country?You need a _________ to visit other countries.A lot of planes land and takeoff from this place....

Polynesian Panthers 2024-10-14

10 Items: Who was the leaderWhat group influenced the polynesian panthersWhat country inspired the Polynesian PanthersWhat social issue did the Polynesian Panthers fight againstsocial movement in the U.S. inspired the Polynesian PanthersWhat police operation targeted Pacific Islanders in the 1970sWhat city was the Polynesian Panthers' headquarters located in...

Christmas Word Search 2024-12-06

10 Items: Where was baby Jesus born?How many ghosts show up in A Christmas Carol?What do naughty children get in their stockings?What Christmas themed ballet premiered in Russia 1892?What Christmas decoration was originally made of silver?Which words follow "Silent Night" in the Christmas carol?In what language does 'Mele Kalikimaka' mean 'Merry Christmas'?...

Barefoot Dreams of Petra Luna 2025-09-20

10 Items: A symbol of Petra's dreams and hopePetra's last name, meaning "moon" in SpanishWhat she holds onto,even during her hardest momentsThe brave 12 year-old girl who is the main characterWhat Petra and her family are searching for in AmericaThe violent conflict that causes Petra's family to fleeSpanish word for grandmother, who guides Petra's journey...

Sayyidunā ‘Īsā (عليه السلام) 2025-12-20

10 Items: The mother Sayyida Maryam (عليها السلام)The Mother of Sayyidunā ‘Īsā (عليه السلام)The Mother of Sayyida Maryam (عليها السلام)The Father of Sayyida Maryam (عليها السلام)The country Sayyidunā ‘Īsā (عليه السلام) was bornThe Angel who visited Sayyida Maryam (عليها السلام)The town where Sayyidunā ‘Īsā (عليه السلام) was born...

The Great Depression 2022-10-31

10 Items: When you owe moneyThe collapse of world tradeWhere people store their moneyWhen people didn’t have a job, they were ———One of the most depressing moments in historyWhen people didn’t have a home, they were ———Many people lost many —— during the Great DepressionMany workers lost lots of ——— during the Great Depression...

Earth Day Review 2025-05-06

10 Items: reduce, reuse, and _________month where we celebrate Earth Daythese cover more than 70% of our planetcountry where the first Earth Day was celebratedthe largest civic celebration to protect our planetinstead of buy water bottles you should use a _________one of our main problems are air, water, and ground _______...

Welsh Wordsearch 2025-04-29

15 Items: A Welsh HugA Hearty Welsh Stew"Thank You" in WelshWelsh name for SwanseaSymbol on the Welsh FlagNative Language of WalesNational Flower of WalesScenic Views near SwanseaThe Patron Saint of WalesCoastal Village in SwanseaThe Most Popular Sport in WalesThe River that runs through SwanseaThe Campus where The College is based...

39 2025-08-17

15 Items: Biker organizationKnown outlaw group.Independent biker club.Controversial U.S. club.Tool used to start a flameOutlaw club with violent past.Group ride organized by the clubMotorcycle club’s planned journeyNighttime social event for ridersTerm of endearment or a small oneSound that fuels the biker’s rideScheduled meeting of a biker group...

Berko Carnegie Wordsearch 2024 2024-04-17

7 Items: The number of shadowers in TeamBerkoThe colour in the title of the 2023 winnerTeamBerko (The name of our school shadowing group)First name of the author of the book 'Door of No Return'Name of the title character in the book by Hiba Noor KhanThe country which is the setting for the book 'Song Walker' by Zillah Bethell...

Ancient Greece Gods And Goddess Word Search! 2025-11-11

10 Items: The god of warThe god of fireThe god of musicThe leader of the godsThe god of sea and oceansThe goddess of war and wisdomThe goddess of love and beautyThe goddess of fields and farmingThe goddess of hunting and animalsThe wife of the leader of the gods and is the goddess of marriage and family

Homophones Find-a-Word 2025-10-05

16 Items: a male child: ____________in this place: ____________also or as well: ____________the number after one: ____________a large strong wild animal: ____________to plant seeds in the ground: ____________water that falls from the sky: ____________correct or the opposite of left: ____________to exchange something for money: ____________...

