communication Word Searches

WORD SEARCH- TLE 4 2025-08-09

1 Item: Minicomputer, devices, supercomputer, communication, information, recordkeeping, software, hardware, components, operations, techniques, internet, virus, authentication, word processor, microsoft word, powerpoint presentation, microsoft excel, document

Workplace Incivility 2024-11-30

10 Items: an authoritative rule dealing with details or procedure.relating to relationships or communication between people.the person who leads or commands a group, organization, or countrythe action of working with someone to produce or create something.a state of emotional, physical, and mental exhaustion caused by excessive and prolonged stress....

A Word Search Across Borders 2025-02-25

1 Item: Language, Culture, Hofstede, Communication, Individualism, Multilingualism, Identity, Ethnicity, Language Barriers, Globalization, Expressions, Body Language, Respect, Hierarchy, Directness, Tone, Translation, Interpretation, Self-expression, Harmony, Co

City Word Search 2025-04-14

1 Item: Year provides service, volunteering, community, education, youth, schools, support, mentoring, tutoring, development, skills, experience, growth, impact, opportunities, leadership, teamwork, communication, collaboration, students, learning, engagement, Am

Mental & Emotional Health - 7th & 8th Grade 2026-04-22

1 Item: Feelings, Mood, Self-esteem, Identity, Confidence, Awareness, Expression, Stress, Anxiety, Depression, Resilience, Coping, Balance, Wellness, Mindfulness, Breathing, Relaxation, Exercise, Meditation, Journaling, Support, Strategy, Communication, Empathy,

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

Nervous System 2025-03-14

17 Items: Specialized cells that transmit nerve impulses.Nervous System (CNS) Comprises the brain and spinal cord.Nerves Nerves that carry commands from the brain to muscles.The part of the brain that coordinates movement and balance.The junction between two neurons where signals are transmitted....

WEDNESAY WORD SEARCH 2025-10-09

1 Item: COMPLIANCE REGULATORY QUALITY INSPECTION MORTALITY CULTURE OF SAFETY, INFECTION CONTROL, PROCESSES, AVOIDABLE, OUTCOMES, RISK MANAGMENT, VALIDATION, VALUE, COMPLICATION, PATIENT RIGHTS, PERFORMANCE, OPPORTUNITIES, COMMUNICATION, EFFICIENCY, DATA DRI

Stay Aware, Stay Compliant 2024-10-15

5 Items: Intrusive software designed to infiltrate a computer system without the owner’s informed consent.Is defined as an uncontrolled unplanned fire that spreads rapidly through areas of combustible vegetation, such as forests, grasslands or brushlands....

Five Themes of Geography 2024-06-11

19 Items: a locationhighways...etc.)a place where a particular point or object exists.measures the distance north or south of the equatorways that people interact with space, and vice versameasures the distance east and west of the Prime Meridianthe four main compass directions; north, south, east, and west...

Modules 2 & 3 Review 2025-02-06

11 Items: Domain in which motor skills are included.These are detailed, objective, and accurate.Can be informal, formal, and can track benchmarks.Domain in which language and literacy are included.Domain referring to a child's ability to think & reason.Domain in which children develop autonomy or independence....

Memorial Day, A&G NEWS. 2022-05-30

232 Items: awejoykinmayWarbanddutyflagfoodherohomehopejoinkeenlifelovepompwaveZealzestbatonbirthblastciviccorpsdreamfeastfree,glorygoalsgravemarchmusicpeacepridequickquietstarsunifyunionunitevalorYearnanthemardentcombatcommonendureenergyequinefamilyheraldhoorayIdealsjoyfuljoyousmutualnationnativeparadepicnicprayerpublicquaintrightssaluteshrineslogansolemn...

tester23 2023-03-18

245 Items: codaâmeartbiochidayareaauraautoâyurbachbodycampcodecoldcropdéfidéjàdénidheaalphaamwayangesappelarchebaccibiaisbiblebijoubonneboulebrainbrownbyrnecayceclarkcordecorpscourscultedabicdébutakashaanoxieapportarchéoashtarastralavatarbamboubarnumbarronbetterbrightbunyipbuttarcabalecannoncartescasquecécitéchaînechampscharmecherrychopraclimatcônagecrânes...