Science trivia jorge-Zachary-Dylan-Isabella 2023-05-06

6 Items: It’s the country where it is The Eiffel tower.It’s a thing that you use to clean your clothes.It’s the person who was the best president of USA.It’s the person who has created the most popular phones.It’s the city where it is Cristo Rey and Parque del perro.It’s a thing that you put on your wrist and you can see the time.

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

The Perfect Cozy Night-In 2025-12-04

8 Items: A classic holiday romcomA must have for cold feetThe best beverage for all occasionsA classic snack choice for movie nightsMusic genre that makes the holidays magicalThe best fabric for a blanket on cold nightsStream this guilty pleasure TV show for cozy nightsThis provides calming ambiance on chilly winter nights

trs 3b w17 pt1 2022-06-01

11 Items: adj. not farn. a baby animaln. brother or sistern. a very smart personv. make something move upn. a person who makes musicv. lift up and move somethingadj. very good at doing somethingn. a big, white bird that lives on waterv. make a sound with a musical instrumentn. small sea creature that looks like it has wings

Lech Lecha 5.0 2024-11-03

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

1920s Crossword 2022-10-20

8 Items: Religion vs. EvolutionIllegal traffic in liquorWomen in the 1920s who wore skirtsContributed to the understanding of evolutionCultural revival of african-american music and artAmerican Gangster who was famous during the Prohibitiontransportation production and consumtion of alcohol now legal...

Revolutions Word Search 2025-09-19

11 Items: the state of being freeFreedom from being ruledPeople from Britain (England)A king or queen rules the countrypeople who moved from Europe to live in AmericaWashington The first President of the United StatesA prison in France stormed during the French RevolutionPeople fight against unfair rulers, sparking a big change...

Reflect Word Search 2025-04-24

14 Items: Food you eat.It holds water.Lots of colors.You dance to this.When the sun goes up.A light you can carry.When the sun goes down.A special day we celebrate.Bright, colorful lights in the sky.When you think back about something.The season of the year that has flowers.Folded paper you put money or a letter in.Something you do each year for celebration....

Lech Lecha 5.0 2024-11-09

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

Numbers and nouns 2025-05-22

13 Items: 10 x 10.Numbers from 1-10.Popular type of transport.The opposite sequence of number 3.Common fruit that is red or green.Bigger than a town, smaller than a country.Furry animal that lives in houses and barks.We read them to learn information or stories.Sequence of numbers that start with 1, 3, 5, 7, 9....

¿Quién soy yo? 2024-11-25

17 Items: writes poemsgoes to schoolsomeone how dancessomeone who makes musicsomeone who writes blogssomeone who plays soccersomeone who plays a sportsomeone who can win an Oscartrains and guides in a sportsomeone you work with in classsomeone who can play the guitarsings, writes, acts, and paintssomeone who speaks two languages...

Week 13 Words 2023-05-15

7 Items: You can put this on your food. __________When you move your body to music. ___________This is something you can eat. ______________When you say the words to a song. ____________When you think of something to do. ___________If you don't cook something, it is this. _____________When you do something over and over to get better. _______

Power and Conflict 2024-02-10

15 Items: Dem tell mePaper that lets the lightHalf a league, half a leagueHer father embarked at sunriseThree days before Armistice SundayI wander thro' each charter'd streetOn another occasion, we get sent outIn his dark room he is finally aloneI met a traveller from an antique landOne summer evening (led by her) I found...

History Chapter 31 Word Search 2024-10-25

8 Items: protection from prosecutiona ban on shipments to another countrya combination of rising prices and a sluggish economythe constitutional provision to remove a president from officea shortage in which government spending is greater than government revenuea foreign policy plan that attempts to relax, or ease, international tensions...

Spelling List 15 REVIEW- Word Search 2023-01-24

25 Items: DirtyFancySquabbleTrue FactBy AccentNot WantedNot WorkingEnter AegeanEasy to FoolMakes ThingsEmbarrassingNot ImportantNot ResistiblePhilly _______Put Back TogetherAll Around the WordCredit with a Suffix6 is _________ by 3.Think About it AegeanWOW! I am in _________!Same Weight on Either SideCan Play Music (Well at It)...

any direction Word Search 2025-08-26

11 Items: Where did sushi originate?What is the capital of Canada?what is the sigil of House starkIn which country was Elon Musk born?What color are Mickey Mouse's shoes?How many dots appear on a pair of dice?What artist has the most streams on Spotify?Which is the only body part that is fully grown from birth?...

Enjoy Shorty 2025-05-26

15 Items: A citrusCapital of OmanTo be or not to beOne of the Jackson 5Largest Greek islandThe national flower of FranceSomething you no longer get at meetingsWhat is the national animal of Scotland?What is the world's most expensive spice?What color is the skin of an adult polar bear?What is the main ingredient of a Greek tzatziki?...

Chapter 7 2024-12-18

15 Items: is when the strategy other than price is used to attract customers.refers to the financial well being of the average person in a countryis the total amount of money circulating at any one time in a countrythe highest point in the business cycle and marks the end of expansion...

Breaker Rock Beach @EBC 2024-04-26

110 Items: evesinvbsbrbsanddocktidecrabfishkingloveorcaadamjohnpaulobeyboatoceankitesbouysgullssealstruthsolidjesuscamelbiblecrossadmitwhalecoastsharksnackmusicjapanfruitrockykayakscanoesgospeldanielneedleheavensaviorshovelcraftsrangerpuffinsturtlesfriendsephesusbelieveconfessmishaelazariahcampfirestarfishpelicanstidepoolriptideswalrusessealionsgodrules...

Advent Word Search 2025-01-01

104 Items: ElfJoyOilToyCardCoalFoodGiftGoldHolyHomeHopeKissLoveNoelRoofSnowStarTreeWishYearAngelBellsCarolCheerChoirGooseHollyJesusLatkeLightMerryMusicPartyPeaceSantaTrainAdventBakingBalsamCandleChangeChurchEggnogFamilyFrostyGivingGrinchJingleMangerParadePrayerSleighSpiritStableWinterWonderWreathBelieveChimneyComfortConcertCookiesDreidelFestiveFriendsJanuary...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Acceptance Word Search 2025-11-17

100 Items: FunHatTieLoveSionPatsBellworkCampcasePensartsDalyDatesExamsRulesSimondriveMusicBooksTeamsHappyAllmanLockerFamilySmilesMarianSportsNervesGrowthHousesRecessLibraryScienceAnxietyFriendsStadiumCanteenHallwayuniformCharismClassesHopefulLeadersUniformWelcomeRespectKindnessRevisionLaughingRoutinesAssemblyBackpackMaturityMemoriesSubjectsSwimmingTeachers...

Cerys & JeD 2025-05-11

26 Items: Best Man’s nameStag do locationMake of Jed’s carBride’s first carCouples star signJed’s birth monthCerys’ birth monthWho cooks the mostFavourite lunch spotWhere did Jed proposeJed’s favourite tv showJed’s cocktail of choiceWho is the pickier eaterMain honeymoon destinationBride’s go to coffee orderCerys’ favourite video game...

GRACE & JACK 2025-08-11

20 Items: Our cat's namePeanut weights _ kgPeanut's favorite foodThe month Jack was bornThe month Grace was bornJack was born in this cityJack's least favorite foodGrace was born in this cityJack's favorite sport in winterGrace must get this twice a weekThe sport Grace is trying hard onWe were in this city for undergradThe first state we lived in together...

COLOR MY ROYALTY WORD SEARCH 2025-09-08

20 Items: King of BakgatlaFamous King Of BasothoKing of Bafokeng NationCapital City of LesothoCapital City of BotswanaA famous King of Bapedi NationWho was Kgosi Moshoeshoe's FatherWho is the father of Kgosi MogôpaKgosi Moshoeshoe's famous MountainWhich village is Kgosi Khama from?Which village is Kgosi Sebele from?Which village is Kgosi Bathoen from?...

Mike & Michelle 2025-10-20

20 Items: Groom's eye colorHoneymoon destinationThe bride's birth monthThe groom's birth monthThe couple's favorite showWhat is the bride's careerThe month the groom proposedWhat city did they first meetWhat is the groom's middle nameWhat city did the groom proposeWhat is the bride's favorite colorThe month the couple started dating...

Las vacaciones 2022-11-20

27 Items: whenI wentnormallylast yeargenerallyit is hotit rainednext yeara year agoit was hotin a hotellast summerI sunbathedit is sunnyit is rainyit was sunnyI took photoswith my parentswith my friendsI swam in the seaI visit monumentsI listen to musicI am going to stayI like taking photosI relaxed on the beachI hate visiting monuments...