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

Hbybgy 2026-03-25

239 Items: ArtJoyNapTeaZenBathCalmCareCozyHomeLoveRestWalkYogaZestDanceFocusHabitHobbyMusicPeaceSleepSpaceBakingBudgetCandleCardioCraftsDIYSpaEnergyGrowthNatureShowerUnplugUnwindWarmthBalanceBedtimeBlanketCheckInClarityComfortCookingDrawingFinanceHygieneLaundryReadingRoutineSilenceSoloArtSpaBathSpaTimeSuccessSunbathSupportTherapyTidyingWorkoutWritingAmbience...

Nursing Shortage 2024-04-07

15 Items: What primary focus guides the efforts of nurses in healthcare settings?What term describes the insufficient number of available nurses in healthcare settings?What strategy aims to keep nurses in their current positions within healthcare institutions?What paramount concern guides the actions of nurses and healthcare providers in their duties?...

Socioeconomic Disparity Word Search 2023-11-29

4 Items: What type of disparity refers to the unequal distribution of economic resources and opportunities among different individuals or groups within a society?What is the communication model discussed in the presentation that helps determine the extent of a patient’s understanding of health information and instructions?...

Chapter 15 Vocab 2026-05-13

15 Items: Indian soldiers who served in the British colonial army.The working class in society, especially industrial laborers who earn wages.The right of foreigners to be exempt from the laws of the country in which they are living.The belief that stronger nations or people naturally dominate weaker ones through competition....

BRAIN DISSECTION 2025-08-04

12 Items: Fold or curve on the surface of the brain.Groove or crevasse on the surface of the brain, creating the gyri.Three membranes around the brain that provide protection and support.Bulb Neural structure responsible for olfaction, or our sense of smell.This lobe controls our sense of hearing and is important for language because it processes sound....

ANIMAL TRAITS 2025-09-09

1 Item: cats, cleverness, communication, Cunning, danger ,Deception,dog, dolphin, fox, friendship ,grace ,hard ,horse, Independence, Intelligence, leadership, lion, Loyalty, Memory, mystery, owl, patience, Playfulness ,snake, Speed Strength ,Teamwork, tiger, wis

Digestive System 2026-03-05

20 Items: simple sugars build thisamino acids are building blocks ofThe digestive system is made up of thisFatty acids are the building blocks for thisaids in digestion and blood sugar regulationthe smallest part of your pancreas is located near thethis type of organ includes the small intestine and esophagus...

Abnormality Word Search 2026-03-04

250 Items: egobiasfeargoalhopemoodcaregritcalmbraindrivefocushabitlogicpanicshamesleeptrustworrydreamdriveaffectapathybeliefcopingdenialesteemlibidomemorymentalneuronphobiapsycherecallrewardstresssymboltraumavaluesvisiongrowthwisdomanxietyarousalbipolarbondingdefenseemotionempathyfantasyfeelinggestalthealingimpulseinsightneglectopiniontensiontherapythought...

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

Words related to Culture 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

2408 HVAC 2026-02-07

23 Items: The CO in HPCOThe "A" in BAS.The "H" in HVAC.NEC article 424.19 covers this.Another name for an airflow switch.An alloy of steel containing 36% Nickle.another name for a semi-hermetic compressor.Another name for a Freeze Protection ThermostatA high temperature limit switch helps prevent this.In a thermostat this is the cooling control wire color....

Academic Word Search 2026-03-08

250 Items: ARTBUSFUNLABTAGBANDBELLBOOKCLUBDATADESKDOOREXAMGLUEHALLIDEALOCKNOTEPLAYQUIZRICETEAMATLASCARDSCHAIRCHESSCLASSDRAMAESSAYFOCUSGAMESGOALSGROUPMEDALMUSICRULESSLIDESTAGESTUDYTRACKTUTORBINDERBURGERCODINGDEBATEEFFORTERASERFRUITSHEALTHLAPTOPLOCKERMARKERNAPKINOFFICEPENCILRECESSREVIEWSAFETYSOCCERSPORTSSTAIRSTABLETTROPHYVIOLINWARMUPADVISORALGEBRAARTROOMBIOLOGY...