Las vacaciones 2022-11-20

27 Items: whenI wentnormallylast yeargenerallyit is hotit rainednext yeara year agoit was hotin a hotellast summerI sunbathedit is sunnyit is rainyit was sunnyI took photoswith my parentswith my friendsI swam in the seaI visit monumentsI listen to musicI am going to stayI like taking photosI relaxed on the beachI hate visiting monuments...

Admire Word Search 2023-10-03

100 Items: DOhugjoycakeGIRLgownkissloveroryryansuitveilvowswifeadoreaisleblissbridebrunsFIELDdancegiftsgroomguesthollyhonorjamesjasonmusicringstoasttrustunionvenueadmirecaringcheerscoupleJOCKEYfamilynebbenoneillBEARERtravusvivianbelovedbouquetbridgetcherishembraceemeraldendlessflowersforeverfriendshusbandjourneykaitlynmagicalpassionpromiseromancesparkle...

Third Word Search 2025-05-26

100 Items: GumDayGymFunMathMuchGuggParkAreaTimeBestPensThirdWorldLunchMusicTalesNounsVerbsBonesJointGamesPartyHappyProudBooksPaperGoalsShalomMertonArcadeRecessFablesPoetryMotionTraitsHeroesEventsGrowthPencilReadingWritingStudiesScienceCursiveBretzelBittmanLibraryFictionFictionOpinionAdverbsWeatherClimatePelletsMusclesFriendsPost-itCrayonsPencilsMarkers...

Study Word Search 2025-08-18

105 Items: keyfunartwifiexamnapscooklockclubchattidygoalgrowstudycleanmusicpartyquietbillsnotesalarmpatiofloordecorrelaxfocusshareunitysmilehellotrustgamesplantlightpeacecoffeefinalsfridgesnacksloungemovieschoresdishesbudgetgradescampusenergybuzzerpostercreatehealthsafetyeventssportssignuplistenengagevisionlaundrykitchenrecycleweekendnetworkrespectfriends...

Adapt Word Search 2025-12-19

104 Items: QHARTCATDIYDOGFINFUNIBIJOYMAPBOOKCARECLIPFISHFLOWHIKEHOPEJAZZLEGOLUNAPONYRESTRIZZROCKSKOLSNOWTOOTWINGSELFADAPTBEACHBOXERBUNNYDAIRYGAMESGRACEHIPPOHUMORHUSKYINSPOMUSICPARKSPEACEPHOTOQUILTSLEEPTROUTTRUSTWEAVECOLLABDELULUENERGYGARDENHEALTHNATUREPOSSUMPURPLERASTERSTREAMTICKETVISIONAGILITYBALANCEBARBELLCAMPINGCHICKENCLAPTONCOMFORTCOURAGEFITNESSFRIENDS...

Melanie and Nathanyal 2025-09-21

50 Items: Nate’s dream carTheir street nameName of their dogNate’s high schoolBride’s first nameGroom's middle nameBride’s middle nameMelanie’s high schoolDay of their proposalMelanie’s Toyota modelMonth they got engagedNate’s gaming platformNate’s Ford truck modelNate’s type of chemistryWord on Melanie’s tattooCity they love living in...

Louis & Andrea, word search of us 2014-02-12

109 Items: BBQXOXTeaTryLoveHugsTimetaleLifeMoveLouisDerbyPizzarollsCallsBlissFairyGalloCouchMusicAndreaCoffeeHeartskissesDreamsVisitsDreamsWalletThreadImpactFamilyDunkinMyloveCuddleOctoberFloridaWalmartPrayersPassionEndlessCookiesBelieveTrinketTheDerbSnuggleILoveyouEvermoreTogetherGinuwineDevotionPatienceTheHouseAquariusCoolattaSeptemberIadoreyouFifteenth...

Do Word Search 2023-05-17

28 Items: hooverget upget homego to bedwatch DVDsplay chesshave lunchgo shoppingget dressedhave dinnerdo homeworkwash the cartidy my roomsurf the Netgo to schoolhave a showerdo the washingread magazineshave breakfastlisten to musicbrush my teethgo to the cinemaclean the windowsdo the washing-uptalk on the phonetake out the rubbishhang out with friends...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Leon & Beth 2024-05-25

28 Items: Leon's jobTheir dogs nameLeon's best manLeon's first carMonth of proposalBeth's birth monthLeon's middle nameBeth's middle nameLeon's birth monthBeth's favourite beachLeon's favourite colourUniversity Beth went tooBoth of their eye colourLeon's favourite cuisineNumber of Leon's siblingsPlace that they first metCity that they got engaged...

The Jefferson Era 2024-09-03

20 Items: legal authorityprotection moneyleader of the Shawneeloose constructioniststaxes on imported goodsstrict constructioniststype of wagon used to move westhero of the battle of new orleanstreaty that ended the war of 1812site of the death of "The Prophet"explored the purchase north and westexplored the purchase south and west...

Vocabulary Word Search 2025-10-27

26 Items: cruelfunnya ditchto overpowerwarm welcometo be disloyalslightly scaredgiving off lightdeep understandingwalk slowly with swagserious, sometimes sadto control or influenceimpossible to understandunnecessary or repetitivemain character, “good guy”to enter a place forcefullyimpossible to express in wordsafflicted by something painful...

Beauty in the Decay 2025-07-21

3 Items: MusicHealing Charismatic Enigma Cripple Loved Pillow Trees Chamomile WholeImmaculate Decay Dragonfly Dimond Lavender Laughter Ladybug Butterflies Rainbows PINK Microphone Audience FRIENDSHIP Crohns Arthritis immunocompromised romantic

Admire Word Search 2023-10-02

100 Items: DOhugjoycakeGIRLgownkissloveroryryansuitveilvowswifeadoreaisleblissbridebrunsFIELDdancegiftsgroomguesthollyhonorjamesjasonmusicringstoasttrustunionvenueadmirecaringcheerscoupleJOCKEYfamilynebbenoneillBEARERtravusvivianbelovedbouquetbridgetcherishembraceemeraldendlessflowersforeverfriendshusbandjourneykaitlynmagicalpassionpromiseromancesparkle...

Advent Word Search 2023-12-17

104 Items: joyoiltoycccdebsamhopelovenoelpineroofstarmarkangelbellscidergoosehollyjesuslatkemerrymusicpartypeacesantaelmerjesisadventbakingbalsamcandlechurcheggnogfamilyfrostygivinggrinchiciclelightsmangernutmegsleighstablewinterwreathbaileyemmetthuntermaddiepicklesnojamthejarjessusjeesuschimneycookiesdreidelfriendsmenorahpageantpresentscroogesnowmancollege...

Winter/Christmas Wordearch 2024-11-22

110 Items: hatpieicebadredfuntreesnowsledcoatstarcoalparkcakemilksaltconelistgoodgoldbowsjudeigloohappyjollysantascarfbootspartybellsmusicgreenmagicjamesshovellightscarroteggnogsleighbeanieturkeymovieswinterauroraglovesbasketcandleskiingangelsgamilygrinchsilveryellowspiritfamilyjackieameliasnowmanpopcorncookiespenguinskatingchimneybrowniemarketslettersanimals...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Walker Filtration Oct 2025 2025-07-03

24 Items: AftershaveNoddys mateThe big blueLarge planetRed and juicyBlack and redType of appleType of appleHome of MickeyLargest house catBoiled or pickledH R Giger creationSlang for NewcastleTakes arial footageDave sings for theseElephant with big earsSome like it some dontSinger from North EastDave drummed for theseListen to music on these...

Vocab 4 word search 2025-09-25

20 Items: indisputableto put up withharsh criticismto pass on, giveextremely skilledto soften in temperto stick to somethingincorrect, misleadingan emotion of sympathyquiet, modest, reservedvaried, diverse in characterbrief and direct in expressiondeceitful, cunning, sly behaviorto wipe out, obliterate, rub awaylogically consistent, intelligible...

Adapt Word Search 2025-12-19

104 Items: QHARTCATDIYDOGFINFUNIBIJOYMAPBOOKCARECLIPFISHFLOWHIKEHOPEJAZZLEGOLUNAPONYRESTRIZZROCKSKOLSNOWTOOTWINGADAPTBEACHBOXERBUNNYDAIRYGAMESGRACEHIPPOHUMORHUSKYINSPOMUSICPARKSPEACEPHOTOQUILTSLEEPTROUTTRUSTWEAVECOLLABDELULUENERGYGARDENHEALTHNATUREPOSSUMPURPLERASTERSTREAMTICKETVISIONAGILITYBALANCEBARBELLCAMPINGCHICKENCLAPTONCOMFORTCOURAGEFITNESSFRIENDSGLITTER...