Diesel Laptops Call Training 2024-12-16

16 Items: platform used to make callscustomer support direct phone numberday of the week Technical Support is not openwhere you do in SF to find a list of all past ticketstimeframe standard for customer outreach on new ticketin SF this is where you would go to find related pictures on your case...

Culture Word Search 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

My Honey Bunches Word Search 2025-02-14

1 Item: bunches sunshine Texas salad love redneck lesbian love deposits love languages trust commitment truth communication calm, harmony respect dependability optimism together equal workitout emotions cuddle touch share happiness kindness integrity boundaries p

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

Definition Report Words 2026-02-06

12 Items: a person or thing equal or similar to anotherThe emotions or conduct of friends; the state of being friendssomething that manifests, embodies, or symbolizes something elsea succulent plant with a thick, fleshy stem that typically bears spinesAn unintended hole, crack, or the like, through which liquid, gas, or light enters or escapes...

Theatre Arts Vocabulary 2026-05-15

34 Items: main characterto leave the stageon the visible stageto raise the curtainoff the visible stagenonverbal communicationto stop action; to omitto move onto the stage.the analysis of a characterthe main characters in a playthe main characters in a play.the scenery for an act or scenean acting role with very few lines.creating and developing a character....

Language Word Search 2025-02-24

20 Items: a describing wordsimilar to Judgingthe study of spacea country in europeanother word for a cliffan army of roman soldiersrelating to, using, or resembling magic.long narrow hilltop, mountain range, or watershed.a soft, white or clear mineral that's made of calcium sulfatehaving or showing a mild, kind, or tender temperament or character....

Healthy vs Unhealthy Relationship Characteristics Word Search 2026-04-23

16 Items: Feeling cared for and respected.Agreement as to action or opinion. Required, every time.Each partner should speak honestly and openly to avoid miscommunication.One dating partner feels that he or she "cannot live without" the other.Your partner gets angry easily and you don't know what will set them off....

International Business Etiquette 2 2024-09-05

22 Items: Avoid ___________________ and high pressure talk.Do not ___________________ touch your Chinese colleagues.As of 2008, Germany was global leader in ___________________.Most business meetings are conducted over ___________________.___________________ is the most widely spoken language in Europe....

The Boy Who Harnessed the Wind Vocab #1-3 2025-10-02

33 Items: very thinto mock or insultto produce or makeconfusion or disorderunstable or unbalancedto set up or to establishto control in order to usean extreme shortage of foodluck or chance in the futurean honor or a special benefitto be kept active or energizedto let loose or set into motionhaving a sweet or pleasant smellto figure out, solve, or plan ahead...

1920s Culture Review 2026-04-23

35 Items: of banning alcoholthe “affordable car”opened communicationpropaganda for shoppingLindy, Charleston, Tango(2 words) jobs for womenthe love of buying thingscenter of movie productionrelaxing and fun activities(2 words) silent film comedian(2 words) jazz artist/trumpetercar company that changed Americapopular music genre of the 1920s...

BF130 Chapter 10-17 Review 2025-10-13

13 Items: an intentional misrepresentation of a material factBreaking into a building with the intent to commit a felonyA legal doctrine indicating that parties meant to do what they did.Written defamation, or defamation published over radio or televisionan artificial, intangible entity created under the authority of a state’s law....

Combating the Opioid Crisis 2026-04-05

33 Items: A medication that blocks opioid effectsInvolving multiple healthcare professionsMoral principles guiding nursing practiceRemote healthcare services using technologyA medication used to reverse opioid overdosesMedications used to treat opioid use disorderSymptoms experienced when stopping opioid useA partial opioid agonist used in OUD treatment...