Indian Wedding Word Search 2025-05-17

10 Items: Indian Wedding (Shaadi)Indian Engagement (Sagai)Hindi word for Groom (Dulha)Hindi word for Bride (Dulhan)Celebration with music and dance (Sangeet)Pre-wedding ritual involving turmeric (Haldi)Procession following Groom to Bride's house (Baraat)Palanquin that carries Bride after the wedding (Doli)...

POSTIES 0708 BIG READ 2024-06-10

6 Items: another word for "reporter"negative feelings that people have about somethinga disease that spreads over a whole country or the whole worldsomething that you wear over part or all of your face in order to protect itThe book "Pandemic Minds" includes _____ with different people such as doctors, mothers and young children....

POSTIES 0317 COVER 2025-02-20

6 Items: activities that involve breaking the lawKowloon Walled City was also called the “City of _____”.a building built in order to defend an area against attackan area that is governed by people from another, more powerful, countryKowloon Walled City was the inspiration for the ______ neighbourhood in the Batman Begins movie....

Newton's Laws of Motion 2024-02-07

6 Items: came up with the lawsa material thing that can be seen and touchedthe action or process of moving or being moveda vehicle's capacity to gain speed within a short timestrength or energy as an attribute of physical action or movement...

Happening this Summer 2025-05-30

16 Items: Guy Fieri's WWWMusic for everyoneLights the evening skyMakes the water sparkleAnnual Summer sky eventAnnual Trash Pick-up in ACMassages,Facials,TreatmentsAnnual Festival in Mays LandingCool off and ride the waves in itOffered at Superfrico after dinnerToga Bar and Superfrico Entertainment$1,500,000 Sweepstakes May 24-August 31...

Common musical Instruments 2024-08-24

8 Items: - A string instrument played with a bow.- A brass instrument with a powerful sound.- A wind instrument with a high, clear sound.- A woodwind instrument developed by Adolphe Sax.- A string instrument often used in popular music.- A keyboard instrument with hammers striking strings.- Percussion instruments that produce sounds by being struck....

Democracy vs. Republic 2023-09-19

5 Items: power of a group by the majority of its membersthe ability to do something or act in a particular waypower is held by the people and their elected representativea body of fundamental ideas according to the country or organization is to be governeda form of indication of a choice between two or more candidates; expressed typically through a ballot

scrib/script/graph review 2025-12-07

9 Items: a person who writesto write how something looksa written order from a doctormap making, the writing of mapsstory of ones life written by that persona devices that writes the earth's movementsa device that play music written on vinyl disksa beginning, middle and end of a collection of sentences...

Listen Word Search 2023-12-13

12 Items: You make food to eat.You do this with music.You say the numbers out.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words on a book.You do this in a swimming pool.Birds do this with their wings.You use a finger to show an object.You make pictures with pencils and color pencils.

Revolutions Word Search 2023-10-12

10 Items: emperor-ruler of an empiretrade-napoleon prevented trade with great britainoppression-people were oppressed in france and haitiestates-three estates that sectioned people into classesguillotine-weighted blade that was used to behead peopleliberate-setting countries free from rule by other countries...

Sunnyfield Carnival 2025-09-25

5 Items: 🎈 | PONY 🐴 | MAGIC 🪄 | TOY 🧸 | SONG 🎶🎢 | FUN 😄 | FOOD 🍔 | TENT ⛺ | PARADE 🎉🤡 | MUSIC 🎵 | DANCE 💃 | GAME 🎯 | PRIZE 🏆🎫 | POPCORN 🍿 | CANDY 🍬 | TARGET 🎯 | DRUM 🥁🤹 | MASK 🎭 | FUNFAIR 🎡 | COTTONCANDY 🍭 | FERRISWHEEL 🎠

1.The 1950s saw the rise of the rock and roll genre, which was heavily influenced by African-American music. 2023-03-03

20 Items: souldoowopmotownthetwistbillhaleydickclarkchuckberryfatsdominobuddyhollysunrecordsedsullivantheplattersthecoastersthedriftersstaxrecordselvispresleylittlerichardjerryleelewisrhythmandbluesamericanbandstand

IMPORTANT YEARS IN BARBADIAN HISTORY - The solution to each clue is an important year in Barbadian history and can be found in this number search. 2024-11-19

10 Items: The year of Bussa’s slave revolt.The year Barbados became a republic.The year rioting broke out Barbados.The year we became an independent country.The birth year of our newest national hero.The year the Father of Independence was born.The year the English first arrived in Barbados.The year that all slaves in the British Empire became free....

Vocabulary Words 2024-12-04

10 Items: bring (something) to an end.keep safe from harm or injury.the ability to do something that frightens one.a belief that someone will or should achieve somethingthe study of past events, particularly in human affairs.combine (one thing) with another so that they become a wholeperceive the intended meaning of (words, a language, or a speaker)....

Occupations and Professions 2025-04-14

10 Items: LITERARY : Related to literature or writing.TEACHER : A person who educates and instructs students.BOTANIST : A scientist who studies plants and plant life.ARCHITECT : A person who designs buildings and structures.HISTORIAN : A person who studies and writes about history.PHYSICIAN : A medical doctor who treats illnesses and injuries....

Eleanor Ch.4 2025-11-11

10 Items: CancelOffical statemantA crop produced mainly for sailA group of people that make lawsOne who opposes official or commonly held veiwsA government in which citizens hold the power to ruleA freedom people possess relating to life, liberty, and propertyA statement or action expressing disapproval of or objection to something...

Idaho Word Search 2025-11-24

10 Items: a very warm temperaturethe second best type of piea plant that grows on the cobbboil 'em, mash 'em, put 'em in a...the best type of pie (made with nuts)a dark, slimy substance we pour over fooda holiday where americans eat more than they shoulda place where the people love trucks, mountains, and trying to be country...

Country Word Search 2024-11-25

1 Item: , thriving, worldwide, rich, cosmopolitan charm, supportive, inflated, loneliness, migration, expansion

Hidden Formation 2025-09-19

18 Items: SORRYHOLDUPSIXINCHFORWARDFREEDOMALLNIGHTFORMATIONLOVEDROUGHTSANDCASTLESDADDYLESSONSPRAYYOUCATCHMEDONTHURTYOURSELFThe tennis legend who made a cameo dancing in the “Sorry” music video.Beyoncé and Jay-Z’s daughter who appears in family visuals within the film.Beyoncé’s hometown, where much of her style and storytelling roots trace back....

The Power of Music- The answers from the Scavenger Hunt side are what you are searching for in the wordsearch! 2025-04-30

20 Items: TwoFiveFlagFourSevenPabbieSwedenBelongSpokenHarmonyMacHuffSixteenWildcatsScotlandStrongmanBeethovenWisconsinSandwichesHurryScurryTwentyeight

LAST DAY OF SCHOOL 2024-05-30

35 Items: - A member of the SenateThe leader of a state governmentThe part of government that makes lawsThe leader of a city or town governmentThe process of choosing leaders by votingA change or addition to a constitution or lawDuties or things that people are expected to do- The process of running for a political office...

Jacob Word Search 2024-07-31

3 Items: FANTASYISLAND FUNFAIR ARCADE SANDCASTLEMUM GRANDAD GRANNY KAINE ANGEL ALLAN SKEGNESS WACKYRACESSEA SHELLS SAND WAVES ROCK SUMMER SUN CARAVAN MUSIC FISHANDCHIPS HAT SWIMMING ICECREAM SLUSHIE SEAL SUNCREAM FAMILY

Environmental Justice 2023-12-12

4 Items: Country known for e-waste management.The equitable exposure to environmental good and harm.All items of electrical and electronic equipment and its parts that have been discarded without the intent of re-use....

One Team, One Mission Word Search 2025-05-13

15 Items: North ____ HealthcareOne ____, One MissionHigh ______ OrganizationNCH embraces a ______ cultureToday (Thursday)'s dress-up themeBehavior Standard beginning with CAcronym for our new standards of behaviorA week-long opportunity to celebrate our staffAt NCH, we engage in open and ___________ communication...

Environmental Justice 2023-12-12

4 Items: Country known for e-waste management.The equitable exposure to environmental good and harm.All items of electrical and electronic equipment and its parts that have been discarded without the intent of re-use....