Hardware Unit Vocabulary 2025-12-11

19 Items: The "U" in "USB"A type of storage that keeps data without powerTransmits data at high speeds via light signalsCable that connects storage devices to the motherboardStores and manages files for other devices on a networkA piece of software that may need to be installed for a peripheral to work....

October Security Summit Wordsearch (Harder) 2023-08-18

20 Items: What term means having permission or approval to access something?What is the unique address used to identify a location on the internet?What term refers to the ability to enter or use a system, service, or area?What term describes a widely accepted or established norm or specification?...

College Operations Policy Word Search 2025-07-19

8 Items: An unmanned aircraft is called a _________.__________ is the acronym for the student board that reviews parking appeals.The number of days after an event that posters must be taken down or they will be removed by SEC or Campus Safety staff....

UPS Label Requests 2023-09-25

19 Items: A UPS label requires _________ _________ to be created.On the confirmation page, what should you copy for later use?UPS labels should be created in possible __________ situations.Box 3 - What are you shipping? - What is the correct Packaging Type?Box 1 - Where is this shipment going/coming from? - What should you click?...

Northeastern Campus Resources 2026-05-19

18 Items: Cooper- University resource dogRegistrar- Information regarding transcripts, records, registration, and verificationWe Care- We Care supports students facing personal, academic, or unexpected challenges.Bouve Fellows- upper-year Bouve students who serve as peer mentors for first-year students...

Customer Engagement Hub Market: Trends, Growth Opportunities, and Regional Insights 2025-06-23

13 Items: playersdriversupdatesanalysissegmentationOpportunitiesthe rising trend of cloud-native engagement hubs and strategic partnerships among tech giants to deliver unified, data-driven customer interaction platforms globally....

Hospice Word Search 2025-08-03

28 Items: – The expected outcome or course of a disease.– Accurate recording of patient care and clinical decisions.– The process of evaluating a patient’s needs and condition.– A federal insurance program that often covers hospice care.– The act of directing a patient to hospice or other services....

Computer Vocabulary 2025-08-26

20 Items: The physical parts of a computer.It receives and sends data on computer networks.A computer that provides data to other computers.A type of memory card typically used in digital cameras.Programs that tell a computer what to do and how to do it.It stores data and instructions while the computer is working....

Unit 6 MegaPuzzle (More points!) 2026-03-26

37 Items: A test given after training endsA test given before training beginsA path for advancement within a companyCommunication teamwork and people skillsA standard used to measure training successAssigning tasks and responsibility to othersPrograms designed to build leadership skillsA person responsible for overseeing employees...

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

Agency Word Search 2026-01-28

25 Items: Basic self-care tasks such as dressing and eating essential for daily life.Complex tasks needed to support life in the home such as shopping or meal prep.A child's internal sense of power and control over their own choices and actions.A physical measure of hand power often evaluated using a specialized dynamometer....

Computer Hardware1 CAT 2023-07-24

24 Items: the computer works on the dataI am also known as optical mediaI measure your unique biological features.computer keeps a permanent record of our workPresenters use me to show their audience a presentationI am a small radio device that stores and transmit datacomputer gives feedback on the results of its processing...

Finance Vocabulary #2 2024-12-17

29 Items: the person sending the moneythe person receiving the moneypersonal identification numbercanceling a check before it is sentan extra charge assessed for a servicewhen money is withdrawn from your accountthe line on a check for your own personal notethe part of a check that requires your signaturethe first set of numbers at the bottom of the check...

EPD Word Search 2022-09-10

35 Items: Protocol 128112 _______ PersonDeterminant 105-B-4Determinant 113-B-3Determinant 118-D-3Determinant 123-B-1Determinant 132-D-1130 Theft (________)Gross and wanton indecency110 _____ (break and enter)119 Harassment / _______ / Threat102 Abuse / Abandonment / ________Examples are needles, syringes, bongs, and pipes...

brain regions 2026-01-13

19 Items: deals with visiondeals with touch, spatial orientationdeals with planning, speaking, personalityOne of the major subdivisions of the cerebral cortex:deals with auditory processing, language comprehension, memoryA limbic structure critical for forming and consolidating new long-term memories and for spatial navigation....

Constitutional Law (Protected vs. Unprotected Speech) 2023-09-22

11 Items: Direct personal insults or offensive language that is likely to provoke a violent reaction, and is not protected by the First Amendment.False statements, spoken or written, that harm the reputation of an individual or entity, potentially leading to legal action for damages....

LD Final part 2 2023-09-25

48 Items: The tab you go to to open a new claimIn claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.ANYONE is able to open a _______ ______.We base the timeframe on the ______ date.Authorization can be written or _________.When a person passes away, they are ________....

LD Final 2 2025-06-24

48 Items: The tab you go to to open a new claimIn claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.ANYONE is able to open a _______ ______.We base the timeframe on the ______ date.Authorization can be written or _________.When a person passes away, they are ________....

Illicit Drugs - Daily Review 2023-08-22

22 Items: The most common reason why people start to take illicit drugs. (9)Drugs that alter or distort the brain's perception of reality. (13)Drugs that speed up the Central Nervous System (CNS) responses. (10)Drugs that slow down the Central Nervous System (CNS) responses. (11)Drugs with multiple effects on the Central Nervous System (CNS). (5-6-5)...

Health Information Technology for Nurses 2025-08-30

25 Items: WVCThe recipient of medical care.Relating to the direct care and treatment of patients.Raw facts and figures collected about a patient's health status.A controlled set of terms used to ensure consistency in data entry and analysis.An abbreviation for Bachelor of Science in Nursing, an academic degree for nurses....

Animal Behaviors for Reproduction 2025-09-24

28 Items: One female mates with one maleOne male mates with multiple femalesOne female mates with multiple malesThe behavior patterns related to how animals mateAmphibian larvae that develop into adults without parental helpThe amount of time and resources given to the care of offspringSome animals migrate to a better environment for _____________....

Astronaut Word Search 2025-08-13

50 Items: Space where data is saved.A place to organize files.Connected to the internet.Creating software using code.The display area of a device.Not connected to the internet.A copy of data kept for safety.A portable touchscreen computer.The physical parts of a computer.Software used to access websites.Online storage for files and data....

Duo 47 2024-03-05

47 Items: credit(το) the dollar(η) the credit card(το) the social media(το) the profit, gain(τα) the social media(η) the saving, thrift,(το) the friend request(το) the social network(το) the request, demand(το) the money, capital,(η) the payment, defrayment(ο) the (economics) inflationto be increased, raised, put up(το) the coin, physical currency...

Series 6 Review 2023-07-19

75 Items: accountA radio interview is a public _________Rule 147 is regarding _______ offeringsSelling group members are paid a selling ______A final prospectus is also known as a _______ prospectusThe firm in which must complete the transfer of an accountThe “A” under discretionary orders that describes buy or sell...

LD Info Part 2 2023-09-29

31 Items: Threshold for USDA is _______.This is a digital version of a checkThreshold for Everyone else is _______.Self-repairs are subject to _______ approval.When mortgage payments are past due they are…How we determine loan status for BOA & USDA loansA W9 is needed for all banks when the loan is in…When mortgage payments are made on time they are......

Intellectual Property and Digital Media Ethics 2026-03-02

20 Items: A notorious type of malicious software that encrypts all your files and demands a payment to unlock them.This term refers to false information spread unintentionally, without a malicious motive to deceive others.This is false information that is deliberately created and spread to deceive people or cause specific harm....

We Will Rock You 2024-07-03

30 Items: Cruel and oppressive government or ruleFormal politeness and courtesy in behavior or speechNot subject to being taken away or transferred; inherentThe faculty or power of using one's will to make decisionsThe capacity to make informed, uncoerced decisions; self-governanceThe belief that free will and determinism are compatible and can coexist...

Building Relationships 2023-10-24

18 Items: A characteristic of the product or service, such as the interest rate or the term.Explicitly choosing not to do something, such as to not receive bank product literature.One seller’s portion of the total sales of a product, usually measured as a percentage of deposits....