Gobi Search 2023-04-11

7 Items: Gobi’s ownerThe dog that went missingA foot race longer then a normal marathoncountry of eastern Asia bordering on the Pacifica city in and the capital of Scotland, in the SE part: administrative center of the Lothian region.contests to determine which of the competitors is able to run a certain distance in the shortest time....

MS13 Ch 4 Vocab 2025-02-13

62 Items: waswarwaswentsidefromsamejailmadesafejobswerecamelivewerebreedworldpeacebordermessesbetteralmostthingstowardeitherpassedseasonwelfarestreetsstrangeworriedwe knewcountryhow manytogetheremigrateunstablethey leftthey grewthey knewsurpassedthey tookchildhoodthey paidhandcuffsatmospherethey couldwas calledthey foundthey facedthey wantedinseparable...

trs22 5b bt4 wk14 pt2 2022-07-05

13 Items: n.How fast something is.v.Think someone is very good.n.A very small branch of a plant.n.For example, Beaufort or Celsius.n.The arms of trees which grow from the trunk.n.What happens as a result of doing something.v.Talk about how something looks or what it does.v.Make a smart guess using the information you have....

4/23 Italian Word Search 2025-04-18

10 Items: a female ballet dancer – __________the text or script of an opera – __________coffee with steamed milk and foam – __________a mural painting done on fresh plaster – __________short, detached musical notes or sounds – __________a narrow, flat-bottomed boat used in Venice – __________a criminal group, especially with Italian roots – __________...

Posties Nov 20 Teens making a difference 2023-10-13

6 Items: another word for "rubbish"alone or without other peoplea person who flies an aircrafta film or television or radio programme that gives facts and information about a subjecta person who has come to live permanently in a different country from the one they were born in...

Adjectives 2022-06-04

23 Items: square, roundwarm, cool, hotold, young, newMexican, Peruviantall, massive, hugered, orange, yellowwooden, glass, metalHis father died. He isAnother word for joyfulthree, ten, a few, severaldelicious, charming, cleanA man that is 6 feet tall isThe country home was very...The man was 3 feet tall. He isShe is only 3 years old. She is...

palabras compuestas 2025-10-06

30 Items: latas/ cansabrir/ to openmedio-dia/noonsubibaja/ seesawdescarado /cheekypelirrojo/red hairparasol/sun stoppersinsentido/nonsensellovizna/light rainduermevela/sleepwalkcorreveidile/a gossipclaroscuro/chiaroscrovaiven/ back and forthaltibajo/ups and downssordomudo/deaf and dumbgrande a big housepararrayos/lightning rodhazmerreir/make me laugh...

Aracely & Owen 2025-11-30

25 Items: the best mantheir first jobtheir dog's namethe maid of honortheir wedding venuethe grooms birth monththe brides birth monththeir first dance songtheir favorite sport teamthe couple college mascotBrides go-to coffee orderthe groom's favorite colorthe month they got engagedthe bride's favorite colorthe groom's favorite sport...

word serch 2025-01-07

15 Items: Very dry, lacking moistureThe study or record of past eventsShowing persistent, careful effortMutual trust, friendship, and loyaltyShowing kindness, goodwill, or a desireTo keep something safe from harm or danger.To grasp the meaning, significance, or natureA period when a country is not involved in war....

Pullfactor Word Search 2025-12-12

15 Items: formal name for a countrythe rapid spread of an ideawhere an idea or culture originatesshared values, beliefs, traits of a groupa factor that attracts people to move therea religion that doesn't seek more followersthe spread of an idea by people moving placesthe ability to handle own affairs independently...

word serch 2025-01-07

15 Items: Very dry, lacking moistureThe study or record of past eventsShowing persistent, careful effortMutual trust, friendship, and loyaltyShowing kindness, goodwill, or a desireTo keep something safe from harm or danger.To grasp the meaning, significance, or natureA period when a country is not involved in war....

Who is Katy Perry? 2025-05-19

10 Items: What month was Katy Perry born?What is Katy Perry's real name?What age did Katy Perry start singing?How many #1 hits does Katy Perry have?Which is one of Katy Perry's top songs?How many children does Katy Perry have?What state is Katy Perry originally from?What year Katy Perry become a famous singer?What Genre music does Katy Perry specialize in?...