Chapter 14 Terminology 2023-05-22

39 Items: This is the percent of time the network or service is up and accessible.Tools that can look up information such as an IP address from a domain server.This refers to redundancy to provide access in the event of component failure.A command that displays network connections for Transmission Control Protocol (TCP)....

EMU Resources 2024-08-01

10 Items: This program’s mission is to provide the Eastern Michigan University (EMU) community with both food and non-food item assistance along with additional resources to positively impact well-being and college success....

Loss Drafts Information Part 2 2023-09-20

26 Items: The longer of the two claim processes.The shorter of the two claim processes.When a person passes away, they are _________.A document proving that a borrower has passed away.This investor has a monitored threshold of $10,000.This loan type has a monitored threshold of $20,000.A court document that can replace an adjuster's report....

Loss Drafts Info Part 2 2025-06-24

26 Items: The longer of the two claim processes.The shorter of the two claim processes.When a person passes away, they are _________.A document proving that a borrower has passed away.This investor has a monitored threshold of $10,000.This loan type has a monitored threshold of $20,000.A court document that can replace an adjuster's report....

Specialized Networks 2023-04-12

37 Items: The internet of things.All SAN storage devices are called targets.A protocol used by wireless mesh networks for communication with smart devices.An IoT standards-based protocol similar to Zigbee but simpler and less expensive.This converts voice and fax calls between the PSTN and your IP network in real time....

Safeguarding Customers and the Bank 2023-10-30

26 Items: Fraud perpetrated by someone who works inside an organization.An employee who reports fraud or other wrongdoing within a company.Authentication by two or more of the following: something the user has, is, or knows.aAn area that allows computers equipped with wireless fidelity to receive internet connection....

horse trivia 2025-10-17

60 Items: an adult female horse.a castrated male horse.the hard foot of a horse.what a baby horse is called.the act of a horse giving birth.is the term for a horse's father.a mature, uncastrated male horse.a person skilled in horse riding.Howy toes a horse has on each foot.the footrests attached to a saddle.a building where horses are housed....

Services Word Search 2024-11-14

49 Items: – Government agency that promotes tourism.- What is the act of traveling to and from work called?- What is the activity of traveling for pleasure called?– The promotional name for tourism in the west of Ireland.- What is an urban railway system, often underground, called?- What primary activity involves catching fish and other seafood?...

Networking Chapter 13 Terminology 2023-05-15

31 Items: Using more than one method to authenticate users.Updates for other Microsoft products like Office.Use this command on a linux system to create a user account.This authentication type uses the unique way you do something.Non-Microsoft driver updates that are applicable to users' devices....

IB CS Network Fundamentals 2026-02-23

89 Items: Inverse of OR gate outputInverse of AND gate outputCPU with one processing unitControl system without feedbackOutputs the inverse of the inputOS handling of network communicationProduces physical movement or outputCPU retrieves instruction from memoryOutputs true when inputs are the sameCPU interprets the fetched instruction...

Abandon Word Search 2026-03-03

140 Items: ClothingAny drinkNot clearDisloyaltyExtremely hotLoss of memoryOpen to debateExtremely cruelA dividing lineStrong hostilityRelating to waterExpressed clearlyA partner in crimeAn opening or holeA qualified lawyerA careless mistakeRelating to plantsTo greatly surpriseGenuine; not a copyArea behind a stageNoisy and energeticArrested for a crime...

EVERYTHING 2025-01-25

99 Items: A WRITING UTENSILUSED TO REMOVE CLIPSTHIS PROTECTS YOUR TOESTHESE PROTECT YOUR EYESNOT FULLY SHOOTING A BOLTTHESE PROTECT YOUR HEARINGTOOL USED TO TEMP A FASTENERFILLED WITH LUBES OR PRIMERSTHIS IS WHAT ALL CARS SIT ONTHESE PROVENT ARM LACERATIONSGLOBAL AUTOMATED LINE CONTROLUSED TO HAND TIGHTEN FASTENERSTHIS PROTECTS FROM HEAD INJURIES...